[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for sent8:ACF66015.1

[Show Plain Result]

#ERROR : Can't open dsspfile "132lA.bssp"
#ERROR : Can't open dsspfile "1bb3A.bssp"
#ERROR : Can't open dsspfile "1b7mA.bssp"
#ERROR : Can't open dsspfile "1dkkA.bssp"
#ERROR : Can't open dsspfile "1a2yC.bssp"
#ERROR : Can't open dsspfile "1cj8A.bssp"
#ERROR : Can't open dsspfile "1at5A.bssp"
#ERROR : Can't open dsspfile "1c7pA.bssp"
#ERROR : Can't open dsspfile "1b5uA.bssp"
#ERROR : Can't open dsspfile "135lA.bssp"
#ERROR : Can't open dsspfile "1b5zA.bssp"
#ERROR : Can't open dsspfile "2dqaA.bssp"
#ERROR : Can't open dsspfile "1d6qA.bssp"
#ERROR : Can't open dsspfile "1ckdA.bssp"
#ERROR : Can't open dsspfile "1b7nA.bssp"
#ERROR : Can't open dsspfile "1b7qA.bssp"
#ERROR : Can't open dsspfile "1di5A.bssp"
#ERROR : Can't open dsspfile "1ckcA.bssp"
#ERROR : Can't open dsspfile "1b7sA.bssp"
#ERROR : Can't open dsspfile "1b7lA.bssp"
#ERROR : Can't open dsspfile "1b7rA.bssp"
#ERROR : Can't open dsspfile "1ckhA.bssp"
#ERROR : Can't open dsspfile "2bqnA.bssp"
#ERROR : Can't open dsspfile "1alcA.bssp"
#ERROR : Can't open dsspfile "1d0lA.bssp"
#ERROR : Can't open dsspfile "1cj7A.bssp"
#ERROR : Can't open dsspfile "1cj6A.bssp"
#ERROR : Can't open dsspfile "2cwiA.bssp"
#ERROR : Can't open dsspfile "1b5wA.bssp"
#ERROR : Can't open dsspfile "1c46A.bssp"
#ERROR : Can't open dsspfile "2bqcA.bssp"
#ERROR : Can't open dsspfile "1b5yA.bssp"
#ERROR : Can't open dsspfile "133lA.bssp"
#ERROR : Can't open dsspfile "1b7pA.bssp"
#ERROR : Can't open dsspfile "1ckgA.bssp"
#ERROR : Can't open dsspfile "1cj9A.bssp"
#ERROR : Can't open dsspfile "1bb4A.bssp"
#ERROR : Can't open dsspfile "1di3A.bssp"
#ERROR : Can't open dsspfile "1c45A.bssp"
#ERROR : Can't open dsspfile "1ckfA.bssp"
#ERROR : Can't open dsspfile "1di4A.bssp"
#ERROR : Can't open dsspfile "1b5xA.bssp"
#ERROR : Can't open dsspfile "3csrA.bssp"
#ERROR : Can't open dsspfile "1b7oA.bssp"
#ERROR : Can't open dsspfile "2bqfA.bssp"
#ERROR : Can't open dsspfile "2bqhA.bssp"
#ERROR : Can't open dsspfile "2bqdA.bssp"
#ERROR : Can't open dsspfile "134lA.bssp"
#ERROR : Can't open dsspfile "1c43A.bssp"
#ERROR : Can't open dsspfile "2bqmA.bssp"
#ERROR : Can't open dsspfile "2bqjA.bssp"
#ERROR : Can't open dsspfile "2bqiA.bssp"
#ERROR : Can't open dsspfile "2bqkA.bssp"
#ERROR : Can't open dsspfile "1b5vA.bssp"
#ERROR : Can't open dsspfile "153lA.bssp"
#ERROR : Can't open dsspfile "2bqeA.bssp"
#ERROR : Can't open dsspfile "2bqoA.bssp"
#ERROR : Can't open dsspfile "2bqgA.bssp"
#ERROR : Can't open dsspfile "2bqlA.bssp"
#ERROR : Can't open dsspfile "2bqbA.bssp"
#ERROR : Can't open dsspfile "1b9oA.bssp"
#ERROR : Can't open dsspfile "3bkhA.bssp"
#ERROR : Can't open dsspfile "1a4vA.bssp"
#ERROR : Can't open dsspfile "3cb7A.bssp"
#ERROR : Can't open dsspfile "2ebzA.bssp"
#ERROR : Can't open dsspfile "2cquA.bssp"

## Summary of PDB Search
:160
    6e-22  21%  132lA  [x.x.x] HEN EGG WHITE LYSOZYME
    3e-20  17%  1bb3A  [d.2.1] LYSOZYME
    3e-20  18%  1b7mA  [d.2.1] PROTEIN (LYSOZYME)
    4e-20  22%  1dkkA  [d.2.1] LYSOZYME
    1e-18  22%  1a2yC  [d.2.1] LYSOZYME
    2e-18  20%  1cj8A  [d.2.1] PROTEIN (LYSOZYME)
    2e-18  21%  1at5A  [x.x.x] LYSOZYME
    1e-17  17%  1c7pA  [d.2.1] LYSOZYME
    2e-17  19%  1b5uA  [d.2.1] PROTEIN (LYSOZYME)
    2e-17  22%  135lA  [d.2.1 (1dzbX)] TURKEY EGG WHITE LYSOZYME
    2e-17  16%  1b5zA  [d.2.1] LYSOZYME
    4e-17  16%  2dqaA  [x.x.x] LYSOZYME
    5e-17  17%  1d6qA  [d.2.1] LYSOZYME
    5e-17  20%  1ckdA  [d.2.1] PROTEIN (LYSOZYME)
    6e-17  22%  1b7nA  [d.2.1] PROTEIN (LYSOZYME)
    6e-17  17%  1b7qA  [d.2.1] PROTEIN (LYSOZYME)
    8e-17  21%  1di5A  [d.2.1] LYSOZYME C
    1e-16  20%  1ckcA  [d.2.1] PROTEIN (LYSOZYME)
    1e-16  23%  1b7sA  [x.x.x] LYSOZYME
    2e-16  22%  1b7lA  [d.2.1] PROTEIN (LYSOZYME)
    3e-16  19%  1b7rA  [d.2.1] PROTEIN (LYSOZYME)
    4e-16  20%  1ckhA  [d.2.1] PROTEIN (LYSOZYME)
    4e-16  21%  2bqnA  [x.x.x] LYSOZYME
    5e-16  16%  1alcA  [x.x.x] ALPHA-LACTALBUMIN
    8e-16  12%  1d0lA  [d.2.1] 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE
    8e-16  19%  1cj7A  [d.2.1] PROTEIN (LYSOZYME)
    9e-16  19%  1cj6A  [d.2.1] PROTEIN (LYSOZYME)
    1e-15  16%  2cwiA  [x.x.x] LYSOZYME C, MILK ISOZYME
    1e-15  19%  1b5wA  [d.2.1] PROTEIN (LYSOZYME)
    1e-15  21%  1c46A  [d.2.1] LYSOZYME
    1e-15  21%  2bqcA  [x.x.x] LYSOZYME
    1e-15  18%  1b5yA  [d.2.1] PROTEIN (LYSOZYME)
    2e-15  24%  133lA  [x.x.x] HUMAN LYSOZYME
    2e-15  19%  1b7pA  [d.2.1] PROTEIN (LYSOZYME)
    3e-15  23%  1ckgA  [d.2.1] PROTEIN (LYSOZYME)
    3e-15  24%  1cj9A  [d.2.1] PROTEIN (LYSOZYME)
    3e-15  20%  1bb4A  [d.2.1] LYSOZYME
    5e-15  20%  1di3A  [d.2.1] LYSOZYME C
    6e-15  21%  1c45A  [d.2.1] PROTEIN (LYSOZYME)
    6e-15  23%  1ckfA  [d.2.1] PROTEIN (LYSOZYME)
    9e-15  19%  1di4A  [d.2.1] LYSOZYME C
    9e-15  20%  1b5xA  [d.2.1] PROTEIN (LYSOZYME)
    1e-14  15%  3csrA  [x.x.x] MORPHOGENESIS PROTEIN 1
    1e-14  18%  1b7oA  [d.2.1] PROTEIN (LYSOZYME)
    1e-14  25%  2bqfA  [x.x.x] LYSOZYME
    1e-14  20%  2bqhA  [x.x.x] LYSOZYME
    1e-14  26%  2bqdA  [x.x.x] LYSOZYME
    2e-14  19%  134lA  [x.x.x] HUMAN LYSOZYME
    3e-14  19%  1c43A  [d.2.1] PROTEIN (HUMAN LYSOZYME)
    3e-14  24%  2bqmA  [x.x.x] LYSOZYME
    3e-14  26%  2bqjA  [x.x.x] LYSOZYME
    3e-14  26%  2bqiA  [x.x.x] LYSOZYME
    4e-14  25%  2bqkA  [x.x.x] LYSOZYME
    1e-13  22%  1b5vA  [d.2.1] PROTEIN (LYSOZYME)
    1e-13  18%  153lA  [x.x.x] GOOSE LYSOZYME
    1e-13  25%  2bqeA  [x.x.x] LYSOZYME
    2e-13  26%  2bqoA  [x.x.x] LYSOZYME
    2e-13  26%  2bqgA  [x.x.x] LYSOZYME
    9e-13  26%  2bqlA  [x.x.x] LYSOZYME
    2e-12  26%  2bqbA  [x.x.x] LYSOZYME
    1e-11  20%  1b9oA  [d.2.1] PROTEIN (ALPHA-LACTALBUMIN)
    1e-10  20%  3bkhA  [x.x.x] LYTIC TRANSGLYCOSYLASE
    2e-09  16%  1a4vA  [x.x.x] ALPHA-LACTALBUMIN
    1e-08  22%  3cb7A  [x.x.x] LYS-RICH LYSOZYME 2
    6e-04  19%  2ebzA  [x.x.x] REGULATOR OF G-PROTEIN SIGNALING 12
    0.001  17%  2cquA  [x.x.x] PEROXISOMAL D3,D2-ENOYL-COA ISOMERASE
:160

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MHYFFIIVIWLLSINTAWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTDLGLMQINSFH
132lA           -----------------LAAAMRHGLDNYRGYSLGNWVCAAFESNFNTQATNRNTDGSTDYGILQINSRW
1bb3A           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYAGDRSTDYGIFQINSRY
1b7mA           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNGDRSTDYGIFQINSRY
1dkkA           ----------------AAAMKRHGLDNYRGYSLGNWVCAAKFESNFNSQATNRNTDGSTDYGVLQINSRW
1a2yC           ----------------AAAMKRHGLANYRGYSLGNWVCAAKFESNFNTQATNRNTDGSTDYGILQINSRW
1cj8A           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNARATNYNGDRSTDYGIFQINSRY
1at5A           ----------------AAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTDGSTDYGILQINSRW
1c7pA           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYAGDRSTDYGIFQINSRY
1b5uA           ----------------ARTLKRLGMDGYRGIALANWMCLAKWESGYNTRATNYNGDRSTDYGIFQINSRY
135lA           ----------------AAAMKRLGLDNYRGYSLGNWVCAAKFESNFNTHATNRNTDGSTDYGILQINSRW
1b5zA           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYAGDRSTDYGIFQINSRY
2dqaA           -----------------------------MVSQKCLLCMCKLESGGCKPIGCRMDVGSLSCGYFQIKQPY
1d6qA           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNGDRSTDYGIFQINSRY
1ckdA           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRAVNYNGDRSTDYGIFQINSRY
1b7nA           ----------------ARTLKRLGMDGYRGISLANWMCLAKWLSGYNTRATNYNGDRSTDYGIFQINSRY
1b7qA           ----------------ARTLKRLGMDGYRGISLALWMCLAKWESGYNTRATNYAGDRSTDYGIFQINSRY
1di5A           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNGDRSTDYGIFQINSRY
1ckcA           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRAANYNGDRSTDYGIFQINSRY
1b7sA           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNGDRSTDYGIFQINSRY
1b7lA           ----------------ARTLKRLGMDGYRGISLANWMCLLKWESGYNTRATNYAGDRSTDYGIFQINSRY
1b7rA           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNGDRSTDYGIFGINSRY
1ckhA           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNGDRSTDYGIFQINSRY
2bqnA           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNGDRSTDYGIFQINSRY
1alcA           -----------------LSQNLYDIDGYGRIALPELICTMFHTSGYDTQAIVEN-DESTEYGLFQISNAL
1d0lA           ----------------ATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYK
1cj7A           ----------------ARVLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNGDRSTDYGIFQINSRY
1cj6A           ----------------ARALKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNGDRSTDYGIFQINSRY
2cwiA           ----------------ARKLKSMGMDGFHGYSLANWVCMAEYESNFNTQAFNGNSNGSSDYGIFQLNSKW
1b5wA           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNGDRSTDYGIFQINARY
1c46A           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNGDRSTDYGIFQINSRY
2bqcA           ----------------ARTLKRLGMDGYRGVSLANWMCLAKWESGYNTRATNYAGDRSTDYGIFQINSRY
1b5yA           ----------------ARTLKRLGMDGYRGISLANWMCLAKWEAGYNTRATNYNGDRSTDYGIFQINSRY
133lA           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNGDRSTDYGIFQINSRY
1b7pA           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNGDRSTDYGIFQINSRY
1ckgA           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNGDRSVDYGIFQINSRY
1cj9A           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNVRATNYNGDRSTDYGIFQINSRY
1bb4A           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNGDRSTDYGIFQINSRY
1di3A           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYAGDGSTDYGIFQINSRY
1c45A           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNGDRSTDYGIFQINSRY
1ckfA           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNGDRSADYGIFQINSRY
1di4A           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYN-DRSTDYGIFQINSRY
1b5xA           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNGDRSTDYGIFQINSRY
3csrA           ---------------KVNAQYILNYLSSNGWTKQGMLGNMQSESTINPGLWQNLDEGNTGFGLVQWTPAS
1b7oA           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESQYNTRATNYNGDRSTDYGIFQINSRY
2bqfA           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYAGDRSTDYGIFQINSRY
2bqhA           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYAGDRSTDYGIFQINSRY
2bqdA           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNGDRSTDYGVFQINSRY
134lA           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYAGDRSTDYGIFQINSRY
1c43A           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNGDRSTDYGIFQINSRY
2bqmA           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYAGDRSTDYGIFQINSRY
2bqjA           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNGDRSTDYGIFQINSRY
2bqiA           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNGDRSTDYGIFQINSRY
2bqkA           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNGDRSTDYGIFQINSRY
1b5vA           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYAGDRATDYGIFQINSRY
153lA           ----------------RYKTIIKKVGEKLCVEPAVIAGIISRESHAGKVLKNGWGDRGNGFGLMQVDKRS
2bqeA           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNGDRSTDYGIFQVNSRY
2bqoA           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNGDRSTDYGIFQINSRY
2bqgA           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNGDRSTDYGIFQINSRY
2bqlA           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNGDRSTDYGIFQINSRY
2bqbA           ----------------ARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNGDRSTDYGIFQINSRY
1b9oA           -----------------LSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVEN-DESTEYGLFQISNKL
3bkhA           PPIPYKTIPPTANKSRAAATPVNAVENATGVRSQLLLTFASIESAFDYEIKAKT---SSATGWFQFLTGT
1a4vA           -----------------LSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVEN-NESTEYGLFQISNKL
3cb7A           ---------------------EMYKLGVPKNQLARWTCIAEHESSYNTKAVGSNSNGSRDYGIFQINNYY
2ebzA           ----------------------------------------------------------------------
2cquA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           MKRLKKMGISEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKRSDIRKRYAKKIWENYR
132lA           WCNDGRTPGSRNLCN-IPCSALLSSDITASVNCAKIVSDGNGMNAWVAWRNRCGTDVQAWIRG-------
1bb3A           WCNDGKTPGAVNACH-LSCSALLQDNIADAVACLKRVVRIRAWVAWRNRCQNRDVRQYVQGCG-------
1b7mA           WCNDGKTPGAVNACH-LSCSALLQDNIADAVRVVRDPQGIRAWVAWRNRCQNRDVRQYVQGCG-------
1dkkA           WCNDGKTPGSRNLCN-IPCSALLSSDITATVNCAKKIVSMNAWVAWRNRCKGTDVQAWIRGCR-------
1a2yC           WCNDGRTPGSRNLCN-IPCSALLSSDITASVNCASDGNGMNAWVAWRNRCKGTDVQAWIRGCR-------
1cj8A           WCNDGKTPGAVNACH-LSCSALLQDNIADAVACAKRVVRWVAWRNRCQNRDVRQ----------------
1at5A           WCNDGRTPGSRNLCCSALLSSDITASVNCAKKIVSNGMNWVAWRNRCKG--TDVQAWIRGC---------
1c7pA           WCNDGKTPGAVNACH-LSCSALLQDNIADAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQGCG-------
1b5uA           WCNDGKTPGAVNACHALLQDNIADAVACAKRVVRDPQGAWVAWRNRCQNRDVRQ----------------
135lA           WCNDGRTPGSKNLCN-IPCSALLSSDITASVNCAKKIAGMNAWVAWRNRCKGTDVHAWIRGCR-------
1b5zA           WCNDGKTPGAVNACAALLQDNIADAVACAKRVVRDPQ-GIRAWVAWRNRCQNRDVRQYVQGCG-------
2dqaA           WIDCGKPGKD----WKSCSNDINCSSKCVQQYMKRYATCEGFAREHNGGPNGCHSSRTLKYWELLQKGCK
1d6qA           WCNDGKTPGAVNACSALLQDNIADAVACAKRVVR-EPQGIRAWVAWRNRCQNRDVRQYVQGCG-------
1ckdA           WCNDGKTPGAVNACH-LSCSNIADAVACAKRVVRDPQGAWVAWRNRCQNR--------------------
1b7nA           WCNDGKTPGAVNALLQDNIADAVACAKRVVRDPQGIRA-WVAWRNRCQNRDVRQ----------------
1b7qA           WCNDGKTPGAVNACHLLLQDNIADAVACAKRVVRDPQ-GIRAWVAWRNRCQNRDVRQYVQGCG-------
1di5A           WCNDGKTPGCSALLQDNIADAVACAKRVVDPQGIRAWVAW----RNRCQ---------------------
1ckcA           WCNDGKTPGAVNACH-LSCSNIADAVACAKRVVRDPQGAWVAWRNRCQNRDVRQ----------------
1b7sA           WCNDGKTPGCSALLQDNIADAVACAKRVVRD--PQGIRAWVAWRNRCQN---------------------
1b7lA           WCNDGKCHLSCSALLQDNIADAVACAKRVVRDPQGIRA-WVAWRNRCQNRDVRQ----------------
1b7rA           WCNDGKTPGAVNACH-LSCSNIADAVACAKRVVRDPIRAWVAWRNRCQNRDVRQ----------------
1ckhA           WCNDGKVPGAVNACH-LSCSNIADAVACAKRVVRDPIRAWVAWRNRCQNRDVRQ----------------
2bqnA           WCNDGKTPGAVNAAH-LSCDAAAAAKRVVRD--PQGIRAWVAWRNRCQNRDVRQ----------------
1alcA           WCKSSQSPQS-RNICDITCDKFLDDDITDDIMCAKKILDIKGIDYWIAHKALCTEKLEQWLCEK------
1d0lA           QYAVDFSGDGHINLW-DPVDAIGSVANYFKAHGWVKGDQV-AVMANGQAPGLPNGFKTKYSISQLAAAGL
1cj7A           WCNDGKTPGAVNACHALLQDNIADAVACAKRVVRDPQGIWVAWRNRCQNRDVRQ----------------
1cj6A           WCNDGKTPGAVNACHALLQDNIADAVACAKRVVRDPQ-GIRAWVAWRNRCQNRD---VRQYVQG------
2cwiA           WCKSNSHSACNIMCSKFLDDNIDDDIACAKRVVKDPN-GMSAWVAWVKHCKGKD----------------
1b5wA           WCNDGKTPGAVNACH-LSCSNIADAVACAKRVVRDPIRAWVAWRNRCQNRDVRQ----------------
1c46A           WCNDGKTPGAVNACH-LSCSALLQDNIADAVADPQGIRAWVAWRNRCQN---------------------
2bqcA           WCNDGKTPGAVNAAH-LSCIADAVAAAKRVVRDPQGIRAWVAWRNRCQNRDV------------------
1b5yA           WCNDGKTPGAVNACSALLQDNIADAVACAKRVVRDPQRAWVAWRNRCQNRDVRQ----------------
133lA           WCNDGKCHLSCSALLQDNIADAVACAKRVVRDPQGIRA-WVAWRNHCQNRDVRQ----------------
1b7pA           WCNDGKTPGAVNACGALLQDNIADAVACAKRVVRDPQRAWVAWRNRCQNRDVRQ----------------
1ckgA           WCNDGKTPLSCSALLQDNIADAVACAKRVVRDPQ-GIRAWVAWRNRCQNRDVRQ----------------
1cj9A           WCNDGKCHLSCSALLQDNIADAVACAKRVVRDPQGIRA-WVAWRNRCQNRDVRQ----------------
1bb4A           WCNDGKTPGAVNACH-LSCSALLQDNIADAVACLKRVVRIRAHVAWRNRCQNRD----------------
1di3A           WCNDGKTPGAVNACH-LSCSALLQDNIADAVACAKRVVRWVAWRNRCQNRDVRQ----------------
1c45A           WCNDGKTPGAVNACH-LSCSNIADAVACAKRVVRDPIRAWVAWRNRCQN---------------------
1ckfA           WCNDGKCHLSCSALLQDNIADAVACAKRVVRDPQ-GIRAWVAWRNRCQNRDVRQ----------------
1di4A           WCNDGKTPGAVNACSALLQDNIADAVACAKRVVRDPQRAWVAWRNRCQNRDVRQ----------------
1b5xA           WCNDGKTPGAVNACH-LACSNIADAVACAKRVVRDPQRAWVAWRNRCQNRDVRQ----------------
3csrA           NYINWANSQGLPSELKRIIWEVNNNAQWINLRDMTFKEYIKSTKSYERP-ANPNQPERGDQAEYWYKNL-
1b7oA           WCNDGKTPGAVNACHLLLQDNIADAVACAKRVVRDPQGIRAWVARNRCQNRDVRQYVQ------------
2bqfA           WCNDGKTPGAVNAAH-LSC---------------------------------------------------
2bqhA           WCNDGKTPGAVNAAH-LSCSALLQDADAVAAAKRVGIRAWAAWRNRCQNRDV------------------
2bqdA           WCNDGKTPGAVNAAH-LSC---------------------------------------------------
134lA           WCNDGKTPGAVNACH-LSCSALLQDNIAAKRVVRDPQGAWVAWRNECQNR--------------------
1c43A           WCNDGKTPGAVNACHALLQDNIADAVACAKRVVRDPIRAWVAWRNRCQNRDVRQ----------------
2bqmA           WCNDGKTPGAANAAH-LSCSAL------------------------------------------------
2bqjA           WCNDGKTPGAVNAAH-LSC---------------------------------------------------
2bqiA           WCNDGKTPGAVNAAH-LSC---------------------------------------------------
2bqkA           WCNDGKTPGAVNAAH-LSCSAL------------------------------------------------
1b5vA           WCNDGKCHLSCSALLQDNIADAVACAKRVVRDPQGIRA-WVAWRNRCQNRDVRQ----------------
153lA           HKPQGT-----WNGEVHITQGTTILINFIKTIQKKFPSLKGGISAYNAGAGNVRSYARMDYANDVVARAQ
2bqeA           WCNDGKTPGAVNAAH-LSC---------------------------------------------------
2bqoA           WCNDGKTPGAVNAAH-LSC---------------------------------------------------
2bqgA           WCNDGKTPGAVNAAH-LSC---------------------------------------------------
2bqlA           WCNDGKTPGAVNAAH-LSC---------------------------------------------------
2bqbA           WCNDGKTPGAVNAAH-LSC---------------------------------------------------
1b9oA           WCKSSQVPQ-SRNICDISC-DKFLDDDITDDAKKILIKGIDYWLAHKALCTEKLEQ--------------
3bkhA           WKTIENYGKYGVALRKDPRISALGAELIKENNILRPVLKRELYLAHFFGPGAARRFLTTG----------
1a4vA           WCKSSQVPQ-SRNICDISC-DKFLDDDITDDIM--CAKKILDIKGIDYW---------------------
3cb7A           WCSPPSGAFSEDFLVDSIEPAVKCAQLVLKQQGWTAWSTW------------------------------
2ebzA           -RRVASWAVSFERLLQDPVGVRYFSDFLRKEFSEENILFWQACEYFNHVPAHDKKELSYR-AREIFSKF-
2cquA           ------------------------------VKLKLYALYKQATEGPCNMPKPGVFDLINK---AKWDAWN


                         +         .         .         .         .         *         .:210
query           KLKGMSAEExxxxxxxxxxx
132lA           --------------------
1bb3A           --------------------
1b7mA           --------------------
1dkkA           --------------------
1a2yC           --------------------
1cj8A           --------------------
1at5A           --------------------
1c7pA           --------------------
1b5uA           --------------------
135lA           --------------------
1b5zA           --------------------
2dqaA           GVK-----------------
1d6qA           --------------------
1ckdA           --------------------
1b7nA           --------------------
1b7qA           --------------------
1di5A           --------------------
1ckcA           --------------------
1b7sA           --------------------
1b7lA           --------------------
1b7rA           --------------------
1ckhA           --------------------
2bqnA           --------------------
1alcA           --------------------
1d0lA           T-------------------
1cj7A           --------------------
1cj6A           --------------------
2cwiA           --------------------
1b5wA           --------------------
1c46A           --------------------
2bqcA           --------------------
1b5yA           --------------------
133lA           --------------------
1b7pA           --------------------
1ckgA           --------------------
1cj9A           --------------------
1bb4A           --------------------
1di3A           --------------------
1c45A           --------------------
1ckfA           --------------------
1di4A           --------------------
1b5xA           --------------------
3csrA           --------------------
1b7oA           --------------------
2bqfA           --------------------
2bqhA           --------------------
2bqdA           --------------------
134lA           --------------------
1c43A           --------------------
2bqmA           --------------------
2bqjA           --------------------
2bqiA           --------------------
2bqkA           --------------------
1b5vA           --------------------
153lA           YYK-----------------
2bqeA           --------------------
2bqoA           --------------------
2bqgA           --------------------
2bqlA           --------------------
2bqbA           --------------------
1b9oA           --------------------
3bkhA           --------------------
1a4vA           --------------------
3cb7A           --------------------
2ebzA           --------------------
2cquA           ALGSLPKEA-----------