[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for sent8:ACF66076.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1a6lA.bssp"
#ERROR : Can't open dsspfile "1bc6A.bssp"
#ERROR : Can't open dsspfile "1b0tA.bssp"
#ERROR : Can't open dsspfile "1d3wA.bssp"
#ERROR : Can't open dsspfile "1bluA.bssp"
#ERROR : Can't open dsspfile "1b0vA.bssp"
#ERROR : Can't open dsspfile "1bqxA.bssp"
#ERROR : Can't open dsspfile "1dwlA.bssp"
#ERROR : Can't open dsspfile "1d0cB.bssp"
#ERROR : Can't open dsspfile "1d0cA.bssp"
#ERROR : Can't open dsspfile "1durA.bssp"
#ERROR : Can't open dsspfile "1clfA.bssp"

## Summary of PDB Search
:294
    6e-15  17%  1a6lA  [x.x.x] FERREDOXIN
    3e-12  21%  1bc6A  [x.x.x] 7-FE FERREDOXIN
    6e-12  18%  1b0tA  [d.58.1] PROTEIN (FERREDOXIN I)
    3e-11  16%  1d3wA  [d.58.1] FERREDOXIN 1
    2e-10  24%  1bluA  [x.x.x] FERREDOXIN
    6e-10  17%  1b0vA  [d.58.1] PROTEIN (FERREDOXIN)
    5e-09  20%  1bqxA  [d.58.1] PROTEIN (FERREDOXIN)
    8e-08  23%  1dwlA  [i.4.1] FERREDOXIN I
    2e-06   9%  1d0cB  [d.174.1] BOVINE ENDOTHELIAL NITRIC OXIDE SYNTHASE HEME
    1e-05  13%  1d0cA  [d.174.1] BOVINE ENDOTHELIAL NITRIC OXIDE SYNTHASE HEME
    2e-05  34%  1durA  [d.58.1] 2[4FE-4S] FERREDOXIN
    1e-04  31%  1clfA  [x.x.x] FERREDOXIN
:294

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxRDYKAEVAKLIDVSSCVGCKACQVACSEWNDIRDNVGHCVGVYDNPA
1a6lA           ----------------------------------------------------------------------
1bc6A           ----------------------------------------------------------------------
1b0tA           ----------------------------------------------------------------------
1d3wA           ----------------------------------------------------------------------
1bluA           ----------------------------------------------------------------------
1b0vA           ----------------------------------------------------------------------
1bqxA           ----------------------------------------------------------------------
1dwlA           ----------------------------------------------------------------------
1d0cB           --------------------------------TYDTLCAQSQQDG--PCTP--------RRCLGSLVLPR
1d0cA           -----------------------LQEVEAEVASTGTYHLRESELVFGAKQAWRNAPRCVGR---------
1durA           ----------------------------------------------------------------------
1clfA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DLSAKSWTVMRFTETEQNGKLEWLIRKDGCMHCEDPGCLKACPSAGAIIQYANGIVDFQSEHCIGCGYCI
1a6lA           ------------------------VVTDNCIKCKYCDCVEVCP-VDCFYEGPNFLVIHP-DECIDCALCE
1bc6A           ------------------------VITEPCIGTKDASCVEVCPVD--CIHEGEDQYYIDPDVCIDCGACE
1b0tA           ------------------------VVTDNCIKCKYTKCVEVCPVD--CFYEGPNFLVIHPDECIDCALCE
1d3wA           ------------------------VVTDNCIKCKYTECVEVCPVD--CFYEGPNFLVIHPDECIDCALCE
1bluA           ------------------------------------------------------------DECINCDVCE
1b0vA           ------------------------VVTDNCIKCKYTDCVEVCPV--DCFYEGPNFLVIHPDECNDCALCE
1bqxA           ------------------------VITEPCIGTKCASCVEVCPVD--CIHEGEDQYYIDPDVCIDCGACE
1dwlA           -------------------------------------------------------IVIDHEECIGCESCV
1d0cB           KLQTRPSPGPPPAEQ-----LLSQARDFINQYYSSIKRSGSQAHEERLQEVEAEVASTGTYHLRESELVF
1d0cA           ---IQWGKLQVFDARDCSSAQE--MFTYICNHIKYATNRGNLRSAITVFPQRAGRGDFRIWNSQLVRYAG
1durA           ------------------------------------------------------------DSCIACGACK
1clfA           -----------------------YKIADSCVSCGA--CASECPVN--AISQGDSIFVIDADTCIDCGNCA


                         +         .         .         .         .         *         .:210
query           AGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCPTGAIHFGTKKEMLELGEQRVEKLKARxxxx
1a6lA           PECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQH-------------
1bc6A           AVCPVSAIYHEDFVPEEWKSYIQKNRDFFKK---------------------------------------
1b0tA           PECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPEDKDPLPDAEDWDGVKGKLQHL---------------
1d3wA           PECPAQAIFSEDEVPEDMQEFQLNAELAEVWPNITEKKDPLPDAEDWDGVKG------------------
1bluA           PECPNGAISQG-DETYVIEPSLCTECVGHYETSQCVEVCPVDCIIKDPSHEETEDELRAKYE--------
1b0vA           PECPAQAIFSEDEPEDMQEFIQLNAELAEVWPNITEKKDPLPDADWDGVKGKLQHLE-------------
1bqxA           AVCPVSAIYHEDFVPEEWKSYIQKNRDFFKK---------------------------------------
1dwlA           ELCPEVFAMIDGEEKAMVTAPDS----TAECAQDAIDACPVEAISK------------------------
1d0cB           GAKQDARDCSSAQEMFTYICNHI---------KYAT--NRGNLRSAITVFPQRAPGRGDFRIWNSQ----
1d0cA           YRQQDGSVR-------------------------------------------------------------
1durA           PECPVNIQEGSIYAIDADSCIDC---------GSCASVCPVGAPNP------------------------
1clfA           NVCPVGAP--------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1a6lA           ----------------------------------------------------------------------
1bc6A           ----------------------------------------------------------------------
1b0tA           ----------------------------------------------------------------------
1d3wA           ----------------------------------------------------------------------
1bluA           ----------------------------------------------------------------------
1b0vA           ----------------------------------------------------------------------
1bqxA           ----------------------------------------------------------------------
1dwlA           ----------------------------------------------------------------------
1d0cB           ----------------------------------------------------------------------
1d0cA           ----------------------------------------------------------------------
1durA           ----------------------------------------------------------------------
1clfA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxx
1a6lA           --------------
1bc6A           --------------
1b0tA           --------------
1d3wA           --------------
1bluA           --------------
1b0vA           --------------
1bqxA           --------------
1dwlA           --------------
1d0cB           --------------
1d0cA           --------------
1durA           --------------
1clfA           --------------