[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for sent8:ACF66348.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1bxzA.bssp"
#ERROR : Can't open dsspfile "1ee2A.bssp"
#ERROR : Can't open dsspfile "2dq4A.bssp"
#ERROR : Can't open dsspfile "1e3jA.bssp"
#ERROR : Can't open dsspfile "1e3eB.bssp"
#ERROR : Can't open dsspfile "2eerA.bssp"
#ERROR : Can't open dsspfile "1d1tA.bssp"
#ERROR : Can't open dsspfile "1cdoA.bssp"
#ERROR : Can't open dsspfile "2eerB.bssp"
#ERROR : Can't open dsspfile "1d1sA.bssp"
#ERROR : Can't open dsspfile "1e3eA.bssp"
#ERROR : Can't open dsspfile "1e3lB.bssp"
#ERROR : Can't open dsspfile "1e3lA.bssp"
#ERROR : Can't open dsspfile "1axeA.bssp"
#ERROR : Can't open dsspfile "1axgA.bssp"
#ERROR : Can't open dsspfile "1a71A.bssp"
#ERROR : Can't open dsspfile "2dfvA.bssp"
#ERROR : Can't open dsspfile "3b70A.bssp"
#ERROR : Can't open dsspfile "2cd9B.bssp"
#ERROR : Can't open dsspfile "2cd9A.bssp"
#ERROR : Can't open dsspfile "2b83A.bssp"
#ERROR : Can't open dsspfile "2b5wA.bssp"
#ERROR : Can't open dsspfile "2dphA.bssp"
#ERROR : Can't open dsspfile "2cf5A.bssp"
#ERROR : Can't open dsspfile "3b6zA.bssp"
#ERROR : Can't open dsspfile "2cdbB.bssp"
#ERROR : Can't open dsspfile "3cosD.bssp"
#ERROR : Can't open dsspfile "2eihA.bssp"
#ERROR : Can't open dsspfile "2b5vA.bssp"
#ERROR : Can't open dsspfile "2cdaA.bssp"
#ERROR : Can't open dsspfile "2d8aA.bssp"
#ERROR : Can't open dsspfile "2cdbA.bssp"
#ERROR : Can't open dsspfile "2cdbC.bssp"
#ERROR : Can't open dsspfile "3cosA.bssp"
#ERROR : Can't open dsspfile "2cdaB.bssp"
#ERROR : Can't open dsspfile "2c0cA.bssp"
#ERROR : Can't open dsspfile "2c0cB.bssp"
#ERROR : Can't open dsspfile "2dm6A.bssp"
#ERROR : Can't open dsspfile "1ch6A.bssp"
#ERROR : Can't open dsspfile "2dg2A.bssp"
#ERROR : Can't open dsspfile "1dlgA.bssp"
#ERROR : Can't open dsspfile "3c3pB.bssp"
#ERROR : Can't open dsspfile "2ebjA.bssp"
#ERROR : Can't open dsspfile "2cqwA.bssp"
#ERROR : Can't open dsspfile "2c4cB.bssp"
#ERROR : Can't open dsspfile "2bryA.bssp"
#ERROR : Can't open dsspfile "3dkiB.bssp"
#ERROR : Can't open dsspfile "3c3pC.bssp"
#ERROR : Can't open dsspfile "3eeqB.bssp"
#ERROR : Can't open dsspfile "1dl5A.bssp"
#ERROR : Can't open dsspfile "3e90B.bssp"
#ERROR : Can't open dsspfile "2c4cA.bssp"
#ERROR : Can't open dsspfile "3dkiA.bssp"
#ERROR : Can't open dsspfile "3dwiB.bssp"
#ERROR : Can't open dsspfile "1dl5B.bssp"
#ERROR : Can't open dsspfile "3dwiA.bssp"
#ERROR : Can't open dsspfile "2eguA.bssp"
#ERROR : Can't open dsspfile "2dsqI.bssp"
#ERROR : Can't open dsspfile "3dwgA.bssp"
#ERROR : Can't open dsspfile "3dwgB.bssp"
#ERROR : Can't open dsspfile "3e90D.bssp"
#ERROR : Can't open dsspfile "2bhtD.bssp"
#ERROR : Can't open dsspfile "3c85C.bssp"
#ERROR : Can't open dsspfile "3e05C.bssp"
#ERROR : Can't open dsspfile "3c85B.bssp"
#ERROR : Can't open dsspfile "1a3xA.bssp"
#ERROR : Can't open dsspfile "3e05A.bssp"
#ERROR : Can't open dsspfile "3e05D.bssp"
#ERROR : Can't open dsspfile "3e05F.bssp"
#ERROR : Can't open dsspfile "1cmvB.bssp"
#ERROR : Can't open dsspfile "3c85D.bssp"
#ERROR : Can't open dsspfile "3e05G.bssp"

## Summary of PDB Search
:339
    1e-49  20%  1bxzA  [b.35.1 - c.2.1] NADP-DEPENDENT ALCOHOL DEHYDROGENASE
    3e-49  19%  1ee2A  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    4e-49  28%  2dq4A  [x.x.x] L-THREONINE 3-DEHYDROGENASE
    8e-49  29%  1e3jA  [b.35.1 - c.2.1] NADP(H)-DEPENDENT KETOSE REDUCTASE
    3e-47  19%  1e3eB  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
    9e-47  25%  2eerA  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    1e-46  19%  1d1tA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE CLASS IV SIGMA CHAIN
    2e-46  22%  1cdoA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    6e-46  25%  2eerB  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    6e-46  18%  1d1sA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE CLASS IV SIGMA CHAIN
    8e-46  19%  1e3eA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
    1e-45  20%  1e3lB  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
    4e-45  21%  1e3lA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
    5e-45  18%  1axeA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    2e-44  18%  1axgA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    2e-44  18%  1a71A  [b.35.1 - c.2.1] LIVER ALCOHOL DEHYDROGENASE
    3e-44  31%  2dfvA  [x.x.x] PROBABLE L-THREONINE 3-DEHYDROGENASE
    6e-44  14%  3b70A  [x.x.x] ENOYL REDUCTASE
    2e-43  18%  2cd9B  [x.x.x] GLUCOSE DEHYDROGENASE
    3e-43  19%  2cd9A  [x.x.x] GLUCOSE DEHYDROGENASE
    7e-43  19%  2b83A  [x.x.x] NADP-DEPENDENT ALCOHOL DEHYDROGENASE
    1e-42  20%  2b5wA  [x.x.x] GLUCOSE DEHYDROGENASE
    1e-42  19%  2dphA  [x.x.x] FORMALDEHYDE DISMUTASE
    2e-42  19%  2cf5A  [x.x.x] CINNAMYL ALCOHOL DEHYDROGENASE
    3e-42  13%  3b6zA  [x.x.x] ENOYL REDUCTASE
    1e-41  18%  2cdbB  [x.x.x] GLUCOSE DEHYDROGENASE GLUCOSE 1-DEHYDROGENASE,
    2e-41  19%  3cosD  [x.x.x] ALCOHOL DEHYDROGENASE 4
    2e-41  25%  2eihA  [x.x.x] ALCOHOL DEHYDROGENASE
    2e-41  19%  2b5vA  [x.x.x] GLUCOSE DEHYDROGENASE
    5e-41  20%  2cdaA  [x.x.x] GLUCOSE DEHYDROGENASE
    6e-41  31%  2d8aA  [x.x.x] PROBABLE L-THREONINE 3-DEHYDROGENASE
    8e-41  20%  2cdbA  [x.x.x] GLUCOSE DEHYDROGENASE GLUCOSE 1-DEHYDROGENASE,
    1e-40  20%  2cdbC  [x.x.x] GLUCOSE DEHYDROGENASE GLUCOSE 1-DEHYDROGENASE,
    2e-40  19%  3cosA  [x.x.x] ALCOHOL DEHYDROGENASE 4
    4e-40  18%  2cdaB  [x.x.x] GLUCOSE DEHYDROGENASE
    4e-35  15%  2c0cA  [x.x.x] ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN
    7e-31  15%  2c0cB  [x.x.x] ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN
    3e-28  15%  2dm6A  [x.x.x] NADP-DEPENDENT LEUKOTRIENE B4 12-
    3e-24   7%  1ch6A  [x.x.x] GLUTAMATE DEHYDROGENASE
    2e-19   6%  2dg2A  [x.x.x] APOLIPOPROTEIN A-I BINDING PROTEIN
    9e-18  11%  1dlgA  [d.68.2] UDP-N-ACETYLGLUCOSAMINE ENOLPYRUVYL TRANSFERASE
    2e-16  10%  3c3pB  [x.x.x] METHYLTRANSFERASE
    4e-15   6%  2ebjA  [x.x.x] PYRROLIDONE CARBOXYL PEPTIDASE
    2e-14  12%  2cqwA  [x.x.x] SUSHI DOMAIN CONTAINING 2
    2e-14  16%  2c4cB  [x.x.x] NEDD9-INTERACTING PROTEIN WITH CALPONIN HOMOLOGY
    9e-14  15%  2bryA  [x.x.x] NEDD9 INTERACTING PROTEIN WITH CALPONIN HOMOLOGY
    3e-12  10%  3dkiB  [x.x.x] CYSTEINE SYNTHASE B
    7e-12   9%  3c3pC  [x.x.x] METHYLTRANSFERASE
    1e-11  11%  3eeqB  [x.x.x] PUTATIVE COBALAMIN BIOSYNTHESIS PROTEIN G
    1e-10  10%  1dl5A  [c.66.1 - d.197.1] PROTEIN-L-ISOASPARTATE O-METHYLTRANSFERASE
    1e-10  18%  3e90B  [x.x.x] NS3 PROTEASE
    1e-10  16%  2c4cA  [x.x.x] NEDD9-INTERACTING PROTEIN WITH CALPONIN HOMOLOGY
    2e-10  11%  3dkiA  [x.x.x] CYSTEINE SYNTHASE B
    4e-10  13%  3dwiB  [x.x.x] CYSTEINE SYNTHASE B
    4e-10  10%  1dl5B  [c.66.1 - d.197.1] PROTEIN-L-ISOASPARTATE O-METHYLTRANSFERASE
    1e-09  12%  3dwiA  [x.x.x] CYSTEINE SYNTHASE B
    2e-09  11%  2eguA  [x.x.x] CYSTEINE SYNTHASE
    5e-09  16%  2dsqI  [x.x.x] INSULIN-LIKE GROWTH FACTOR IB
    9e-09  10%  3dwgA  [x.x.x] CYSTEINE SYNTHASE B
    1e-08  15%  3dwgB  [x.x.x] CYSTEINE SYNTHASE B
    1e-08  18%  3e90D  [x.x.x] NS3 PROTEASE
    5e-08  11%  2bhtD  [x.x.x] CYSTEINE SYNTHASE B
    1e-06  13%  3c85C  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    1e-06  12%  3e05C  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    1e-06  14%  3c85B  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    2e-06  20%  1a3xA  [c.1.12 - b.58.1 - c.49.1] PYRUVATE KINASE
    7e-05   9%  3e05A  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    7e-05  10%  3e05D  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    1e-04  12%  3e05F  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
    2e-04  10%  1cmvB  [b.57.1] HUMAN CYTOMEGALOVIRUS PROTEASE
    0.001  16%  3c85D  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    0.001  12%  3e05G  [x.x.x] PRECORRIN-6Y C5,15-METHYLTRANSFERASE
:339

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKSIVIEKPNTLTIETRALPQPAPGEVRIKVKLAGICGSDSHIYRGHNPFAKYPRVIGHEFFGVIDAVGD
1bxzA           MKGFAMLSIGKVGWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGERHNMILGHEAVGEVVEVGS
1ee2A           CKAAVLWEQKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDDHVVSGTLVA-PLPVIAGHEAAGIVESIGE
2dq4A           MRALAKLAPEGLTLVDRPVPEPGPGEILVRVEAASICGTDLHIWKWDAGRIRPPLVTGHEFSGVVEAVGP
1e3jA           LSAVLYK-QNDLRLEQRPIPEPKEDEVLLQMAYVGICGSDVHYYEHGRIADKDPMVIGHEASGTVVKVGK
1e3eB           CKAAIAWKTGPLCIEEIEVSPPKACEVRIQVIATCVCPTDINATDPKKKA-LFPVVLGHECAGIVESVGP
2eerA           MRAMRLVEIGPLKLEDIPIPKPKGSQVLIKIEAAGVCHSDVHMRQGRFGNVKLPVTLGHEIAGRIEEVGD
1d1tA           CKAAVLWEQKPFSIEEIEVAPPKTKEVRIKILATGICRTDDHVIKGTMVS-KFPVIVGHEATGIVESIGE
1cdoA           CKAAVAWEANPLVIEEIEVDVPHANEIRIKIIATGVCHTDLYHLFEGKHKDGFPVVLGHEGAGIVESVGP
2eerB           MRAMRLVEIGPLKLEDIPIPKPKGSQVLIKIEAAGVCHSDVHMRQGRDLGVKLPVTLGHEIAGRIEEVGD
1d1sA           CKAAVLWEQKPFSIEEIEVAPPKTKEVRIKILATGICRTDDHVIKGTMVS-KFPVIVGHEATGIVESIGE
1e3eA           CKAAIAWKTGPLCIEEIEVSPPKACEVRIQVIATCVCPTDINATDPKKKA-LFPVVLGHECAGIVESVGP
1e3lB           CKAAIAWKTGPLCIEEIEVSPPKACEVRIQVIATCVCHTDINATDPKKKA-LFPVVLGHECAGIVESVGP
1e3lA           CKAAIAWKTGPLCIEEIEVSPPKACEVRIQVIATCVCHTDINATDPKKK-ALFPVVLGHECAGIVESVGP
1axeA           CKAAVLWEEKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVT-PLPVIAGHEAAGIVESIGE
1axgA           CKAAVLWEEKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVT-PLPVIAGHEAAGIVESIGE
1a71A           CKAAVLWEEKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVT-PLPVIAGHEAAGIVESIGE
2dfvA           -KVAIKTKPGGAELVEVDVPKPGPGEVLIKVLATSICGTDLHIYEWNEQSRIKPPQIGHEVAGEVVEIGP
3b70A           QTALTVNDHDVTVWNAAPCPMLPRDQVYVRVEAVAINPSDTKMRGQFATP---WAFLGTDYAGTVVAVGS
2cd9B           MKAIIVKPPNAVQVKDVDEKKDSYGKIKIRTIYNGICGTDREIVNGKLTLGKDFLVLGHEAIGVVEESYH
2cd9A           MKAIIVKPPNAVQVKDVDEKKDSYGKIKIRTIYNGICGTDREIVNGKLTL-SKGKDFLVLGHEAIGVVEE
2b83A           MKGFAMLGINKLGWIEKERPVAGSYDAIVRPLAVSPCTSDIHTVFEGALGDRKNMILGHEAVGEVVEVGS
2b5wA           MKAIAVKRGERPVVIEKPRPEPESGEALVRTLRVGVCGTDHEVIAGGHPEGEDHLVLGHE--AVGVVVDP
2dphA           NKSVVYHGTRDPYPKLEHNNRKLEHAVILKVVSTNICGSDQHIYRGRFIV-PKGHVLGHEITGEVVEKGS
2cf5A           TTGWAARDPSILSPYTYTLRETGPEDVNIRIICCGICHTDLHQTKNDLGMSNYPMVPGHEVVGEVVEVGS
3b6zA           QTALTVNDHDVTVWNAAPCPMLPRDQVYVRVEAVAINPSDTKMRGQFAT---PWAFLGTDYAGTVVAVGS
2cdbB           MKAIIVKPPNAVQVKDVDEKKDSYGKIKIRTIYNGICGADREIVNGKLG--KDFLVLGHEAIGVVEESYH
3cosD           CKAAIAWEAGPLCIEEVEVAPPKAHEVRIQIIATSLCHTDATVIDSKFEGLAFPVIVGHEAAGIVESIGP
2eihA           MRAVVMRARGVLEVADLPVPEPGPKEVRVRLKAAALNHLDVWVRKGVASPKPLPHVLGADGSGVVDAVGP
2b5vA           MKAIAVKRGR-PVVIEKPRPEPESGEALVRTLRVGVDGTDHEVIAGGHGGFEDHLVLGHEAVGVVVDPND
2cdaA           MKAIIVKPPNGVQVKDVDEKKDSYGKIKIRTIYNGICGTDREIVNGKL-KGKDFLVLGHEAIGVVEESYH
2d8aA           -KVAIKTKPGGAELVEVDVPKPGPGEVLIKVLATSICGTDLHIYEWNEQSRIKPPQIGHEVAGEVVEIGP
2cdbA           MKAIIVKPPNAVQVKDVDEKKDSYGKIKIRTIYNGICGADREIVNGKLKG-KDFLVLGHEAIGVVEESYH
2cdbC           MKAIIVKPPNAVQVKDVDEKKDSYGKIKIRTIYNGICGADREIVNGKLK---DFLVLGHEAIGVVEESYH
3cosA           CKAAIAWEAGPLCIEEVEVAPPKAHEVRIQIIATSLCHTDATVIDSKFEGLAFPVIVGHEAAGIVESIGP
2cdaB           MKAIIVKPPNAVQVKDVDEKKDSYGKIKIRTIYNGICGTDREIVNGKLG--KDFLVLGHEAIGVVEESYH
2c0cA           MQKLVVTRLSVTLSRDCPVPLPGDGDLLVRNRFVGVNASDINYSAGRYDPVKPPFDIGFEGIGEVVALGL
2c0cB           MQKLVVTRLSVTLSRDCPVPLPGDGDLLVRNRFVGVNASDINYSAGRYDPVKPPFDIGFEGIGEVVALGL
2dm6A           AKSWTLKKQSDFELKTVELPPLKNGEVLLEALFLSVDPYMRIASKRLKE---GAVMMGQQVARVVESKNS
1ch6A           VRGILRIIKPCNHVLSLSFPIRRDDGSWEVIEGYRQHSHQRTPCKGGIRYLASLMTYKCAVVDVPFGGAK
2dg2A           ----------------------------------------------------------------------
1dlgA           ----------TMKLLTQLGTKVERGSVWIDASNVNNFSAPYDLVKTMRSIWALGPLVARFGQGQVSLPGG
3c3pB           ----------------------------------------------------------------------
2ebjA           ----------------------------------------------------------------------
2cqwA           ------------------------------------------------------------------AGAQ
2c4cB           ----------------------------------------------------------------------
2bryA           ----------------------------------------------------------------------
3dkiB           ----------------------------------------------------------------------
3c3pC           ----------------------------------------------------------------------
3eeqB           ----------------------------------------------------SASEDAFSAGETIKEKLK
1dl5A           -----------------------------------------------------------------EKLFW
3e90B           NGQDEVQMIVVEPGKNVKNVRTKPGVFKTPEGEIGAVTLDFPTGTSGSPVDKNGDVIGLYGNGVIMPNGS
2c4cA           ----------------------------------------------------------------------
3dkiA           ----------------------------------------------------------------------
3dwiB           ----------------------------------------------------------------------
1dl5B           -----------------------------------------------------------------EKLFW
3dwiA           ----------------------------------------------------------------------
2eguA           ----------------------------------------------------------------------
2dsqI           ---------------------------------------------------------ETLCGAELVDALQ
3dwgA           ----------------------------------------------------------------------
3dwgB           ----------------------------------------------------------------------
3e90D           NGQDEVQMIVVEPGKNVKNVRTKPGVFKTPEGEIGAVTLDFPTGTSGSPIDKNGDVIGLYGNGVIMPNGS
2bhtD           ----------------------------------------------------------------------
3c85C           ----------------------------------------------------------------------
3e05C           ----------------------------------------------------------------------
3c85B           ----------------------------------------------------------------------
1a3xA           -----------------------PNCPIILVTRCPRAARFSHLYRGVFPFVFEKETDDEARINFGIEKAK
3e05A           ----------------------------------------------------------------------
3e05D           ----------------------------------------------------------------------
3e05F           ----------------------------------------------------------------------
1cmvB           ----------------------------------------------------------------------
3c85D           ----------------------------------------------------------------------
3e05G           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           NVNRDRIGERVSVDPVISCGHCYPCSVGKPNVCTSLVVLGVHRDGGFSEYAVAPARNAHRIPDNIADHHA
1bxzA           EVKDFKPGDRVVVPAITPDWRTSEVQRGYHQHSGGMLANVKDGVFGEFFHVNDADMNLAHLPKEIPLEAA
1ee2A           GVTTVRPGDKVIPLFIPQCGKCSVCKHPEGNLCRGKPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKV
2dq4A           GVRRPQVGDHVSLESHIVCHACPACRTGNYHVCLNTQILGVDRDGGFAEYVVVPAENAWVNPKDLPFEVA
1e3jA           NVKHLKKGDRVAVEPGVPCRRCQFCKEGKYNLCPDLTCATPPDDGNLARYYVHAADFCHKLPDNVSLEEG
1e3eB           GVTNFKPGDKVIPFFAPQCKRCKLCLSPLTNLCGKLRIYHFMGVSSFSQYTVVSEANLARVDDEANLERV
2eerA           EVVGYSKGDLVAVNPWEGEGNCYYCRIGEEHLCDSPRWLGINYDGAYAEYVLVPHYKYLYKLRRLSAVEA
1d1tA           GVTTVKPGDKVIPLFLPQCRECNACRNPDGNLCIRSDVHHFLNTSTFTEYTVVDESSVAKIDDAAPPEKV
1cdoA           GVTEFQPGEKVIPLFISQCGECRFCQSPKTNQCVKGKVLQFLGTSTFSQYTVVNQIAVAKIDPSAPLDTV
2eerB           EVVGYSKGDLVAVNPWEGEGNCYYCRIGEEHLCDSPRWLGINYDGAYAEYVLVPHYKYLYKLRRLSAVEA
1d1sA           GVTTVKPGDKVIPLFLPQCRECNACRNPDGNLCIRSPVHHFMNTSTFTEYTVVDESSVAKIDDAAPPEKV
1e3eA           GVTNFKPGDKVIPFFAPQCKRCKLCLSPLTNLCGKLRIYHFMGVSSFSQYTVVSEANLARVDDEANLERV
1e3lB           GVTNFKPGDKVIPFFAPQCKRCKLCLSPLTNLCGKLRIYHFMGVSSFSQYTVVSEANLARVDDEANLERV
1e3lA           GVTNFKPGDKVIPFFAPQCKRCKLCLSPLTNLCGKLRIYHFMGVSSFSQYTVVSEANLARVDDEANLERV
1axeA           GVTTVRPGDKVIPLWTPQCGKCRVCKHPEGNFCLKNPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKV
1axgA           GVTTVRPGDKVIPLFTPQCGKCRVCKHPEGNFCLKNPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKV
1a71A           GVTTVRPGDKVIPLWTPQCGKCRVCKHPEGNFCLKNPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKV
2dfvA           GVEGIEVGDYVSVETHIVCGKCYACRRGQYHVCQNTKIFGVDTDGVFAEYAVVPAQNIWKNPKSIPPEYA
3b70A           DVTHIQVGDRVYGAQNEMCPRTPDQGAFSQYTVTRGRVWAKIPKGSFEQAAALPAGISTAGLAMKLLGLP
2cd9B           GFSQGDLVMPVNRRGCGICRNCLVGRPDFCETGEFGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGI
2cd9A           SYHGFSQGDLVMPVNRRGCGICRNCLVGRPDFCETGEFGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGI
2b83A           EVKDFKPGDRVIVPCTTPDWRSLEVQAGFPQHSNGMLKFSNFKDGVFGEYFHVNDMNLAILPKDMPLENA
2b5wA           NDTELEEGDIPTVRRPPASGTNEYFERDQPDMAPDGMYGIVGAHGYMSEFFTSPEKYLVRIPRSQAELGF
2dphA           DVELMDIGDLVSVPFNVACGRCRNCKEARSDVCENNLFDLKGWSGGQAEYVLVPYADYMLLKFGDKEQAM
2cf5A           DVSKFTVGDIVGVGCLVPCERDLEQYCPKKISYNDVYINGQPTQGGFAKATVVHQKFVVKIPEGMAVEQA
3b6zA           DVTHIQVGDRVYGAQNEMCPRTPDQGAFSQYTVTRGRVWAKIPKGLSFEQAAALPAGISTAGLAMKLLGL
2cdbB           GFSQGDLVMPVNRRGCGICRNCLVGRPDFCETGEFGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGI
3cosD           GVTNVKPGDKVIPLYAPLCRKCKFCLSPLTNLCGKISVYHFFGTSTFSQYTVVSDINLAKIDDDANLERV
2eihA           GVEGFAPGDEVVINPGLSCGRCERCLAGEDNLCPRYQILGEHRHGTYAEYVVLPEANLAPKPKNLSFEEA
2b5vA           TELEEGDIVVPTVRRPPASGTNEYFERDQPDMAPDGMRGIVGAHGYMSEFFTSPEKYLVRIPRSQAELGF
2cdaA           GFSQGDLVMP---VNRRGCGICRNCLVGRPDFCETGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGI
2d8aA           GVEGIEVGDYVSVETHIVCGKCYTKIF------------GVDTDGVFAEYAVVPAQNIWKNPKSIPPEYA
2cdbA           GFSQGDLVMPV---NRRGCGICRNCLVGRPDFCETGEFGIHKMDGFMREWWYDDPKYLVKIPKSIEDSIE
2cdbC           GF---SQGDLVMPVNRRGCGICRNCLVGRPDFCEFGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGI
3cosA           GVTNVKPGDKVIPLYAPLCRKCKFCLSPLTNLCGKISVYHFFGTSTFSQYTVVSDINLAKIDDDANLERV
2cdaB           GFSQGDLVMPVNRRGCGICRNCLVGRPDFCETGEFGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGI
2c0cA           SASARYTVGQAVAYMAPGSFAEYTV---------------------------VPASIATPVPSVKPEYLT
2c0cB           SASARYTVGQAVAYMAPGSFAEYTVVPASIATP---------------------------VPSVKPEYLT
2dm6A           AFP---------------AGSIVLAQSGWTT-------------HFISDGKGLEKLLTEWPDKLPSLALG
1ch6A           AGVKINPKNYTDEDLEKITRRFTMELAKKGFIGPGVDVPAPNMSTGEREMSWIADTYAIGHYDINAHACV
2dg2A           ------------------------------------------KYLSQEEAQAVDQELFNEYQFSVDQLEL
1dlgA           SAIGARPVDLHIFGLEKLGAEIKLEEGYVKASVNGRLKGAHIVMDKVSVGATVTIMSAA----TLAEGTT
3c3pB           -----------------------------------------IVDSRIGAYLDGLLPEADPVVAAEQIARE
2ebjA           ------------------------------------LVTGFEPFGSLEHNPSQALLDLLPSEVDGKPLRK
2cqwA           GSCSLRCGAQDGLCSHPTCSGLGTCCEDFLDYCLEILPSSGS-MMGGKDFVVQHLKWTDPSGPS------
2c4cB           -------PAHDHFETFVQAQLCQDVLSSFQGLCR---ALGVESGGGLSQYHKIKAQLNYWSAKSLWAKLD
2bryA           -------PAHDHFETFVQAQLCQDVLSSFQGLCR---ALGVESGGGLSQYHKIKAQLNYWSAKSLWAKLD
3dkiB           ------------------------------------LVGLQRLSPRWDDGRDGPHVRLWAKLEDRNPTGS
3c3pC           -----------------------------------------IVDSRIGAYLDGLLPEADPVVAAEQIARE
3eeqB           SFEIPVVHYRYKDAEIETIWKCYDA-----------------------IVFVMALEGATRIVCKYAKEDP
1dl5A           ILKKYGVSDHI------------------------AKAFLEIPREEFLTKSYPLSYVYEDIVLVSYDDGE
3e90B           YISAIVQGKRMDE---------------------------------------------------------
2c4cA           -------PAHDHFETFVQAQLCQDVLSSFQGLCR---ALGVESGGGLSQYHKIKAQLNYWSAKSLWAKLD
3dkiA           ------------------------------------LVGLQRLSPRWDDGRDGPHVRLWAKLEDRNPTGS
3dwiB           -------------------------------------LVGLQRPRWDDGRDGPHVRLWAKLEDRNPTGSI
1dl5B           ILKKYGVSDHI------------------------AKAFLEIPREEFLTKSYPLSYVYEDIVLVSYDDGE
3dwiA           ------------------------------------LVGLQRLSPRWDDGRDGPHVRLWAKLEDRNPTGS
2eguA           -------------------------------------LIGDTPAVKLNRIVDEDSADVYLKLEFMNPGSS
2dsqI           FVCGDR-GFYFNKGIVDECCFRSCDLRRLEMYC-------------------------------------
3dwgA           ------------------------------------LVGLQRLSPRWDDGRDGPHVRLWAKLEDRNPTGS
3dwgB           ---------------------------------TPLVGLQRLSPRWDDGRDGPHVRLWAKLEDRNPTGSI
3e90D           YISAIVQGKRMDE---------------------------------------------------------
2bhtD           -------------------------------------LEQTIGNTPLVKLQRMGPDNGSEVWEGNNPAGS
3c85C           ----------------------------------------------------------------------
3e05C           ----------------------------------------------------------IGIDDDEFATAK
3c85B           ----------------------------------------------------------------------
1a3xA           EFGILKKGDTY----VSIQGN----TLQVSTV--------------------------------------
3e05A           ----------------------------------------------------------IGIDDDEFATAK
3e05D           ----------------------------------------------------------IGIDDDEFATAK
3e05F           ----------------------------------------------------------IGIDDDEFATAK
1cmvB           ---------------------------------------INHDDTAVVGHVAARDGLFCLGCVTSPRFLE
3c85D           ----------------------------------------------------------------------
3e05G           ----------------------------------------------------------IGIDDDEFATAK


                         +         .         .         .         .         *         .:210
query           VMVEPFTIAANVTGQVNPTEQDVALIYGAGPMGLTTVQALKGVYQVKTVIVVDRIEERLAMAKQSGADWT
1bxzA           VMIDMMTTGFHGAELADIELGATVAVLGIGPVGLMAVAGAK-LRGAGRIIAVGSRPVCVDAAKYYGATDI
1ee2A           CLVGCGFSTGYVKVAKVTQGSTCAVFGLGGVGLSVIMGCKA--AGAARIIGVDINKDKFAKAKEVGATEC
2dq4A           AILEPFGNAVHTVYAGSGVSGKSVLITGAGPIGLMAAMVVR-ASGAGPILVSDPNPYRLAFARPYADRLV
1e3jA           ALLEPLSVGVHACRRAGVQLGTTVLVIGAGPIGLVSVLAAK--AYGAFVVCTARSPRRLEVAKNCGADVT
1e3eB           CLIGCGFSSGYINTAKVTPGSTCAVFGLGCVGLSAIIGCKI--AGASRIIAIDINGEKFPKAKALGATDC
2eerA           APLTCVTTYRAVRKASLDPSKTLVVIGAGGGLGTMAIQIAK-AVSGATIIGVDVREEALEAAKRAGADYV
1d1tA           CLIGCGFSTGAAVKTGKVKPGSTCVVFGLGGVGLSVIMGCK-SAGASRIIGIDLNKDKFEKAMAVGATEC
1cdoA           CLLGCSTGFGAAVNTAKVEPGSTCAVFGLGAVGLAAVMGCH-SAGAKRIIAVDLNPDKFEKAKVFGATDF
2eerB           APLTCVTTYRAVRKASLDPSKTLVVIGAGGGLGTMAIQIAK-AVSGATIIGVDVREEALEAAKRAGADYV
1d1sA           CLIGCSTGYGAAVKTGKVKPGSTCVVFGLGGVGLSVIMGCK-SAGASRIIGIDLNKDKFEKAMAVGATEC
1e3eA           CLIGCGFSSGYINTAKVTPGSTCAVFGLGCVGLSAIIGCKI--AGASRIIAIDINGEKFPKAKALGATDC
1e3lB           CLIGCSSGYGAAINTAKVTPGSTCAVFGLGCVGLSAIIGCK-IAGASRIIAIDINGEKFPKAKALGATDC
1e3lA           CLIGCSSGYGAAINTAKVTPGSTCAVFGLGCVGLSAIIGCK-IAGASRIIAIDINGEKFPKAKALGATDC
1axeA           CLIGCSTGYGSAVKVAKVTQGSTCAVFGLGVGLSVIMGCKA--AGAARIIGVDINKDKFAKAKEVGATEC
1axgA           CLIGCGFSTSAVKVAKVTQGSTCAVFGLGGAGLSVIMGCKA--AGAARIIGVDINKDKFAKAKEVGATEC
1a71A           CLIGCGFSTSAVKVAKVTQGSTCAVFGLGGAGLSVIMGCKA--AGAARIIGVDINKDKFAKAKEVGATEC
2dfvA           TLQEPLGNAVDT-VLAGPISGKSVLITGAGPLGLLGIAVAKASGA-YPVIVSEPSDFRRELAKKVGADYV
3b70A           LPSPSADQPPT-----HSKPVYVLVYGGSTATATVTMQMLRLSGY---IPIATCSPHNFDLAKSRGAEEV
2cd9B           LAQPLADIEKVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYG--LEVWMANRREPTEVEQTVIEETKT
2cd9A           LAQPLADIEKVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYG--LEVWMANRREPTEVEQTVIEETKT
2b83A           VMIDMMTTGFHGAELADIQMGSSVVVIGIGAVGLMGIAGAK-LRGAGRIIGVGSRPICVEAAKFYGATDI
2b5wA           LIEPIALEHAYASRSAFDWDPSSAFVLGNGSLGLLTLAMLKGYENLYCLGRRDRPDPTIDIIEELDATYV
2dphA           EKIKDLTLISHGCVSAGVKPGSHVYIAGAGPVGRCAAAGAR-LLGAACVIVGDQNPERLKLLSDAGFETI
2cf5A           PLLCAGVTVYSPLSHFGLKQPGLGGILGLGGVGHMGVKIAK-AMGHHVTVISSSNKKREEALQDLGADDY
3b6zA           PL---PSPSADQPPTHSK-PVYVLVYGGSTATATVTMQMLRLSGY---IPIATCSPHNFDLAKSRGAEEV
2cdbB           LAQPLQKRVPVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYG--LEVWMANRREPTEVEQTVIEETKT
3cosD           CLLGCGFSTGAAINNAKVTPGSTCAVFGLGGVGLSAVMGCK-AAGASRIIGIDINSEKFVKAKALGATDC
2eihA           AAIPLTFLTAMVVDKLGVRPGDDVLVMAAGS-GVSVAAIQIAKLFGARVIATAGSEDKLRRAKALGADET
2b5vA           SITEKALEHAYASRSAFDWDPSSAFVLGNGSLGLLTLAMLKGYENLYCLGRRDRPDPTIDIIEELDATYV
2cdaA           LAQPLQKRVPVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYG--LEVWMANRREPTEVEQTVIEETKT
2d8aA           TLQEPLGNAVD-TVLAGPISGKSVLITGAGPLGLLGIAVAKASGA-YPVIVSEPSDFRRELAKKVGADYV
2cdbA           EILEVQKRVPVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYG--LEVWMANRREPTEVEQTVIEETKT
2cdbC           LAQPLQKRVPVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYG--LEVWMANRREPTEVEQTVIEETKT
3cosA           CLLGCGFSTGAAINNAKVTPGSTCAVFGLGGVGLSAVMGCK-AAGASRIIGIDINSEKFVKAKALGATDC
2cdaB           LAQPLQKRVPVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGL--EVWMANRREPTEVEQTVIEETKT
2c0cA           LLVSGTTAYISLKELGGLSEGKKVLVTAAAGGTGQFAMQLS-KKAKCHVIGTCSSDEKSAFLKSLGCDRP
2c0cB           LLVSGTTAYISLKELGGLSEGKKVLVTAAAGGTGQFAMQLS-KKAKCHVIGTCSSDEKSAFLKSLGCDRP
2dm6A           TIGMPGLTAYFGLLEVCGVKGGETVLVSAAAGAVGSVVGQIAKLKGCKVVGAAGSDEKIAYLKQIGFDAA
1ch6A           TGKPISQGGIHGRISATGRGVFHGIENFIENAS-------------------------------------
2dg2A           AGLSCATAIAKAYPPTSSKSPPTVLVICGGNNGGDGLVCARLKLFGYQPTIYYPKRPNKPLFTGLVTQCQ
1dlgA           IIENA----------------------AREPEIVDTANFLV-ALGAKISGQGTDRITIEGVERLGGGVYR
3c3pB           RNIPIRQTGRLLYLLARIKQPQLVVVPGDGLGCASWWFARA--ISISSRVVIDPDRDNVEHARRLHDNGL
2ebjA           AVLPVEALGEALEDLHREGPKAVLHLGLAEDRPVLTLERLAVNLLDFPRPDNRGRVLEDLPIVPGGPL--
2cqwA           ----------------------------------------------------------------------
2c4cB           KRASQ-----PVYQQGQACTNTKCLVVGAGPCGLRAAVELALLGARVVLVELHLWPFTIHDLRALGAKKF
2bryA           KRASQPVY--------------------------------------------------------------
3dkiB           IDRPAVRMIEQAEADGLLRPGATILEPTSGNTGISLAMAARLKYRLICVMPENTSVERRQLLELYGAQII
3c3pC           IPIVDRQTGRLLYLLARIKQPQLVVVPGDGLGCASWWFARA--ISISSRVVIDPDRDNVEHARRLHDNGL
3eeqB           AIVCIDDK----------INYVIPLLGGHWGANDIARELSVILN--STPIITKLSIERIANILIAKIINP
1dl5A           STSSQPSLMALFMEWVGLDKGMRVLEIGGGTGYNAAVMS-RVVGEKGLVVSVEYSRKICEIAKRNVERLG
3e90B           ----------------------------------------------------------------------
2c4cA           KRAS------------------------------------------------------------------
3dkiA           IDRPAVRMIEQAEADGLLRPGATILEPTSGNTGISLAMAARLKYRLICVMPENTSVERRQLLELYGAQII
3dwiB           KDRPAVRMIEQAEADGLLRPGATILEPTSGNTGISLAMAARLKYRLICVMPENTSVERRQLLELYGAQII
1dl5B           STSSQPSLMALFMEWVGLDKGMRVLEIGGGTGYNAAVMSRV-VGEKGLVVSVEYSRKICEIAKRNVERLG
3dwiA           IKDRPVRMIEQAEADGLLRPGATILEPTSGNTGISLAMAARLKYRLICVMPENTSVERRQLLELYGAQII
2eguA           VKDIALAMIEAAEKAGKLKPGDTIVEPTSGNTGIGLAMVAAAKYKAVLVMPDTMSLERRNLLRAYGAELV
2dsqI           ----------------------------------------------------------------------
3dwgA           IKDRPVRMIEQAEADGLLRPGATILEPTSGNTGISLAMAARLKYRLICVMPENTSVERRQLLELYGAQII
3dwgB           KDRPAVRMIEQAEADGLLRPGATILEPTSGNTGISLAMAARLKYRLICVMPENTSVERRQLLELYGAQII
3e90D           ----------------------------------------------------------------------
2bhtD           VDRAALSMIVEAEKRGRIKPGDVLIEATSGNTGIALAMIAA-LKGYRMKLLMP--DERRAAMRAYGAELI
3c85C           ---------------------HAQVLILGGRIGTGAYDELR-ARYGKISLGIEIREEAAQQHRSEGRNVI
3e05C           KLITKQEVRAVTLSKLRLQDDLVMWDIGAGS-ASVSIEASN-LMPNGRIFALERNPQYLGFIRDNLKKFV
3c85B           -------------------PGHAQVLILGGRIGTGAYDELRARYGKI-SLGIEIREEAAQQHRSEGRNVI
1a3xA           ----------------------------------------------------------------------
3e05A           KLITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSIEASNLMPNGRIFALERNPQYLGFIRDNLKKFVAR
3e05D           KLITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSIEASNLMPNGRIFALERNPQYLGFIRDNLKKFVAR
3e05F           KLITKQEVRAVTLSKLRLQDDLVMWDIGAGSASV--SIEASNLMPNGRIFALERNPQYLGFIRDNLKKFV
1cmvB           IVRRASEKSELVSGPVSPLQPDKVVEFLSGSYAGLSLSKHVACSVGRRRGTLAVYGRDPEWVTQRFPDLT
3c85D           ----------------------LVLLAPHHQGNQTALEQLQRRNYKGQIAAIAEYPDQLEGLLESGVDAA
3e05G           KLITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSIEASNLM--PNGRIFALERNPQYLGFIRDNLKKFV


                         .         .         .         +         .         .         .:280
query           LNNGQHSLAEFLQQKALKPTLIVDAACHPAILQEAITLASPAARIVLMGFSSDPCEIVQQGITGKELAIY
1bxzA           VNYKDGPIES--QIMNLTEGKGVDAAINADIMATAVKIVKPGGTIANVNYFGEGEVEWGCGMAHKTIKGG
1ee2A           VNPQDYKKPIQEVLTEMGVDFSFEVIGRLDTMVAALSCCQEAYGVSVIVPPDSQNLSMNPMLLLSGRAIF
2dq4A           NPLEEDLLEVVRRVTGSGVEVLLEFSGNEAAIHQGLMALIPGGEARILGISDPIRFDLAGELVMRGITAF
1e3jA           LVEEESSIIERIRSAIDLPNVTIDCSGNEKCITIGINITRTGGTLMLVGMGSQMVTVPLVNACAREIDIK
1e3eB           LNPRELDKPVQDVITELGVDYSLDCAGTAQTLKAAVDCTVLGWGSCTVVGAKVDEMTIPTVDVILGRSIN
2eerA           INASSQDPVSEIRRQGKGADAVIDLNNSEKTLSIYPYVLAKQGKYVMVGLFGADLKYHAPLITLNEVQFI
1d1tA           ISPKDSTKPISEVLSEMVGYTFEVIGHLETMIDALASCHMNYGTSVVVGVPPYDPMLLFTGRTWK-GCVF
1cdoA           VNPNDHSEPISQVLSKMTNGSLECVGNVGVMRNALESCLKGWGVSVLVGWTDLHDVATRPIQLIAGRTWK
2eerB           INASSQDPVSEIRRITQGKGAVIDLNNSEKTLSIYPYVLAKQGKYVMVGLFGADLKYHAPLITLNEVQFI
1d1sA           ISPKDSTKPISEVLSEMTGNTFEVIGHLETMIDALASCHMNYGTSVVVGVPPSAKMLTDPMLLFTGRTWF
1e3eA           LNPRELDKPVQDVITELTADYSLDCAGTAQTLKAAVDCTVLGWGSCTVVGAKVDEMTIPTVDVILGRSIN
1e3lB           LNPRELDKPVQDVITELGVDYSLDCAGTAQTLKAAVDCTVLGWGSCTVVGAKVDEMTIPTVDVILGRSIN
1e3lA           LNPRELDKPVQDVITELGVDYSLDCAGTAQTLKAAVDCTVLGWGSCTVVGAKVDEMTIPTVDVILGRSIF
1axeA           VNPQDYKKPIQEVLTEMGVDFSFEVIGRLDTMVTALSCCQEAYGVSVIVGPDSQNLSMNPMLLLSGRTWF
1axgA           VNPQDYKKPIQEVLTEMGVDFSFEVIGRLDTMVTALSCCQEAYGVSVIVPPDSQNLSMNPMLLLSGRTWK
1a71A           VNPQDYKKPIQEVLTEMGVDFSFEVIGRLDTMVTALSCCQEAYGVSVIVPPDSQNLSMNPMLLLSGRAIF
2dfvA           INPFEEDVVKEVDITDNGVDVFLEFSGAPKALEQGLQAVTPAGRVSLLGLPGKVTIDFNNLIIFKALTIY
3b70A           FDYRAPNLAQTIRTYTNNLRYALDCITNVESTTFCFIGRAGGHYVSLNPFPETRKMVTTDWTLGPTIFGE
2cd9B           NYYNSSNGYDLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFTSGSVPLDLQEIVHTNKTII
2cd9A           NYYNSSNGYDLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFTSGSVPLDYQEIVHTNKTII
2b83A           LNYKNGHIVDQVMKLTKGVDRVIMAGGGSETLSQAVSMVKPGGIISNINYHGSGDALWGCGMAHKTIKGG
2b5wA           DSRQTP--VEDVPDVYEQMDFIYEATGFPKHAIQSVQALAPNGVGALLGVPSDWAFEVDAGAFHREMVLH
2dphA           DLRNSAPLRDAVGFEAHGLGDEANTETPNGALNSLFDVVRAGGAIGIPGIYVGSLHLDFGKMWTKSIRIM
2cf5A           VIGSDQAKMSELAD---SLDYVIDTVPVHHALEPYLSLLKLDGKLILMGVINNPLQFLTPLLMLGRKVIT
3b6zA           FDYRAPNLAQTIRTYTKNRYALDCITNVESTTFCFAAIGRAGGHYVSLNPFPRKEGSTWPAPYGRPGSEE
2cdbB           NYYNSSNGYDKLKDSVKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFTSGSVPLDLQEIVHTNKTII
3cosD           LNPRDLHKPIQEVIIELGVDFALDCAGGSETMKAALDCTTAGWGSCTFIAAGSKGLTVFPEELIIGRTIF
2eihA           VNYTHPDWPKEVRRLTGGKGAKVVDHTGALYFEGVIKATANGGRIAIAGASSYEGTLPFAHVFYRQLSIL
2b5vA           DS--RQTPVEDVPDVYEQMDFIYEATGFPKHAIQSVQALAPNGVGALLGVPSDWREMVLHNKALVGSVNS
2cdaA           NYYNSSNGYDKLKDSVGKFDVIIATGADVNILGNVIPLLGRNGVLGLFGFTSGSVPLDLQEIVHTNKTII
2d8aA           INPFEEDVVKEVDITDNGVDVFLEFSGAPKALEQGLQAVTPAGRVSLLGLYPGKVTIFNNLIIFKALTIY
2cdbA           NYYNSSNGYKLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLLQEIVHTNKTII
2cdbC           NYYNSSNGYDLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFTSGSVPLDLQEIVHTNKTII
3cosA           LNPRDLHKPIQEVIIELTKDFALDCAGGSETMKAALDCTTAGWGSCTFIAAGSKGLTVFPEELIIGRTIF
2cdaB           NYYNSSNGYDLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFTSGSVPLDLQEIVHTNKTII
2c0cA           INYKTEPVGTVLKQEYPEGVDVVYESVGGAMFDLAVDALATKGRLIVIGAGTLPAKLLKKSASVQGFFLN
2c0cB           INYKTEPVGTVLKQEYPEGVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGYAKLLKKSASVQGFFLN
2dm6A           FNYKTVNSLEALKKASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGADQLPPGPSPESIIYKQLRIE
1ch6A           ----------------------------------------------------------------------
2dg2A           KDIPFLGEPPEPVDELYELVVSFKGDVREPFHSILSVLSGLTVPIASIDISGWDVEKGNPSGIQPDLLIS
1dlgA           VLPDRIETGTFLVAAAISGGKIVCRNAQPDTLDAVLAKLREAGADIETGEDWISLDMHGKRPKAVTV-RT
3c3pB           IDRVELQVGDPLGIAAGQRDLFDCDVFNGADVLERNRCLAKNALLIAVNALRREFNHHLS----------
2ebjA           -ALPARFPVKPVLARWAGIPGRPSLSAGNQAFYLSLYRLPEEVPVGFLHLPPDETLALK-----------
2cqwA           ----------------------------------------------------------------------
2c4cB           YGRFCTGTLDHISIRQLQLLLL------------------------------------------------
2bryA           ----------------------------------------------------------------------
3dkiB           FSATAVATAKELAATNPSWVMLYQ---------------YGNPANTDSHYCGTGPELLAD----------
3c3pC           IDRVELQVGDPLGIAAGQRDIDICDVFNGADVLERNRCLAKNALLIAVNALRR-----------------
3eeqB           ENIVKINAALLRDESI---CIDGINVNFPENIKVCSYIISLRDKEYKDKIVVWLKPLKISIGIGSKKDVK
1dl5A           IENVIFVCGDGYYGVPEFSPVIFVTVGVDEVPETWFTQLKEGGRVIVPINLKLSRRQPAFLFKKKDPYLV
3e90B           ----------------------------------------------------------------------
2c4cA           ----------------------------------------------------------------------
3dkiA           FSAAEGGSNT------------------------------------------------------------
3dwiB           FSAA------------------------------------------------------------------
1dl5B           IENVIFVCGDGYYGVPEFSPVIFVTVGVDEVPETWFTQLKEGGRVIVPINLKLSRRQPAF----------
3dwiA           FSA-------------------------------------------------------------------
2eguA           LTPGAQGMRGAIAK--------------------------------------------------------
2dsqI           ----------------------------------------------------------------------
3dwgA           FSAAEGGSNTAVATAKELAATNPSWVMLYQYGNPAN----TDSHYCGTGP-----ELLADL---------
3dwgB           FS--------------------------------------------------------------------
3e90D           ----------------------------------------------------------------------
2bhtD           ME--------------------------------------------------------------------
3c85C           SGDATDPDFWERILDT-GHVKLVLLAPHHQGNQTALEQLQRRNYKGQIAIAEYPDQLEGLLESGVDAAFN
3e05C           ARNLVEAFAPEGLDDLPDPDRVFIGGMLEEIIDAVDRRLKSEGVIVLNAVTLDTLTKAVEFLEDHGYMVE
3c85B           SGDATDPDFWERILDT-GHVKLVLLAPHHQGNQTALEQLNYKGQIAAIAEYPDQLEGLLE--SGVDAAFN
1a3xA           ----------------------------------------------------------------------
3e05A           NVTLVEAFAPEGLDDPDRVFIGGSGGMLEEIIDAVDRRLKSEGVIVLNAVTLDTLTKAVEFLEDHGYMVE
3e05D           NVTLVEAFAPEGLDDLPDPDIGGSGGMLEEIIDAVDRRLKSEGVIVLNAVTLDTLTKAVEFLEDHGYMVE
3e05F           ARNVTLVEAFAPEGL--DDLPDPDRVFLEEIIDAVDRRLKSEGVIVLNAVTLDTLTKAVE----------
1cmvB           AADRDGLRAQWQRGDPFRSDGLLGNSVDALYIRERLPKLRYDKQLVGVTERES-----------------
3c85D           FN--------------------------------------------------------------------
3e05G           ARNVTLVEAFAPEGLDDLPDPDRVFIGGEEIIDAVDRRLKSEGVIVLNAVTLDTLTKAVEFLEDHGYMVE


                         .         *         .         .         .         .         +:350
query           SSRLNANKFPVVIDWLNKGLIDPDKLITHTFDYQHVTDAIELFEKDQRQCCKVLLTFAK
1bxzA           LCPGGRLRMERLIDLVFYKRVDPSKLVTHFRGFDNIEKAFMLMKDKPKDLIKPVVILA-
1ee2A           GGFKSKDSVPKLVADFMAKKFALDPLITHVLPFEKINEGFDLLRSGKSIRTILTF----
2dq4A           GIAGRRLWWMQGTALVYSGRVDLSPLLTHRLPLSRYREAFGLLA--SGQAVKVILDP--
1e3jA           SVFRYCNDYPIALEMVASGRCNVKQLVTHSFKLEQTVDAFEAARKKADNTIKVMISC--
1e3eB           GTWKSVDSVPNLVSDYKNKKFDLDLLVTHALPFESINDAIDLMKEGKSIRTILTF----
2eerA           GSLVNQSDFLGIMSLAEAGKVKP--MVTKTMKLEEANEAIDNLENFKAVGRQVLV----
1d1tA           GGLKSRDDVPKLVTEFLAKKFDLDQLITHVLPFKKISEGFELLNSGQSIRTVLTF----
1cdoA           GSFKGKDGVPKMVKAYLDKKVKLDEFITHRMPLESVNDAIDLMK--HGKCIRTVLSL--
2eerB           GSLGNQSDFLGIMSLAEAGKVKP--MVTKTMKLEEANEAIDNLENF-KAVGRQVLV---
1d1sA           GGLKSRDDVPKLVTEFLAKKFDLDQLITHVLPFKKISEGFELLNSGQSIRTVLTF----
1e3eA           GTWKSVDSVPNLVSDYKNKKFDLDLLVTHALPFESINDAIDLMKEGKSIRTILTF----
1e3lB           GTFFSVDSVPNLVSDYKNKKFDLDLLVTHALPFESINDAIDLMKEGKSIRTILTF----
1e3lA           GGWKSVDSVPNLVSDYKNKKFDLDLLVTHALPFESINDAIDLMKEGKSIRTILTF----
1axeA           GGFKSKDSVPKLVADFMAKKFALDPLITHVLPFEKINEGFDLLRSGESIRTIL------
1axgA           GAIFSKDSVPKLVADFMAKKFALDPLITHVLPFEKINEGFDLLRSGESIRTIL------
1a71A           GGFKSKDSVPKLVADFMAKKFALDPLITHVLPFEKINEGFDLLRSGESIRTIL------
2dfvA           GITGRHLWWYTVSRLLQSGKLNLDPIITHYKGFDKYEEAFELRAG--KTGKVVFL----
3b70A           GSTWPAPYWRIAGQLVEDGRLVHHPLRVVQGGFDHIKQGMELVRKGELSGEKLVVRL--
2cd9B           GLVNQKPHFQQAVVHLASWKTLYKMLITKTVSINDEKELLKVLREKEHGEIKIRILW--
2cd9A           GLVNQKPHFQQAVVHLASWKTLYKMLITKTVSINDEKELLKVLREKEHGEIKIRILW--
2b83A           LCPGGRLRAEMLRDMVVYNRVDLSKLVTHYHGFDHIEEALLLMKDKPKDLIKAVVIL--
2b5wA           NKALVEHFEAATVTFTKLPKWFLEDLVTGVHPLSEFEAAFD----DDDTTIKTAIEFST
2dphA           TGMPVTNYNRHLTEAILWDQMPYKVMNIEVITLDQAPDGYAKFD--KGSPAKFVIDPHG
2cf5A           GSFIGSMKTEEMLEFCKEKGL---SSIIEVVKMDYVNTAFERLEKN-DVRYRFVVDVEG
3b6zA           ERQFGEDLWRIAGQLVEDGRLVHHPLRVVQGGFDHIKQGMELVRKGELSGEKLVVRL--
2cdbB           GLVNQKPHFQQAVVHLASWKTLYKMLITKTVSINDEKELLKVLREKEHGEIKIRILW--
3cosD           GGWKSVDSIPKLVTDYKNKKFNLDALVTHTLPFDKISEAFDLMNQGKSIRTILIF----
2eihA           GSTMASKSLFPILRFVEEGKLKP--VVGQVLPLEAAAEGHRLLEER-RVFGKVVLQVG-
2b5vA           HVE---HFEAATVTFTKLPKWFLEDLVTGVHPLSEFEAAFD----DDDTTIKTAIEFST
2cdaA           GLVNQKPHFQQAVVHLASWKTLYKMLITKTVSINDEKELLKVLREKEHGEIKIRILW--
2d8aA           GITGRHLWWYTVSRLLQSGKLNLDPIITHKY--KGFDKYEEAFELRAGKTGKVVF----
2cdbA           GLVNQKPHFQQAVVHLASWKTLYKMLITKTVSINDEKELLKVLREKEHGEIKIRILW--
2cdbC           GLVNQKPHFQQAVVHLASWKTLYKMLITKTVSINDEKELLKVLREKEHGEIKIRILW--
3cosA           GGWKSVDSIPKLVTDYKNKKFNLDALVTHTLPFDKISEAFDLMNQGKSIRTILIF----
2cdaB           GLVNQKPHFQQAVVHLASWKTLYKMLITKTVSINDEKELLKVLREKEHGEIKIRILW--
2c0cA           HYLKYQAAMSHLLEMCVSGDLVCEVPEGRFTGLESIFRAVNYMY-MGKNTGKIVVEL--
2c0cB           HYLKYQAAMSHLLEMCVSGDLVCEVPEGRFTGLESIFRAVNYMY-MGKNTGKIVVEL--
2dm6A           GFIVYRWQLRDLMKWVLEGKIQY--HEHVTKGFENMPAAFIEMLNG-ANLGKAVVT---
1ch6A           -----------------------------------------------------------
2dg2A           LTAPKKSATHFTGRYHYLGGRFVPPALEKKYQLNLPSYPDT------------------
1dlgA           APHPAFPTDMQAQFTLLNLVAEGTGVITETIFENRFMHVPELIRMGAH-----------
3c3pB           -----------------------------------------------------------
2ebjA           -----------------------------------------------------------
2cqwA           -----------------------------------------------------------
2c4cB           -----------------------------------------------------------
2bryA           -----------------------------------------------------------
3dkiB           -----------------------------------------------------------
3c3pC           -----------------------------------------------------------
3eeqB           MEEI-------------------------------------------------------
1dl5A           ------GNYKLETRFITAGLLERNRKLLREFPFNREILLVR------------------
3e90B           -----------------------------------------------------------
2c4cA           -----------------------------------------------------------
3dkiA           -----------------------------------------------------------
3dwiB           -----------------------------------------------------------
1dl5B           -----------------------------------------------------------
3dwiA           -----------------------------------------------------------
2eguA           -----------------------------------------------------------
2dsqI           -----------------------------------------------------------
3dwgA           -----------------------------------------------------------
3dwgB           -----------------------------------------------------------
3e90D           -----------------------------------------------------------
2bhtD           -----------------------------------------------------------
3c85C           IYSEAGSGFA-------------------------------------------------
3e05C           VACV-------------------------------------------------------
3c85B           IYSEAGSGF--------------------------------------------------
1a3xA           -----------------------------------------------------------
3e05A           VACVNVAKTKEYKMFE-------------------------------------------
3e05D           VACVNVAKTKGLTEYKMFESHNPVYIITAW-----------------------------
3e05F           -----------------------------------------------------------
1cmvB           -----------------------------------------------------------
3c85D           -----------------------------------------------------------
3e05G           VACVNVAKTKGLTEYKMFESHNPVYIITAW-----------------------------