[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for sent8:ACF66317.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2a6qA.bssp"
#ERROR : Can't open dsspfile "2a6qB.bssp"
#ERROR : Can't open dsspfile "3ctoD.bssp"
#ERROR : Can't open dsspfile "3ctoB.bssp"
#ERROR : Can't open dsspfile "3d55D.bssp"

## Summary of PDB Search
:82
    5e-07  21%  2a6qA  [x.x.x] ANTITOXIN YEFM
    5e-06  22%  2a6qB  [x.x.x] ANTITOXIN YEFM
    2e-05  16%  3ctoD  [x.x.x] UNCHARACTERIZED PROTEIN RV3357/MT3465
    2e-05  19%  3ctoB  [x.x.x] UNCHARACTERIZED PROTEIN RV3357/MT3465
    3e-04  16%  3d55D  [x.x.x] UNCHARACTERIZED PROTEIN RV3357/MT3465
:82

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxTAASITELKRDPMGTFNAGDGAPVAILNRNEPAFYCVPPALYAHLMDILEDEELGRIIDERA
2a6qA           --------RTISYSEARQNLSATMMKEDHAPILITRQNGEACVLMSLEEYNSLEETAYLLRSPANIDSLK
2a6qB           ---------TISYSEARQNLSATMMKEDHAPILITRQNGEACVLMSLEEYNSLEETAY------------
3ctoD           ---------SISASEARQRLFPLIEQTDHQPVRITSRAGDA-VLMSADDYDAWQETVYLLRSPEN-----
3ctoB           ---------SISASEARQRLFPLIENTDHQPVRITSRAGDA-VLMSADDYDAWQYLLRSPENARRLMEVA
3d55D           ---------SISASEARQRLFPLIENTDHQPVRITSRAGDA-VLMSADDYDAWQETVYLLRSPEN-----


                         .         .         *         .         .         .         .:140
query           NERVIEVNIDDL
2a6qA           SGKGTEKDIIE-
2a6qB           ------------
3ctoD           ------------
3ctoB           RDKAGHSAFTKS
3d55D           ------------