[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for sent8:ACF66691.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "2c61B.bssp"
#ERROR : Can't open dsspfile "3dt2A.bssp"
#ERROR : Can't open dsspfile "3cmvH.bssp"
#ERROR : Can't open dsspfile "3cmvG.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "1accA.bssp"
#ERROR : Can't open dsspfile "2dwoA.bssp"
#ERROR : Can't open dsspfile "2akaB.bssp"
#ERROR : Can't open dsspfile "3dmdC.bssp"
#ERROR : Can't open dsspfile "2c9yA.bssp"
#ERROR : Can't open dsspfile "3eiuB.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "3dtbB.bssp"
#ERROR : Can't open dsspfile "2ccjB.bssp"
#ERROR : Can't open dsspfile "3c95A.bssp"
#ERROR : Can't open dsspfile "2dwpA.bssp"
#ERROR : Can't open dsspfile "2c04A.bssp"
#ERROR : Can't open dsspfile "4dcgA.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "3cmvC.bssp"
#ERROR : Can't open dsspfile "3cmvA.bssp"
#ERROR : Can't open dsspfile "1e9fA.bssp"
#ERROR : Can't open dsspfile "2b8tA.bssp"
#ERROR : Can't open dsspfile "1e9cA.bssp"
#ERROR : Can't open dsspfile "2ccgA.bssp"
#ERROR : Can't open dsspfile "1d1cA.bssp"
#ERROR : Can't open dsspfile "1bifA.bssp"
#ERROR : Can't open dsspfile "2ccgB.bssp"
#ERROR : Can't open dsspfile "1dkiA.bssp"
#ERROR : Can't open dsspfile "2cjwB.bssp"
#ERROR : Can't open dsspfile "3dt7A.bssp"
#ERROR : Can't open dsspfile "2czvA.bssp"
#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "3b2qA.bssp"
#ERROR : Can't open dsspfile "2c03A.bssp"
#ERROR : Can't open dsspfile "3dm5A.bssp"
#ERROR : Can't open dsspfile "2c61A.bssp"
#ERROR : Can't open dsspfile "1e98A.bssp"
#ERROR : Can't open dsspfile "2ahvA.bssp"
#ERROR : Can't open dsspfile "2a5gA.bssp"
#ERROR : Can't open dsspfile "1e3mB.bssp"
#ERROR : Can't open dsspfile "2b8wA.bssp"
#ERROR : Can't open dsspfile "3dt4C.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "3dmdB.bssp"
#ERROR : Can't open dsspfile "3dt4A.bssp"
#ERROR : Can't open dsspfile "1aroP.bssp"
#ERROR : Can't open dsspfile "3eiuA.bssp"
#ERROR : Can't open dsspfile "2dr3A.bssp"
#ERROR : Can't open dsspfile "2a2zA.bssp"
#ERROR : Can't open dsspfile "1cr4A.bssp"
#ERROR : Can't open dsspfile "1e9dA.bssp"
#ERROR : Can't open dsspfile "2dr3E.bssp"
#ERROR : Can't open dsspfile "1cs4C.bssp"
#ERROR : Can't open dsspfile "2dr3B.bssp"
#ERROR : Can't open dsspfile "3cddF.bssp"
#ERROR : Can't open dsspfile "3cddC.bssp"
#ERROR : Can't open dsspfile "2a2zD.bssp"
#ERROR : Can't open dsspfile "3a1wA.bssp"
#ERROR : Can't open dsspfile "3d7wA.bssp"
#ERROR : Can't open dsspfile "3b2qB.bssp"
#ERROR : Can't open dsspfile "3czpB.bssp"
#ERROR : Can't open dsspfile "1culC.bssp"
#ERROR : Can't open dsspfile "2a30A.bssp"
#ERROR : Can't open dsspfile "1e4yA.bssp"
#ERROR : Can't open dsspfile "3d3kA.bssp"
#ERROR : Can't open dsspfile "1e9sG.bssp"
#ERROR : Can't open dsspfile "2ahwD.bssp"
#ERROR : Can't open dsspfile "2c9oC.bssp"
#ERROR : Can't open dsspfile "2bifA.bssp"
#ERROR : Can't open dsspfile "3ed8A.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "3ec1A.bssp"
#ERROR : Can't open dsspfile "2a30D.bssp"
#ERROR : Can't open dsspfile "2akaA.bssp"
#ERROR : Can't open dsspfile "2bofX.bssp"
#ERROR : Can't open dsspfile "1dg3A.bssp"
#ERROR : Can't open dsspfile "1e1qB.bssp"
#ERROR : Can't open dsspfile "3cmxA.bssp"
#ERROR : Can't open dsspfile "3bpbA.bssp"
#ERROR : Can't open dsspfile "3bb1A.bssp"
#ERROR : Can't open dsspfile "1e9sF.bssp"
#ERROR : Can't open dsspfile "3b85A.bssp"
#ERROR : Can't open dsspfile "1bmfC.bssp"
#ERROR : Can't open dsspfile "1cr1A.bssp"
#ERROR : Can't open dsspfile "1e2fA.bssp"
#ERROR : Can't open dsspfile "2a30B.bssp"
#ERROR : Can't open dsspfile "1dhiA.bssp"
#ERROR : Can't open dsspfile "2bc9A.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"
#ERROR : Can't open dsspfile "3cbnA.bssp"
#ERROR : Can't open dsspfile "2ctsA.bssp"
#ERROR : Can't open dsspfile "2d4hB.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "3cr7D.bssp"
#ERROR : Can't open dsspfile "3cmvB.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "2a2zB.bssp"
#ERROR : Can't open dsspfile "421pA.bssp"
#ERROR : Can't open dsspfile "2axpA.bssp"
#ERROR : Can't open dsspfile "2bkhA.bssp"
#ERROR : Can't open dsspfile "2aunA.bssp"
#ERROR : Can't open dsspfile "3dm9B.bssp"
#ERROR : Can't open dsspfile "2ck3C.bssp"
#ERROR : Can't open dsspfile "3cddD.bssp"
#ERROR : Can't open dsspfile "2bx2L.bssp"
#ERROR : Can't open dsspfile "2b8tC.bssp"
#ERROR : Can't open dsspfile "2cgtH.bssp"
#ERROR : Can't open dsspfile "1bg0A.bssp"
#ERROR : Can't open dsspfile "3bjdB.bssp"
#ERROR : Can't open dsspfile "1e0jA.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "3da4A.bssp"
#ERROR : Can't open dsspfile "3adkA.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"
#ERROR : Can't open dsspfile "1ai4B.bssp"
#ERROR : Can't open dsspfile "3bgwA.bssp"
#ERROR : Can't open dsspfile "1cr2A.bssp"
#ERROR : Can't open dsspfile "1cjtC.bssp"
#ERROR : Can't open dsspfile "2axzC.bssp"
#ERROR : Can't open dsspfile "2ausC.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "1e3mA.bssp"
#ERROR : Can't open dsspfile "3bb1E.bssp"
#ERROR : Can't open dsspfile "2bdtA.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "2c4rL.bssp"
#ERROR : Can't open dsspfile "1dvrA.bssp"
#ERROR : Can't open dsspfile "2d4hA.bssp"
#ERROR : Can't open dsspfile "2b8tB.bssp"
#ERROR : Can't open dsspfile "3c8uA.bssp"
#ERROR : Can't open dsspfile "3cmtD.bssp"
#ERROR : Can't open dsspfile "3bb1H.bssp"
#ERROR : Can't open dsspfile "3bb1F.bssp"
#ERROR : Can't open dsspfile "3bczC.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "3bb1B.bssp"
#ERROR : Can't open dsspfile "1e9sD.bssp"
#ERROR : Can't open dsspfile "2d0kA.bssp"
#ERROR : Can't open dsspfile "2bkiA.bssp"
#ERROR : Can't open dsspfile "3cmwC.bssp"
#ERROR : Can't open dsspfile "3di4A.bssp"
#ERROR : Can't open dsspfile "2a5jA.bssp"
#ERROR : Can't open dsspfile "3cr7C.bssp"
#ERROR : Can't open dsspfile "3d3qB.bssp"
#ERROR : Can't open dsspfile "2bnlB.bssp"
#ERROR : Can't open dsspfile "2aumA.bssp"
#ERROR : Can't open dsspfile "3bgwD.bssp"
#ERROR : Can't open dsspfile "3a00A.bssp"
#ERROR : Can't open dsspfile "1e2gA.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "2bwjA.bssp"
#ERROR : Can't open dsspfile "1e9sE.bssp"
#ERROR : Can't open dsspfile "2bnlA.bssp"
#ERROR : Can't open dsspfile "3cr7A.bssp"
#ERROR : Can't open dsspfile "1e2hB.bssp"
#ERROR : Can't open dsspfile "2bjbA.bssp"
#ERROR : Can't open dsspfile "2dpyA.bssp"
#ERROR : Can't open dsspfile "2drcA.bssp"
#ERROR : Can't open dsspfile "3czpA.bssp"
#ERROR : Can't open dsspfile "2bkeA.bssp"
#ERROR : Can't open dsspfile "2b0lC.bssp"
#ERROR : Can't open dsspfile "3bo6B.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1e9rG.bssp"
#ERROR : Can't open dsspfile "3d3qA.bssp"
#ERROR : Can't open dsspfile "1e3aB.bssp"
#ERROR : Can't open dsspfile "2eg5G.bssp"
#ERROR : Can't open dsspfile "2b92B.bssp"
#ERROR : Can't open dsspfile "2d4uA.bssp"
#ERROR : Can't open dsspfile "1draA.bssp"
#ERROR : Can't open dsspfile "3cmvE.bssp"
#ERROR : Can't open dsspfile "3dauA.bssp"
#ERROR : Can't open dsspfile "3bh0A.bssp"
#ERROR : Can't open dsspfile "1dhjA.bssp"
#ERROR : Can't open dsspfile "1d6jB.bssp"
#ERROR : Can't open dsspfile "3crmA.bssp"
#ERROR : Can't open dsspfile "3dlbB.bssp"
#ERROR : Can't open dsspfile "1e59A.bssp"
#ERROR : Can't open dsspfile "2cvfA.bssp"
#ERROR : Can't open dsspfile "2a1fF.bssp"
#ERROR : Can't open dsspfile "2c7cH.bssp"
#ERROR : Can't open dsspfile "3dfnC.bssp"
#ERROR : Can't open dsspfile "1cjuC.bssp"
#ERROR : Can't open dsspfile "1ek0A.bssp"
#ERROR : Can't open dsspfile "3bm2B.bssp"
#ERROR : Can't open dsspfile "2dpyB.bssp"
#ERROR : Can't open dsspfile "1e9sB.bssp"
#ERROR : Can't open dsspfile "3clvA.bssp"
#ERROR : Can't open dsspfile "3e8aC.bssp"
#ERROR : Can't open dsspfile "1eilA.bssp"
#ERROR : Can't open dsspfile "2bnlC.bssp"
#ERROR : Can't open dsspfile "1e9sJ.bssp"
#ERROR : Can't open dsspfile "3bb1C.bssp"
#ERROR : Can't open dsspfile "1e9sL.bssp"
#ERROR : Can't open dsspfile "1e9rF.bssp"
#ERROR : Can't open dsspfile "3dffA.bssp"
#ERROR : Can't open dsspfile "1bglA.bssp"
#ERROR : Can't open dsspfile "1e2kA.bssp"
#ERROR : Can't open dsspfile "2b8wB.bssp"
#ERROR : Can't open dsspfile "1e0jB.bssp"
#ERROR : Can't open dsspfile "2dr3C.bssp"
#ERROR : Can't open dsspfile "2b8tD.bssp"
#ERROR : Can't open dsspfile "3c15C.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "3cueF.bssp"
#ERROR : Can't open dsspfile "1cfrA.bssp"
#ERROR : Can't open dsspfile "3cm0A.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "3dfpC.bssp"
#ERROR : Can't open dsspfile "1e9sH.bssp"
#ERROR : Can't open dsspfile "2dr3F.bssp"
#ERROR : Can't open dsspfile "1e9sM.bssp"
#ERROR : Can't open dsspfile "2dr3D.bssp"
#ERROR : Can't open dsspfile "2c0bL.bssp"
#ERROR : Can't open dsspfile "2a1fD.bssp"
#ERROR : Can't open dsspfile "3ch4B.bssp"
#ERROR : Can't open dsspfile "1d2zD.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"
#ERROR : Can't open dsspfile "3be4A.bssp"
#ERROR : Can't open dsspfile "1av6A.bssp"
#ERROR : Can't open dsspfile "2bhjA.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "3ecpA.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "3czjA.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "3c14C.bssp"
#ERROR : Can't open dsspfile "1e9rE.bssp"
#ERROR : Can't open dsspfile "1d6aA.bssp"
#ERROR : Can't open dsspfile "3c7kA.bssp"
#ERROR : Can't open dsspfile "5dfrA.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "2a1fE.bssp"
#ERROR : Can't open dsspfile "3dfpD.bssp"
#ERROR : Can't open dsspfile "3cr7B.bssp"
#ERROR : Can't open dsspfile "1drbA.bssp"
#ERROR : Can't open dsspfile "3bb1G.bssp"
#ERROR : Can't open dsspfile "3dfdA.bssp"
#ERROR : Can't open dsspfile "3dftC.bssp"
#ERROR : Can't open dsspfile "3dftD.bssp"
#ERROR : Can't open dsspfile "3dfoD.bssp"
#ERROR : Can't open dsspfile "2aumB.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "2ancF.bssp"
#ERROR : Can't open dsspfile "1aldA.bssp"
#ERROR : Can't open dsspfile "3dfqA.bssp"
#ERROR : Can't open dsspfile "1eamA.bssp"
#ERROR : Can't open dsspfile "6aldA.bssp"
#ERROR : Can't open dsspfile "3dfnA.bssp"
#ERROR : Can't open dsspfile "1adoA.bssp"
#ERROR : Can't open dsspfile "3dfnD.bssp"
#ERROR : Can't open dsspfile "3b9qA.bssp"
#ERROR : Can't open dsspfile "3dfqD.bssp"
#ERROR : Can't open dsspfile "4atjA.bssp"
#ERROR : Can't open dsspfile "3b55A.bssp"
#ERROR : Can't open dsspfile "2bhvD.bssp"
#ERROR : Can't open dsspfile "1dyhA.bssp"
#ERROR : Can't open dsspfile "3dymA.bssp"
#ERROR : Can't open dsspfile "1e9sI.bssp"
#ERROR : Can't open dsspfile "3bjqB.bssp"
#ERROR : Can't open dsspfile "1azsC.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "4dfrA.bssp"
#ERROR : Can't open dsspfile "3cioD.bssp"
#ERROR : Can't open dsspfile "3c85A.bssp"
#ERROR : Can't open dsspfile "1chdA.bssp"
#ERROR : Can't open dsspfile "2aexA.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "2bwjB.bssp"
#ERROR : Can't open dsspfile "3cmuA.bssp"
#ERROR : Can't open dsspfile "1e2kB.bssp"
#ERROR : Can't open dsspfile "2bhvA.bssp"
#ERROR : Can't open dsspfile "2a1fC.bssp"
#ERROR : Can't open dsspfile "2aunB.bssp"
#ERROR : Can't open dsspfile "2b0lB.bssp"
#ERROR : Can't open dsspfile "1e2mA.bssp"
#ERROR : Can't open dsspfile "2bhvC.bssp"
#ERROR : Can't open dsspfile "2bwjD.bssp"
#ERROR : Can't open dsspfile "2e85A.bssp"
#ERROR : Can't open dsspfile "1e2mB.bssp"
#ERROR : Can't open dsspfile "3dfqC.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "1cjvC.bssp"
#ERROR : Can't open dsspfile "3dvlD.bssp"
#ERROR : Can't open dsspfile "3bv4A.bssp"
#ERROR : Can't open dsspfile "2bv7A.bssp"
#ERROR : Can't open dsspfile "3dfoC.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "3dkvA.bssp"
#ERROR : Can't open dsspfile "1e2lA.bssp"
#ERROR : Can't open dsspfile "2d7vA.bssp"
#ERROR : Can't open dsspfile "2d7vB.bssp"
#ERROR : Can't open dsspfile "1e9rB.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "2e85B.bssp"
#ERROR : Can't open dsspfile "2ccjA.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "2boeX.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "3dm5B.bssp"
#ERROR : Can't open dsspfile "3d1mB.bssp"
#ERROR : Can't open dsspfile "1e2iA.bssp"
#ERROR : Can't open dsspfile "3cqcA.bssp"
#ERROR : Can't open dsspfile "1akeA.bssp"
#ERROR : Can't open dsspfile "1e2jB.bssp"
#ERROR : Can't open dsspfile "3d1mA.bssp"
#ERROR : Can't open dsspfile "3dyoA.bssp"
#ERROR : Can't open dsspfile "1dw9A.bssp"
#ERROR : Can't open dsspfile "2ancD.bssp"
#ERROR : Can't open dsspfile "1dekB.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "2a78A.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "2anbA.bssp"
#ERROR : Can't open dsspfile "1e9sA.bssp"
#ERROR : Can't open dsspfile "2bwjF.bssp"
#ERROR : Can't open dsspfile "3brwA.bssp"
#ERROR : Can't open dsspfile "3cwzA.bssp"
#ERROR : Can't open dsspfile "3cnlA.bssp"
#ERROR : Can't open dsspfile "2e9sA.bssp"
#ERROR : Can't open dsspfile "3do6A.bssp"

## Summary of PDB Search
:588
    5e-38  18%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN
    7e-36  30%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    3e-25   9%  2c61B  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    4e-25   8%  3dt2A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    8e-25   9%  3cmvH  [x.x.x] PROTEIN RECA
    1e-24  10%  3cmvG  [x.x.x] PROTEIN RECA
    2e-24  20%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    5e-24  10%  1accA  [x.x.x] ANTHRAX PROTECTIVE ANTIGEN
    6e-24   9%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    2e-23  13%  2akaB  [x.x.x] DYNAMIN-1
    2e-23  10%  3dmdC  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    7e-23  10%  2c9yA  [x.x.x] ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL
    3e-22   9%  3eiuB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    5e-22  15%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    6e-22   8%  3dtbB  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    7e-22   9%  2ccjB  [x.x.x] THYMIDYLATE KINASE
    8e-22  14%  3c95A  [x.x.x] EXODEOXYRIBONUCLEASE I
    1e-21   8%  2dwpA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    1e-21  15%  2c04A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    1e-21  10%  4dcgA  [x.x.x] VP39
    2e-21  17%  1e69A  [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN
    6e-21  13%  3cmvC  [x.x.x] PROTEIN RECA
    1e-20  15%  3cmvA  [x.x.x] PROTEIN RECA
    2e-20  13%  1e9fA  [c.37.1] THYMIDYLATE KINASE
    2e-20   8%  2b8tA  [x.x.x] THYMIDINE KINASE
    2e-20  10%  1e9cA  [c.37.1] THYMIDYLATE KINASE
    2e-20  10%  2ccgA  [x.x.x] THYMIDYLATE KINASE
    4e-20   9%  1d1cA  [c.37.1 - b.34.3] MYOSIN
    5e-20   7%  1bifA  [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/
    6e-20   9%  2ccgB  [x.x.x] THYMIDYLATE KINASE
    7e-20   9%  1dkiA  [d.3.1] PYROGENIC EXOTOXIN B ZYMOGEN
    9e-20  16%  2cjwB  [x.x.x] GTP-BINDING PROTEIN GEM
    1e-19   7%  3dt7A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    1e-19   7%  2czvA  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    3e-19  10%  1e2dA  [c.37.1] THYMIDYLATE KINASE
    4e-19   9%  3b2qA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    4e-19  15%  2c03A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    1e-18  11%  3dm5A  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    1e-18   9%  2c61A  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    3e-18  10%  1e98A  [c.37.1] THYMIDYLATE KINASE
    4e-18  11%  2ahvA  [x.x.x] PUTATIVE ENZYME YDIF
    7e-18   8%  2a5gA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    9e-18  12%  1e3mB  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    1e-17   9%  2b8wA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    2e-17   8%  3dt4C  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    2e-17  15%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-17   9%  3dmdB  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    3e-17   8%  3dt4A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    4e-17   9%  1aroP  [e.8.1] T7 RNA POLYMERASE
    6e-17  10%  3eiuA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    8e-17   9%  2dr3A  [x.x.x] UPF0273 PROTEIN PH0284
    8e-17   9%  2a2zA  [x.x.x] DEOXYCYTIDINE KINASE
    8e-17  10%  1cr4A  [c.37.1] DNA PRIMASE/HELICASE
    1e-16  10%  1e9dA  [c.37.1] THYMIDYLATE KINASE
    1e-16   8%  2dr3E  [x.x.x] UPF0273 PROTEIN PH0284
    2e-16  17%  1cs4C  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    5e-16   9%  2dr3B  [x.x.x] UPF0273 PROTEIN PH0284
    6e-16   9%  3cddF  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    7e-16   7%  3cddC  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    8e-16  10%  2a2zD  [x.x.x] DEOXYCYTIDINE KINASE
    9e-16   9%  3a1wA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    9e-16  13%  3d7wA  [x.x.x] BETA-GALACTOSIDE-SPECIFIC LECTIN 1
    1e-15   8%  3b2qB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    1e-15  10%  3czpB  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    1e-15  15%  1culC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    2e-15   9%  2a30A  [x.x.x] DEOXYCYTIDINE KINASE
    2e-15  12%  1e4yA  [c.37.1 - g.41.2] ADENYLATE KINASE
    2e-15  10%  3d3kA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
    3e-15  12%  1e9sG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-15   9%  2ahwD  [x.x.x] PUTATIVE ENZYME YDIF
    9e-15   7%  2c9oC  [x.x.x] RUVB-LIKE 1
    9e-15   9%  2bifA  [c.37.1 - c.60.1] PROTEIN
    2e-14  13%  3ed8A  [x.x.x] YELLOW FLUORESCENCE PROTEIN
    2e-14   9%  1e9rA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-14  19%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-14   7%  3ec1A  [x.x.x] YQEH GTPASE
    4e-14   7%  2a30D  [x.x.x] DEOXYCYTIDINE KINASE
    5e-14   8%  2akaA  [x.x.x] MYOSIN II HEAVY CHAIN
    5e-14  12%  2bofX  [x.x.x] ENDOGLUCANASE E-2
    6e-14  10%  1dg3A  [c.37.1 - a.114.1] PROTEIN (INTERFERON-INDUCED
    6e-14  11%  1e1qB  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    7e-14  13%  3cmxA  [x.x.x] PROTEIN RECA
    8e-14   8%  3bpbA  [x.x.x] DIMETHYLARGININE DIMETHYLAMINOHYDROLASE
    8e-14  13%  3bb1A  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    8e-14   9%  1e9sF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    9e-14  10%  3b85A  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    1e-13   8%  1bmfC  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    1e-13  12%  1cr1A  [c.37.1] DNA PRIMASE/HELICASE
    1e-13  14%  1e2fA  [c.37.1] THYMIDYLATE KINASE
    2e-13   9%  2a30B  [x.x.x] DEOXYCYTIDINE KINASE
    2e-13  12%  1dhiA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-13   9%  2bc9A  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    3e-13  11%  2cckA  [x.x.x] THYMIDYLATE KINASE
    4e-13  13%  3cbnA  [x.x.x] CONSERVED PROTEIN MTH639
    4e-13   8%  2ctsA  [x.x.x] CITRATE SYNTHASE
    4e-13   8%  2d4hB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    5e-13  20%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-13  14%  3cr7D  [x.x.x] ADENYLYL-SULFATE KINASE
    6e-13  12%  3cmvB  [x.x.x] PROTEIN RECA
    8e-13  10%  1ckvA  [x.x.x] PROTEIN (PROTEIN B)
    1e-12   8%  2a2zB  [x.x.x] DEOXYCYTIDINE KINASE
    2e-12   9%  421pA  [x.x.x] H-RAS P21 PROTEIN
    2e-12  10%  2axpA  [x.x.x] HYPOTHETICAL PROTEIN BSU20280
    2e-12   5%  2bkhA  [x.x.x] UNCONVENTIONAL MYOSIN
    2e-12   9%  2aunA  [x.x.x] HYPOTHETICAL PROTEIN
    2e-12  12%  3dm9B  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    3e-12   9%  2ck3C  [x.x.x] ATP SYNTHASE ALPHA CHAIN HEART ISOFORM
    3e-12   9%  3cddD  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    4e-12   7%  2bx2L  [x.x.x] RIBONUCLEASE E
    4e-12   7%  2b8tC  [x.x.x] THYMIDINE KINASE
    5e-12  10%  2cgtH  [x.x.x] 60 KDA GROEL
    6e-12   7%  1bg0A  [a.83.1 - d.128.1 (1m15A)] ARGININE KINASE
    7e-12  13%  3bjdB  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)
    7e-12  13%  1e0jA  [c.37.1] DNA HELICASE
    7e-12  15%  1e6cA  [c.37.1] SHIKIMATE KINASE
    7e-12   8%  3da4A  [x.x.x] COLICIN-M
    7e-12  11%  3adkA  [x.x.x] ADENYLATE KINASE
    9e-12  12%  2cckB  [x.x.x] THYMIDYLATE KINASE
    1e-11   7%  1ai4B  [d.153.1] PENICILLIN AMIDOHYDROLASE
    1e-11  10%  3bgwA  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    1e-11  10%  1cr2A  [c.37.1] DNA PRIMASE/HELICASE
    1e-11  18%  1cjtC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    2e-11   7%  2axzC  [x.x.x] PRGX
    2e-11   7%  2ausC  [x.x.x] PSEUDOURIDINE SYNTHASE
    2e-11  14%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-11  13%  1e3mA  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    2e-11  10%  3bb1E  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-11  10%  2bdtA  [x.x.x] BH3686
    2e-11  20%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-11   7%  2c4rL  [x.x.x] RIBONUCLEASE E
    3e-11  10%  1dvrA  [c.37.1 - g.41.2] ADENYLATE KINASE
    3e-11  10%  2d4hA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    3e-11  10%  2b8tB  [x.x.x] THYMIDINE KINASE
    3e-11  18%  3c8uA  [x.x.x] FRUCTOKINASE
    3e-11  11%  3cmtD  [x.x.x] PROTEIN RECA
    3e-11  12%  3bb1H  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    4e-11  12%  3bb1F  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    4e-11   8%  3bczC  [x.x.x] PROTEIN MEMO1
    5e-11  13%  1cr0A  [c.37.1] DNA PRIMASE/HELICASE
    6e-11  10%  3bb1B  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    6e-11  11%  1e9sD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    7e-11  13%  2d0kA  [x.x.x] DIHYDROFOLATE REDUCTASE
    9e-11   7%  2bkiA  [x.x.x] UNCONVENTIONAL MYOSIN
    1e-10  14%  3cmwC  [x.x.x] PROTEIN RECA
    1e-10  10%  3di4A  [x.x.x] UNCHARACTERIZED PROTEIN DUF1989
    1e-10   8%  2a5jA  [x.x.x] RAS-RELATED PROTEIN RAB-2B
    1e-10  13%  3cr7C  [x.x.x] ADENYLYL-SULFATE KINASE
    1e-10  13%  3d3qB  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    2e-10   8%  2bnlB  [x.x.x] MODULATOR PROTEIN RSBR
    2e-10   7%  2aumA  [x.x.x] HYPOTHETICAL PROTEIN
    3e-10   9%  3bgwD  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    3e-10  14%  3a00A  [x.x.x] GUANYLATE KINASE
    3e-10  10%  1e2gA  [c.37.1] THYMIDYLATE KINASE
    3e-10  15%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    3e-10  12%  2bwjA  [x.x.x] ADENYLATE KINASE 5
    3e-10  18%  1e9sE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-10  10%  2bnlA  [x.x.x] MODULATOR PROTEIN RSBR
    3e-10  12%  3cr7A  [x.x.x] ADENYLYL-SULFATE KINASE
    4e-10  10%  1e2hB  [c.37.1] THYMIDINE KINASE
    4e-10  11%  2bjbA  [x.x.x] 3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE
    4e-10  20%  2dpyA  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    5e-10  12%  2drcA  [c.71.1] DIHYDROFOLATE REDUCTASE
    5e-10   8%  3czpA  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    5e-10   5%  2bkeA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    5e-10   7%  2b0lC  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    5e-10  10%  3bo6B  [x.x.x] HYDROPHILIC PROTEIN, VIRA PROTEIN
    6e-10   8%  1afrA  [a.25.1] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    7e-10  19%  1e9rG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    7e-10   9%  3d3qA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    7e-10   9%  1e3aB  [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT
    8e-10  13%  2eg5G  [x.x.x] XANTHOSINE METHYLTRANSFERASE
    1e-09   8%  2b92B  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-09  12%  2d4uA  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    1e-09  12%  1draA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-09  12%  3cmvE  [x.x.x] PROTEIN RECA
    1e-09  13%  3dauA  [c.71.1 (1ddrA)] DIHYDROFOLATE REDUCTASE
    1e-09   9%  3bh0A  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    1e-09  11%  1dhjA  [c.71.1] DIHYDROFOLATE REDUCTASE
    2e-09  13%  1d6jB  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    2e-09  14%  3crmA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    2e-09  10%  3dlbB  [x.x.x] ARGONAUTE
    2e-09  10%  1e59A  [c.60.1] PHOSPHOGLYCERATE MUTASE
    2e-09   7%  2cvfA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB
    3e-09  14%  2a1fF  [x.x.x] URIDYLATE KINASE
    3e-09  11%  2c7cH  [x.x.x] 60 KDA CHAPERONIN
    3e-09  10%  3dfnC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-09  17%  1cjuC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    4e-09  12%  1ek0A  [c.37.1] PROTEIN (GTP-BINDING PROTEIN YPT51)
    4e-09   7%  3bm2B  [x.x.x] PROTEIN YDJA
    4e-09  20%  2dpyB  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    5e-09  21%  1e9sB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-09  10%  3clvA  [x.x.x] RAB5 PROTEIN, PUTATIVE
    7e-09  18%  3e8aC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    9e-09   6%  1eilA  [d.32.1 - d.32.1] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE
    1e-08  11%  2bnlC  [x.x.x] MODULATOR PROTEIN RSBR
    1e-08  10%  1e9sJ  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-08  12%  3bb1C  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-08  18%  1e9sL  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-08  18%  1e9rF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-08   7%  3dffA  [x.x.x] TEICOPLANIN PSEUDOAGLYCONE DEACETYLASES ORF2
    2e-08   8%  1bglA  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    2e-08  14%  1e2kA  [c.37.1] THYMIDINE KINASE
    3e-08   8%  2b8wB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    3e-08   9%  1e0jB  [c.37.1] DNA HELICASE
    3e-08   9%  2dr3C  [x.x.x] UPF0273 PROTEIN PH0284
    3e-08   9%  2b8tD  [x.x.x] THYMIDINE KINASE
    3e-08  14%  3c15C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    4e-08  22%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    5e-08  10%  3cueF  [x.x.x] GTP-BINDING PROTEIN YPT1
    5e-08  13%  1cfrA  [x.x.x] RESTRICTION ENDONUCLEASE
    5e-08  13%  3cm0A  [x.x.x] ADENYLATE KINASE
    6e-08  19%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    6e-08  10%  3dfpC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    8e-08  16%  1e9sH  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    8e-08  11%  2dr3F  [x.x.x] UPF0273 PROTEIN PH0284
    1e-07  20%  1e9sM  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-07  11%  2dr3D  [x.x.x] UPF0273 PROTEIN PH0284
    1e-07   8%  2c0bL  [x.x.x] RIBONUCLEASE E
    1e-07  15%  2a1fD  [x.x.x] URIDYLATE KINASE
    1e-07  11%  3ch4B  [x.x.x] PHOSPHOMEVALONATE KINASE
    1e-07   5%  1d2zD  [a.77.1] DEATH DOMAIN OF TUBE
    1e-07   9%  1dekA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    1e-07  12%  3be4A  [x.x.x] ADENYLATE KINASE
    1e-07   4%  1av6A  [c.66.1] PROTEIN (VP39 PROTEIN (E.C.2.7.7.19))
    2e-07   8%  2bhjA  [x.x.x] NITRIC OXIDE SYNTHASE
    2e-07  17%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-07  11%  3ecpA  [x.x.x] TN5 TRANSPOSASE
    2e-07  21%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-07   6%  3czjA  [x.x.x] BETA-GALACTOSIDASE
    2e-07  17%  2d2eA  [x.x.x] SUFC PROTEIN
    2e-07  15%  3c14C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    2e-07  10%  1e9rE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-07   9%  1d6aA  [d.165.1] POKEWEED ANTIVIRAL PROTEIN
    3e-07  15%  3c7kA  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
    3e-07  12%  5dfrA  [x.x.x] DIHYDROFOLATE REDUCTASE
    3e-07  25%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-07  14%  2a1fE  [x.x.x] URIDYLATE KINASE
    3e-07   8%  3dfpD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-07  14%  3cr7B  [x.x.x] ADENYLYL-SULFATE KINASE
    5e-07  11%  1drbA  [c.71.1] DIHYDROFOLATE REDUCTASE
    5e-07  11%  3bb1G  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    5e-07   8%  3dfdA  [x.x.x] PROTEIN YQBN
    5e-07   8%  3dftC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    5e-07   8%  3dftD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    5e-07   8%  3dfoD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    5e-07   7%  2aumB  [x.x.x] HYPOTHETICAL PROTEIN
    8e-07  22%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    8e-07  15%  2ancF  [x.x.x] GUANYLATE KINASE
    9e-07   9%  1aldA  [c.1.10 (2aldA)] ALDOLASE A
    9e-07  10%  3dfqA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-06  11%  1eamA  [c.66.1] PROTEIN (VP39)
    1e-06   9%  6aldA  [c.1.10] FRUCTOSE-1,6-BIS(PHOSPHATE) ALDOLASE
    1e-06   9%  3dfnA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-06   9%  1adoA  [c.1.10] ALDOLASE
    1e-06   9%  3dfnD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-06  17%  3b9qA  [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT
    1e-06   8%  3dfqD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-06  10%  4atjA  [a.93.1] PROTEIN (PEROXIDASE C1A)
    2e-06   7%  3b55A  [x.x.x] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN
    2e-06  12%  2bhvD  [x.x.x] COMB10
    2e-06  13%  1dyhA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-06   6%  3dymA  [x.x.x] BETA-GALACTOSIDASE
    3e-06  16%  1e9sI  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-06   6%  3bjqB  [x.x.x] PHAGE-RELATED PROTEIN
    5e-06  13%  1azsC  [c.37.1 - a.66.1] GS-ALPHA
    5e-06  17%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    5e-06  14%  4dfrA  [c.71.1] DIHYDROFOLATE REDUCTASE
    6e-06   9%  3cioD  [x.x.x] TYROSINE-PROTEIN KINASE ETK
    6e-06  11%  3c85A  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    7e-06  12%  1chdA  [x.x.x] CHEB METHYLESTERASE
    8e-06  14%  2aexA  [x.x.x] COPROPORPHYRINOGEN III OXIDASE, MITOCHONDRIAL
    8e-06  15%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-06  23%  2bwjB  [x.x.x] ADENYLATE KINASE 5
    9e-06  13%  3cmuA  [x.x.x] PROTEIN RECA
    1e-05  13%  1e2kB  [c.37.1] THYMIDINE KINASE
    1e-05  11%  2bhvA  [x.x.x] COMB10
    1e-05  12%  2a1fC  [x.x.x] URIDYLATE KINASE
    2e-05   9%  2aunB  [x.x.x] HYPOTHETICAL PROTEIN
    2e-05   9%  2b0lB  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    2e-05  12%  1e2mA  [c.37.1] THYMIDINE KINASE
    2e-05   9%  2bhvC  [x.x.x] COMB10
    2e-05  24%  2bwjD  [x.x.x] ADENYLATE KINASE 5
    2e-05  14%  2e85A  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    2e-05  11%  1e2mB  [c.37.1] THYMIDINE KINASE
    3e-05  10%  3dfqC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-05  16%  1ckeA  [c.37.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    3e-05  17%  1cjvC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    3e-05  14%  3dvlD  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    4e-05  10%  3bv4A  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-05   7%  2bv7A  [x.x.x] GLYCOLIPID TRANSFER PROTEIN
    4e-05  10%  3dfoC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-05  16%  2d2fA  [x.x.x] SUFC PROTEIN
    5e-05  13%  3dkvA  [x.x.x] ADENYLATE KINASE
    6e-05   8%  1e2lA  [c.37.1] THYMIDINE KINASE
    6e-05  14%  2d7vA  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    6e-05  12%  2d7vB  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    6e-05  16%  1e9rB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    7e-05  29%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-05  24%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-05  19%  2e85B  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    1e-04   9%  2ccjA  [x.x.x] THYMIDYLATE KINASE
    1e-04  25%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-04   8%  2boeX  [x.x.x] ENDOGLUCANASE E-2
    1e-04  51%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    1e-04  14%  3dm5B  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    1e-04  15%  3d1mB  [x.x.x] SONIC HEDGEHOG PROTEIN
    1e-04   9%  1e2iA  [c.37.1] THYMIDINE KINASE
    1e-04  18%  3cqcA  [x.x.x] NUCLEAR PORE COMPLEX PROTEIN NUP107
    2e-04   6%  1akeA  [c.37.1 - g.41.2] ADENYLATE KINASE
    2e-04  12%  1e2jB  [c.37.1] THYMIDINE KINASE
    2e-04  19%  3d1mA  [x.x.x] SONIC HEDGEHOG PROTEIN
    2e-04   7%  3dyoA  [x.x.x] BETA-GALACTOSIDASE
    3e-04  12%  1dw9A  [a.35.1 - d.72.1] CYANATE LYASE
    3e-04  19%  2ancD  [x.x.x] GUANYLATE KINASE
    3e-04   9%  1dekB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    3e-04   9%  1d8jA  [a.4.5] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    5e-04  39%  2a78A  [x.x.x] RAS-RELATED PROTEIN RAL-A
    5e-04  17%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    7e-04  33%  2anbA  [x.x.x] GUANYLATE KINASE
    7e-04  24%  1e9sA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    7e-04  24%  2bwjF  [x.x.x] ADENYLATE KINASE 5
    9e-04   9%  3brwA  [x.x.x] RAP1 GTPASE-ACTIVATING PROTEIN 1
    9e-04  32%  3cwzA  [x.x.x] RAS-RELATED PROTEIN RAB-6A
    0.001  30%  3cnlA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    0.001  32%  2e9sA  [x.x.x] RAS-RELATED PROTEIN RAB-6B
    0.001  21%  3do6A  [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
:588

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3b60A           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
2bnlB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
2bnlA           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2bnlC           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
3cwzA           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
2e9sA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxWLRERVGFHAGQHIRFEIRRQVLDRLQQAGPAWIQGKPAGSWATLVLEQIDDMHDYYARY
3b60A           ----------YISSYCISWVSGKVVMTMRRRLFGHMMGMPVAFFDKQSTGTLLSRITYDSEQVASXXXXX
3b5jA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------GSLDSLPQEVRKFVEGN-------
3cmvH           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1accA           ---------------------------------PDSLEVEGYTVDVKNKRTFLS------PWISNIHEKK
2dwoA           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
3dtbB           ----------------QLHNGLDFSAKVIQGSLDSLPQEVRKFVE-GNAQLCQPEYIHICDGSEEEYGRL
2ccjB           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
2bnlB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
2bnlA           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2bnlC           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
3cwzA           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
2e9sA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LPQMALAVCVPLLIVAAIFPSNWAAALILLGTAPLIPLFMAMVGMGAADANRRNFLALARLSGHFLDRLR
3b60A           XXXXXXXXXXXXXXXXXXFYYSXXXXXXXXXXXXXXXXXXXXXXKRFRSISKNMQNTMGQVTTSAEQMLK
3b5jA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
3dt2A           -----AQLCQPEYIHICDGSEEEYGRLLMQEEGVIRKLKKYDNCWLALTDPRRIESKTVIITQEQRDTVP
3cmvH           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1accA           GLTKYKSS--PEKWSTASDPYSDFEK-VTGRIDKNVSPRHPLVAAYPIVHVDMENIILSKNETISKNTST
2dwoA           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
3dtbB           LAHMQEEGVIRKLKKY-----------------DNCWLALTDPRDVARIESKT-----VIITQEQRDTVP
2ccjB           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
3dt7A           --------IHICDGSEEEYGRLLAHMQEEGVIRKLKKYDNCWLALTDPRDVARIESKTVIITQEQRDTVP
2czvA           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------VIITQEQRDTVP
2bbsA           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
3dt4A           ----------------------LLAHMQEEGVIRKLKYDNCWLALTDPRDVARIESKTVIITQEQRDTVP
1aroP           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
3bgwA           --------------------------------------------------------AEQAVLGSILTEPE
1cr2A           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
2bnlB           --------------------------------------------------YQFIAENQNELLQLWTDTLK
2aumA           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
2bnlA           -------------------------------------------------VYQFIAENQNELLQLWTDTLK
3cr7A           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2bnlC           ------------------------------------------------TVYQFIAENQNELLQLWTDTLK
1e9sJ           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
3cwzA           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
2e9sA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GMETLRIFGRGEAETESIRAASQDFRQRTMEVLRLAFLSSGVLEFFTSLSIALVAVYFGFSYLGELNFGH
3b60A           GHKEVLIFGGQEVETKRFDKVSNKMRLQGMKMVS-------ASSISXXXXXXXXXXXXXXXXXXXXXXXV
3b5jA           ----------------------------------------------------------------------
2c61B           -----------------------------------------------PLIFVEKTEPVGYNEIVNIKMGD
3dt2A           IPKSGQSQLGRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLAKIGIELTDSPYVVMTRMGTS
3cmvH           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1accA           SRTHTSEVVSAGFSNSNSSTVAIDHSLSLAGGLNTADT------ARLNANIRYVNTGTAPIYNVLPTTSL
2dwoA           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
3eiuB           -----------------------------------------------PLIFVEKTEPVGYNEIVNIKMGD
2c03B           ----------------------------------------------------------------------
3dtbB           IPKSGQSQLGRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLAKIGIELTDSPYVVA--SMRI
2ccjB           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
3dt7A           IPKSGQSQLGRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLAKIGIELTDSSMRIMTRMGTS
2czvA           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
3b2qA           ---------------------------------------AGPLIFVEKTEPVGYNEIVNIKMGDGTVRR-
2c03A           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
2c61A           -----------------------------------------------PLIFVEKTEPVGYNEIVNIKMGD
1e98A           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
3dt4C           IPKSGQSQLGRWMSEEDFEKAFNARKGRTMYVIPFSMGPLGSPLAKIGIELTDSPYVVASMRIMTRMGTS
2bbsA           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
3dt4A           IPKSGQSQLGRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLAKIGIELTDSPYVVASMRIMT
1aroP           ----------------------------------------------------------------------
3eiuA           -----------------------------------------------PLIFVEKTEPVGYNEIVNIKMGD
2dr3A           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
3b2qB           --------------------------------------------------TEPVGYNEIVNIKMGDGTVR
3czpB           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
3ed8A           -----------------------------------------------------------FSVRGEGEGGK
1e9rA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
1e1qB           -------------------------------------------HGLRNVQAEEM-VEFSSGLKGMLNLEP
3cmxA           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
1bmfC           --------------------ADTSVDLE--ETGRVLSIGDGIARGLRNVQAEEMVEFSSGLKGMSLNLEP
1cr1A           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
2ck3C           ---------------------------DLEETGRVLSIGDGIAHGLRNVQAEEMVEFSSGLKGMSLNLEP
3cddD           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
3da4A           --------------------------------------------------------------------GA
3adkA           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
3bgwA           LIKECPLHFSPGKHFNIYFTMQDLDRKGQSVDFTIAARVGEKLPQLGGFGYLTELAASVASTT---TFKQ
1cr2A           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
2bnlB           ELSEQESYQLTDQVYENISKEYIDILLLSVKDENAAESQISELALRAVQIGLSKFLATALAEFWKRLYTK
2aumA           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
2bnlA           ELSEQESYQLTDQVYENISKEYIDILLLSVKDENAAESQISELALRAVQIGLSKFLATALAEFWKRLYTK
3cr7A           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2bnlC           ELSEQESYQLTDQVYENISKEYIDILLLSV---KDENAAESQISELALRAVQIGLSKFLATALAEFWKRL
1e9sJ           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
3cwzA           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
2e9sA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           YGTGVTLAAGFLALILAPEFFQPLRDLGTFYHAKAQAVGAADSLKTFLETPLAHPARGEVELAENEPVTI
3b60A           MDXXXXXXXXXXXXXXXXXXXXXXX-LTNVNAQFQRGMAACQTLFAILDSEQEKDEGKRVIDRATGDLEF
3b5jA           ----------------------------------------------------------------------
2c61B           GTVRRGQVLDSSADIVVVQVFIFTGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLLDINGAAMNPY
3dt2A           VLEALGDGEFIKCLHSVGCPLPLKKPLVNNWACNPELTLIAHLPDRREIISFGSGYGGNSLLGKKCFARI
3cmvH           ---------------------------------------------------------------------D
3cmvG           ----------------------------------------------------------------------
2d3wB           ---------------------------------------------------------------------L
1accA           VLGKNQTLATIKAKENQLSQILAP---NNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRL
2dwoA           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
3dmdC           ------------------------------------ALEVVDALREKIKQK---LVGKKVRIGTDKGAVK
2c9yA           ----------------------------------------------------------------------
3eiuB           GTVRRGQVLDSSADIVVVQVFIFTGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLLDINGAAMNPY
2c03B           ------------------DLKATLREI---RRALMDADVNLEVTRDFVERVREEALGKQVLESLT-PAEV
3dtbB           MTRMGTSVLEALGDGEFIKCLHSVGCPLPLKKPLVNNWACNPELTLIAHLPDRREIISFGSGYGGNSLLA
2ccjB           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
2c04A           ------------------DLKATLREI---RRALMDADVNLEVARDFVERVREEALGKQVLESLTPAE-V
4dcgA           -------------------------------------VVSLDKPFMYFEEI--------DNELDYEPESA
1e69A           ----------------------------------------------------------------------
3cmvC           ------------------------------------------------------KQFGKGSIMRLGEDRS
3cmvA           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
1dkiA           NLGGELSGSNMYVYNGFVIVSGDKRSPEILGYSTSGSFDVNGKENIASFMESYVEQIKENKKLPVVKSLL
2cjwB           ----------------------------------------------------------------------
3dt7A           VLEALGDGEFIKCLHSVGCPLPLKKPLVNNWACNPELTLIAHLPDRREIISFGSGYGGNSLLGKKCFARI
2czvA           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
3b2qA           -----GQVLDSSADIV---VVQVFEIFTGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDINGAAMNPY
2c03A           ------------------DLKATLREI---RRALMDADVNLEVTRDFVERVREEALGKQVLESLTPAE-V
3dm5A           -----------ASSVDEALIKELVRDI---QRALIQADVNVRLVLQLTREIQRRALEEKPPAGISKKEHI
2c61A           --GTVRRGQVLDSSADIVVVQVFFTGETLKLPASVDLLGRLSGSGEPRDGGPRIVPDQLLDINGAAMNPY
1e98A           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------TGPM-C
3dt4C           VLEALGDGEFIKCLHSVGCPLPLKKPLVNNWACNPELTLIAHLPDRREIISFGSGYGGNSLLGKKCFALI
2bbsA           ----------------------------------------------------------------------
3dmdB           ------------------------------------ALEVVDALREKIKQKLVGKKVRIGTDKGKIIEEA
3dt4A           RMGTSVLEALIKCLHSVGCPLPLKKPLVNNWACNPELTLIAHLPDRREIISFGSGYGGNSLLGKKCFA-L
1aroP           ----------------------------------------------------------------------
3eiuA           -GTVRRGQVLDSSADIVVVQVFFTGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLLDINGAAMNPY
2dr3A           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
3cddF           ----IVLKAGGKIYWTKIGITRSLEASGAFDLETYKFNDAQYKAFIEPIKQ-GQACTVDIGGERVITGYV
3cddC           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
3b2qB           RGQVLDSSADIVVVQVFE-GVIFTGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLLDINGAAMNPY
3czpB           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1e9sG           ------------------------------------------------------PFKRFLRGTRIVSG-G
2ahwD           ----------------------------------------------------------------------
2c9oC           -----------------------------------KSTTKTQRIA-----SHSHVKGLGLDESGLAKQAA
2bifA           ----------------------------------------------------------------------
3ed8A           LTLKFICTTGKLPPTLVTTLLQCFARYPDFFKSAMPEGYVQERTISFKDDGKYKTRAVVKFEGDTLVNRI
1e9rA           --------------------------------------------------------KRFLRGTRIVSG-G
2awnC           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------TGPM-C
1e1qB           -DNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGII
3cmxA           ----------------------------------------------------------------------
3bpbA           -------------------------------------------------------------------IIA
3bb1A           ----------------------------------------------------------------------
1e9sF           -----------------------------------------------QGEFGGAPFKRFLRGTRIVSG-G
3b85A           ----------------------------------------------------------------------
1bmfC           DNVGVVVFGNDKLIKEGD-IVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGII
1cr1A           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
2bc9A           ------------------------------------------------------------EIHMTGPM-C
2cckA           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------TGPM-C
2awnB           --------------------------------------------------------------------SV
3cr7D           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
1ckvA           ------------------------------------------------------------------SVNS
2a2zB           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2bkhA           ---------EDNCSL---MYLNEATLLHNIKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSETIKSYQG
2aunA           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------KVRIGTDKGKII
2ck3C           -DNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGII
3cddD           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
2cgtH           --------------------------------ARVKMLRGVNVLADAVKVTLGPKGR-------NVVLDK
1bg0A           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
1e0jA           -------------------------------------------------------------------GVV
1e6cA           ----------------------------------------------------------------------
3da4A           FSLSAPHVPGAGPLLV-QVVYSFFQSPNMCLQALTQLEDYIKKHGASNPLTLQIISTNIGYFCNADRNLV
3adkA           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
3bgwA           HCQTVSEYF------QKRKAISIAQQIIENVNVKPIQEAVSELMEIEASGTDDDDGSIDEALVTVYEEIE
1cr2A           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2awnD           --------------------------------------------------------------------SV
1e3mA           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------TGPM-C
2b8tB           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
1e9sD           ---------------------------------------------------------------------G
2d0kA           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
3di4A           ------------------------------------------------NDSLPRPDLALYRAAR------
2a5jA           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
2bnlB           N---------DESTELIWQIDRFFSPINTEIFNQYSI---------------------------------
2aumA           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
2d62A           ---------------------------------------------------------------------V
2bwjA           ----------------------------------------------------------------------
1e9sE           ---------------------------------------------------------------------G
2bnlA           NDKES-----TELIWQIDRFFSPINTE-------------------------------------------
3cr7A           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
2bjbA           -------------------------------------------------------GRGASTISRDTELML
2dpyA           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
2eg5G           ---------------------------------------------------------GDTSYAKN--SAY
2b92B           ----------------------------------------------------------------TGPM-C
2d4uA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
3bh0A           -------------------------------------------------------------------IES
1dhjA           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
3dlbB           -----------------------------------------------------YAYRLYPKGRRPLDPKD
1e59A           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2bnlC           YTKRLPDQESTELIWQIDRFFSPINTEIFNQ---------------------------------------
1e9sJ           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
1e9sL           ---------------------------------------------------------------------G
1e9rF           ---------------------------------------------------------------------G
3dffA           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------TGPM-C
1e0jB           ---------------------------------------------------------------------S
2dr3C           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
2d3wD           ---------------------------------------------------------------------L
3dfpC           ----------------------------------------------------------------------
1e9sH           --------------------------------------------------------KRFLRGTRIVSG-G
2dr3F           ----------------------------------------------------------------------
1e9sM           ---------------------------------------------------------------------G
2dr3D           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1d2zD           -------------------RNTELRRVENDIYRLAKILDENSCWRKLMSIIPKGMDVQACSGAGCLNPAE
1dekA           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
2d3wC           ---------------------------------------------------------------------L
3ecpA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2d2eA           ---------------------------------------------------------------------L
3c14C           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
2awnA           --------------------------------------------------------------------SV
2a1fE           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
3dfdA           -------------------------------------------------------------------IDA
3dftC           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
1eamA           -----------------------------------------------LDKPFMYFIDNELDYEPA-----
6aldA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
3b9qA           ----------IDELLLFWNLAETDRVLDELEEALLVSDFGPKITVRIVERLREDIMSGKLKSGS---EIK
3dfqD           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
1e9sI           ---------------------------------------------------------------------G
3bjqB           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
2bbtB           ---------------------------------------------------------------------E
2bwjB           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
2d7vA           ------------------------------------------------ASPHVVPVPLSVEANVDEEAFV
2d7vB           --------------------------------SRAHTWEFDGGSKILASASPHVVVPLSVEANVDEEAFV
1e9rB           -----------------------------------------------------------------RIVSG
2bbtA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dm5B           -----------ASSVDEALIKELVRDIQRAL---IQADVNVRLVLQLTREIQRRALEEKPPAGISKKEHI
3d1mB           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
1e9sA           ---------------------------------------------------------------------G
2bwjF           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
3cwzA           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
2e9sA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           DAVNLIITSPEGKTLAGPLNFSLAAGERAVLVGRSGSGKSSLLNVLSGFLSYQGSLRINGVELRDLSPES
3b60A           RNVTFTYPGREVPALRN-INLKIPAGKTVALVGRSGSGKSTIASLITRFYDIEGHILMDGHDLREYTLAS
3b5jA           ------------------INLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPEGQVLIDGHDLALADPNW
2c61B           ARLPPKDFIQTGISTIDG-TNTLVRGQKLPIFSASGLPHNEIALQIARQASPGSESAFAVVFAAMGITEE
3dt2A           ASRLAKEEGWLAEHMLIGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGKVECVGDDIAWMKFDAQGN
3cmvH           RSMDVETISTGSLSLDIAGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREKTCAFIDAEHALDPIYA
3cmvG           ------------------GAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQRGKTCAFIDAEHALDPI--
2d3wB           SIKDLHVSVEDKAILRG-LSLDVHPGEVHAIMGPNGSGKSTLSATLAGREVTGGTVEFKGKDLLALSPDR
1accA           DTVLPQIQETTARIIFNG-KDLNLVERRIAAVNPSTTKPDMALKIAFGFNEPNGNLQYQGKD--------
2dwoA           ------IWVPVDHRPSLPRSCGPNSPTVIVMVGLPARGKTYISKKLTRYLNWIVPTKVFNVGEYRREAVK
2akaB           ---DLIPLVNRLQDAFSAIGQNALDLPQIAVVGGQSAGKSSVLENFVGRDFPRGSGIVTRRPLVLQLVNS
3dmdC           EAVSEILETSRRIDLIE-EIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHFSVVIAASDTFRAGAIE
2c9yA           -------------------------GIRAVLLGPPGAGKGTQAPRLAENFCVCLATGDMLRAMVASGSEL
3eiuB           ARLPPKDFIQTGISTIDG-TNTLVRGQKLPIFSASGLPHNEIALQIARQASPGSESAFAVVFAAMGITEE
2c03B           ILATVYEALKEALGGEA-RLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKRRPLLVAADTQRPAARE
3dtbB           SRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMNPTLPGWKVECVGDDIAWMKFDAQGN
2ccjB           ------------------------------FEGPEGSGKTTVINEVYHRLVDYDVIMTREPGGVPTGEEI
3c95A           ------------------LLELDSDTLRAVPVKLVHINKCPVLAQANTLRPDADRLGINRQHCLDNLKPQ
2dwpA           ------------------IWVPVDHRNSPVMVGLPARGKTYISKKLTRYLNWIVPTKVFNVGEYRREAVK
2c04A           ILATVYEALKEALGGE-ARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKKGRRPLLVAADTQRPAARE
4dcgA           NEVAKLPYQGQLKLLLGELFFLSKGILDGATVVYIGSAPGTHIRYLRDHFYLGVIIKWMLIDGRHHDPIL
1e69A           ------------------PSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKDMIFAGSENLPPAGSAY
3cmvC           MDVETISTGSLSLDIAL-GAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIY
3cmvA           ------------------GAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQEGKTCAFIDAEHALDPIYA
1e9fA           -------------------------GALIVLEGVDGAGKSTQSRKLVEALCAAHRAELLRFPERSTEI--
2b8tA           -------------------------GWIEFITGPMFAGKTAELIRRLHRLEYAVKYLVFKPKIDTRSIRN
1e9cA           -------------------------GALIVLEGVDRAGKSTQSRKLVEALCAGHRAELLRFPERSTEIGK
2ccgA           ------------------------------FEGPEGSGKTTVINEVYHRLVKDDVIMTREPGGVPTGEE-
1d1cA           ---------FAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVGRNQAGVLEQQILQANP
1bifA           -------------------------PTLIVMVGLPARGKTYISKKLTRYLNIGVPTREFNVGQYRRDMVK
2ccgB           -------------------------SAFITFEGPEGSGKTTVINEVYHRLVKDDVIMTREPGGVPTGEEI
1dkiA           DSKGIHYNQGNPYNLLTPVIEKVKPGEQSGQHAATGSVATATAQIMKYHNYNKGLKDYTYTLSSNNPY--
2cjwB           -------------------------YYRVVLIGEQGVGKSTLANIFAGVEDTYRTLMVDGESATIILLDM
3dt7A           ASRLAKEEGWLAEHMLLGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDIAWMKFDAQGN
2czvA           -----------GGGGVKFIEMDIRDKEAYELAKEWFDEVVVSIKFNEEVDKKLREARKEYGKVAILLSNP
1e2dA           -------------------------GALIVLEGVDRAGKSTQSRKLVEALCAGHRAELLRFPERSTEIGK
3b2qA           ARLPPKDFIQTGISTID-GTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPSESAFAVVFAAMGITNE
2c03A           ILATVYEALKEALGGE-ARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKKGRRPLLVAADTQRPAARE
3dm5A           IKIVYEELTKFLGTEAK-PIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRYKVGVVCSDTWRPGAYH
2c61A           ARLPPKDFIQTGISTID-GTNTLVRGQKLPIFSASGLPHNEIALQIARQASPGSESAFAVVFAAMGITNE
1e98A           -------------------------GALIVLEGVDRAGKSTQSRKLVEALCAGHRAELLRFPERSTEIGK
2ahvA           -------------------VNYIPDEATLCVLGAILEATTLITALADKYKQTQLGDRADRGISPLAQEGL
2a5gA           -------------------------EMRILMLGLDAAGKTTILYKLKLGQVTTIPTVGFNVETVTYKNVK
1e3mB           ---------------------------------------------------------KPGIRITEG----
2b8wA           LIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFLGSTVQSHTKGIWMWCV
3dt4C           ASRLAKEEGWLAEHMLLGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGKVECVGDDIAWMKFDAQGN
2bbsA           --FGELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGEL-------------EPSEGKI
3dmdB           VKEAVSEILETSRRIDIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHFSVVIAASDTFRAGAIE
3dt4A           RIASRLAKEEGWLAEHMLITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGKVECVGDDIAWMKFDAQGN
1aroP           ----------------------------------------------------------------------
3eiuA           ARLPPKDFIQTGISTIDG-TNTLVRGQKLPIFSASGLPHNEIALQIARQASVPSESAFAVVFAAMGITEE
2dr3A           -----------IPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLMGEPGIYVALEEHPVQVRQ
2a2zA           -------------------------IKKISIEGNIAAGKSTFVNILKQLCEWEVVPEPVARWCNVQSTNV
1cr4A           --------LFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEET
1e9dA           -------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAHRAELLRFPERSTEIGK
2dr3E           ------------------LHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLMGEPGIYVALEEHPVQVRQ
1cs4C           ------------------------ATHRLLLLGAGESGKSTIVKQMRILHVEKATKVQDIKNNLKEAIET
2dr3B           --------------------------------RRVKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFS
3cddF           DDWVPSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKFGIKVIVNTDVGEPFQRIQ
3cddC           -----------------------------KAGGKIYQGWTKIGITRSLTYKFQYKAFIEPIKQGQACTVD
2a2zD           -------------------------IKKISIEGNIAAGKSTFVNILKQLCEWEVVPEPVARWCNVQMMYE
3a1wA           ---------------------------KVALAGCPNVGKTSLFNALTGTKYVANWPGVTVEKKEGVFTYK
3d7wA           -----------NIPLLRQSTVPVSEGQRFVLVELTNAGGDTITAAIDVTNLYVAYEAGNQSYFLSDAPAG
3b2qB           ARLPPKDFIQTGISTID-GTNTLVRGQKLPIFSASGLPHNEIALQIARQASPGSESAFAVVFAAMGITNE
3czpB           ------------------DKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRYHIVPIA---APTEEER
1culC           ------------------------ATHRLLLLGAGESGKSTIVKQMRILHVEKATKVQDIKNNLKEAIET
2a30A           -------------------------IKKISIEGNIAAGKSTFVNILKQLCEWEVVPEPVARWCNVQSTNV
1e4yA           ---------------------------RIILLGALVAGKGTQAQFIMEKYGPQISTGDMLRAAVKSGSEL
3d3kA           ---------LHKKLLSVAEKHGLTLERRLEMTGVCASQMALTLLGGPQR--PTVALLCGPHVKGAQGISC
1e9sG           KLKRMTREKAKQVTVAG-VPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLRGDRMVIVDPNGDMLSKFG
2ahwD           ------------------AVNYIPDEATLCVLGAILEATTLITALADKYKQTQLGDRADRGISPLAQEGL
2c9oC           S--GLVGQENACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIQELGSKVPFCPMVGSEVYSTEIKK
2bifA           -----------------------------VMVGLPARGKTYISKKLTRYLNFIVPTREFNVGQYRRDMVK
3ed8A           ELKGT--DFKEDGNILGHKLEYNFNSHNVYITATRGTQKNGIKANFTVRHNEDGSVQLADHYQQNTPIGD
1e9rA           KLKRMTREKAKQVTVAG-VPMPRDAERHLLVNGATGTGKSVLLRELAYTGLRGDRMVIVDPNGDMLSKFG
2awnC           --------------------------------ASVQLQNVTVSKDINLDIH-EGEFVVFVGPSTLLRMIA
3ec1A           ------------------------------------------------------VITTSYFPGTTLDMIE
2a30D           -------------------------IKKISIEGNIAAGKSTFVNILKQLCEDEVVPEPVARWCNVQSTNV
2akaA           -------HIFAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVGRNQANGSGVLEQQILQ
2bofX           ---------------------------------------------------NMSSAEWVRNNPNDPRTPV
1dg3A           LIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKHTKIWMWCVPHPKKPGHILV
1e1qB           PRISVREPMQTGIKAVD-SLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKFNDGTDEKKKLYCIYVAIG
3cmxA           ------------------GAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREKTCAFIDAEHAL--DPI
3bpbA           RTPARSLVDGLTSSHLGKPDYAKALEQHNAYIRALQVDITLLPPDERFFVEDPVLCTSRCAIITRPGAES
3bb1A           ------------------LKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVSISPFQSEGPRPVMVSRSR
1e9sF           KLKRMTREKAKQVTVAG-VPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLRGDRMVIVDPNGDMLSKFG
3b85A           ------------------YVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQKQVSRIILTRPAVEAGEKL
1bmfC           PRISVREPMQTGIKAVDS-LVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRNDGTDEKKKLYCIYVAIG
1cr1A           ------------------KTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEET
1e2fA           -------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAG--HRAELLRFPERSTE
2a30B           -------------------------IKKISIEGNIAAGKSTFVNILKWEVVPEVARWCNVQSTNVLQMMY
1dhiA           ----------------------------------------------------------------------
2bc9A           LIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKFSLGSTVQSHTKGIWMWCV
2cckA           -----------------------------TFEGPEGSGKTTVINEVYHRLVDYDVIMTREPGGVPTGEEI
3cbnA           -----------------------------------------------------YTLRARGHPNVT----A
2ctsA           ------------------LIPKEQIKTFRQQHGNTAVGQITVDMMYGGMRGKGLVYETSVLDPDEGIRFY
2d4hB           LIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNWMWCVPHPKPGHILVLLDTEGLGQND
2awnB           QLQNVTKAWGEVVVSKD-INLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITGDLFIGEKRMNDTPPAE
3cr7D           ------------------------RGLTIWLTGLSASGKSTLAVELEHQLRDRRVHAYRLDGDNIRFGLN
3cmvB           ------------------GAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIY
1ckvA           NAYDAGIMKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYRAGYWWIKANGKIEVDCDE
2a2zB           -------------------------IKKISIEGNIAAGKSTFVNILKQLCEDEVVPEPVARWCNVQSTNV
421pA           -------------------------EYKLVVVGARGVGKSALTIQLIQNHFVDYDPTIEDSYRKQVVIDG
2axpA           ------------------------------LEGPDCCFKSTVAAKLSKELKYPIKGSSFELAKSGNEKFN
2bkhA           KSLGTMPPHVFAADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESGTGQDID---DRIVEAN
2aunA           ----------------------------------------------------------------------
3dm9B           EEAAVSEILETSRRIDLIEEIRKAEKPYVIFVGFNGSGKTTTIAKLANWLKNHFSVVIAASDTFRAGAIE
2ck3C           PRISVREPMQTGIKAVDS-LVPIGRGQRELIIGDRQTGKTSIAIDTIINQKFNDGTDEKKKLYCIYVAIG
3cddD           EEIVLKA---GGKIYQGWTKIGITRS-----LEASGAFDLETY---KFNDAQYKAFIEPIKQGQACTVD-
2bx2L           ----------------------------------------------------------------------
2b8tC           -------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVLVFKPKIDSRTGTSL
2cgtH           SFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLQAIITEGLKAVAAGMNP
1bg0A           ---------GMGATLLDVIQSGVELDSGVGIYAPDAESYRTFGPLFDPIIDDYHGGFKPPKQWGDINTLV
3bjdB           --------------------------------------------SLPQLQNLPEEARIVA---DALAVHA
1e0jA           SALSLRERIREGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAGKKVGLAMLEESVEETA
1e6cA           --------------------------EPIFMVGARGCGMTTVGRELARALGYEFVDTIFMQHTSGMTVAD
3da4A           LHPGISVYDAYHF----AKPAPSQYDYRSMNMKQMSGNVTTPIVALAHYLWNGAERSVNIANINQIKDII
3adkA           ------------------MEEKLKKSKIIFVVGGPGSGKGTQCEKIVQKYGYHLSTGDLLRAEVSSGSAR
2cckB           -----------------------------TFEGPEGSGKTTVINEVYHRLVKYDVIMTREPGGVPTGEEI
1ai4B           -------------------TINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGKWDWKGLLPFEMN
3bgwA           SADGNITGVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDN-DDVVNLHSLEMGKKEN
1cr2A           --------LFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEET
1cjtC           ------------------------ATHRLLLLGAGESGKSTIVKQMRILHVGEATKVQDIKNNLKEAIET
2axzC           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2awnD           QLQNVTKAWGEVVVSKD-INLDIHEGEFVVFVGPSGCGKSTLLRMIAGLEITSGDLFIGEKRMNDTPPAE
1e3mA           -----------------------------------LVNLAERAYTLNYTCPTFDKPGIRITEGRHPVVEQ
3bb1E           ------------------LKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGRPVMVSRSR
2bdtA           --------------------------KLYIITGPAGVGKSTTCKRLAAQLDSAYIEGDIINHVVGGYRPP
2bbsB           -----------AFWVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQNS
2c4rL           ---------------------------------------------------QWDLSFRLKHWEAIKKAAE
1dvrA           -------------------------SIRMVLIGPPGAGKGTQAPNLQERFHAALATGDMLRSQIAKGTQL
2d4hA           LIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFLGSTVQKGIWMWCVPPK
2b8tB           -------------------------GWIEFITGPMFAGKTAELIRRLHRLADVKYLVFKPKILPSVEVES
3c8uA           ------------------LDPRQPGRQLVALSGAPGSGKSTLSNPLAAALSAQ-GLPAEVVPDGFHLDNR
3cmtD           ----------------------LPMGRIVEIYGPESSGKTTLTLQVIAAAQREKTCAFIDAEHALDPI--
3bb1H           ------------------LKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSSPFQSEGPRPVMVSRSR
3bb1F           ------------------LKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVISPFQSEGPRPVMVSRSR
3bczC           -----------------------GSWYTASGPQLNAQLEGWLSQVQSTKRPRAIIAPHAGYTYCGSCAAH
1cr0A           --------LFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEET
3bb1B           ------------------LKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSSPFQSGPRPVMVSRSRA
1e9sD           KLKRMTREKAKQVTVAG-VPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLRGDRMVIVDPNGDMLSKFG
2d0kA           ----------------------------------------------------------------------
2bkiA           -----------IADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESGTGQDID---DRIVEAN
3cmwC           ------------------GAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREKTCAFIDAEHALDPI--
3di4A           --ASARKTGEVLVPPREGRCFEVKAGQFFRISSVEGPQVGDLNL----HNLHDLTERFFSGKTRALHGTH
2a5jA           -----------------GLVPRGSYLFKYIIIGDTGVGKSCLLLQFTDKRFQPIGEFGARMVNIDGKQIK
3cr7C           ------------------------RGLTIWLTGLSASGKSTLAVELEHQLVDRRVHAYRLDGDNIRFGLN
3d3qB           -------------------------PFLIVIVGPTASGKTELSIEVAKKFNEIISGDSQVYQGDIGTAKV
2bnlB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
3bgwD           ------------------MTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSNDDVVNLHSLEMGKKENIK
3a00A           -----------------------------VISGPSGTGKSTLLKKLFAEYPSFGFSVSSTTRTPRAGEVN
1e2gA           -------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAHRAELLRFPERSTEIGK
2d62A           KLINIWKRFGDVTAVKD-LSLEIKDGEFLVLLGPSGCGKTTTLRIAGLEEPTRGQIYIEDNLVADPEKGV
2bwjA           -------------------MEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFT-HLSTGELLREELASES
1e9sE           KLKRMTREKAKQVTVAG-VPMPRDAEPRHLLNGATGTGKSVLLRELAYTGLLRDRMVIVDPNGDMLSKFG
2bnlA           ----------------------------------------------------------------------
3cr7A           -------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVAYRLDGDNIRFGLN
1e2hB           ----------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDWRVLGASETIANIYTT
2bjbA           DALQTLRVDGVGSELTSGRIEPGPGAR--VDCGLAGT----VLRFVPPLAALGVPVTFDGDQARGRPIAP
2dpyA           ------------------ALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTADVIVVGLIGERGREVKDFI
2drcA           ----------------------------------------------------------------------
3czpA           ---AVIELREALLEAQFELKQQARFPVIILINGIEGAGKGETVKLLNEWDPLIEVQSFLRPSDEELERPP
2bkeA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
3bo6B           ---NQMRQMPMSHFREA-LDAPDYSGMRQSGFFAMSQGFQLESHGGDVFMHAHRENPQCKGDFAGDKFHI
1afrA           ------------------VTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWPQDFLPDPASDGFDEQV
1e9rG           ---RMTREKAKQVTVAG-VPMPRDAEPRHLLNGATGTGKSVLLRELAYTGLRGDRMVIVDPNGDMLSKFG
3d3qA           -------------------------PFLIVIVGPTASGKTELSIEVAKKFNEIISGDSQVYQGDIGTAKV
1e3aB           ---------WTQQAAKQALTINWYYADVNGNIGYVHTGAYPDRQSGHDPRLKWDWKGLLPFEMNPKVYNP
2eg5G           NQLVLAKVKPVVRELLRANLPNINKCIKVADLGCAS-GPNTLLTVRDIVQSIDKVGQIFLNDLFPNDFNS
2b92B           LIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGSLGSTVQSHTKGIWMWCV
2d4uA           ------------------------------PLGSGGLFFNALKNCKENFTVQQSTLNGSWVALLQTRNTL
1draA           ----------------------------------------------------------------------
3cmvE           ------------------GAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGTCAFIDAEHALDPIYA
3dauA           ----------------------------------------------------------------------
3bh0A           ADGNITGVPSGFTELDR-MTYGYKRRNFVLIAARPSMGKTAFALKQAKNMDNDDVVNLHSLEMGKKENIK
1dhjA           ----------------------------------------------------------------------
1d6jB           ------------------TELRNQRGLTIWLTGLSASGKSTLAVELEHQLRRVHAYRLDGDNIRFGLNKD
3crmA           -------------------------PPAIFLMGPTAAGKTDLAMALADALPCLISVDSALIYRGMDIGTA
3dlbB           PGERSVLSALARRLLQERLRVWVEGLAVYRREHARGPGWR----------------VLGGAVLDLWVSDS
1e59A           -------------------------GESQWNKENRFTGWYDVDLSEKGVSEAKKEEGYSFDFAYTSVLKR
2cvfA           ------------------LGGGFAPGVLTQVYGPYASGKTTLALQTGLLSGKKVAYVDTEGGFSPERLVQ
2a1fF           ----------------------------------------------------------------------
2c7cH           -----PTITKDGVSVAREIELDKFENMGAQMVKEVASKATTTATVLAQAAGMNPMDLKRGIDLKALSVPC
3dfnC           ----------------------------------------------------------------------
1cjuC           ------------------------ATHRLLLLGAGESGKSTIVKQMRILH-VNGEKATKVQDIKNNLKEA
1ek0A           -----------------------------VLLGEAAVGKSSIVLRFVSNDFANKEPTIGAAFLTQRVTIN
3bm2B           ----------------------------------------------------------------------
2dpyB           ------------------ALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTADVIVVGLIGERGREVKDFI
1e9sB           ---RMTREKAKQVTVAG-VPMPRDAEPRHLLVGATGTGKSVLLRELAYTGLRGDRMVIVDPNGDMLSKFG
3clvA           ---------------------EKKSSYKTVLLGESSVGKSSIVLLTKDTFHENTNTTIGAVNLNDNYNEN
3e8aC           ------------------------ATHRLLLLGAGESGKSTIVKQMRILH-VNGEKATKVQDIKNNLKEA
1eilA           ----------------------------------------------------------------------
2bnlC           ----------------------------------------------------------------------
1e9sJ           ---RMTREKAKQVTVAG-VPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLRGDRMVIVDPNGDMLSK--
3bb1C           ------------------LKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVISPFQSEGPRPVMVSRSR
1e9sL           KLKRMTREKAKQVTVAG-VPMPRDAEPRHLLNGATGTGKSVLLRELAYTGLRGDRMVIVDPNGDMLSKFG
1e9rF           KLKRMTREKAKQVTVAG-VPMPRDAEPRHLLNGATGTGKSVLLRELAYTGLRGDRMVIVDPNGDMLSKFG
3dffA           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
1e2kA           ----------------------MPTLLRVYIDGPHGMGKTTTTQLLVADDIVYPEPMTYWRVLGASETIA
2b8wB           LIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKFSLGSTVQSHTKGIWMWCV
1e0jB           SEESVGLLFSGCTGIND-KTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEET
2dr3C           -------RVKTGIGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLMGEPGIYVALEEHPVQVRQ
2b8tD           -------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKVFKPKSIRNIQSRT
3c15C           -------------------------THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKEAIE
3dhwC           ------------------VSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTGSVLVDGQELTTLSESE
3cueF           ----------------------YDYLFKLLLIGNSGVGKSCLLLRFSDDYISTIGVDFKIKTVELDGKTV
1cfrA           ------------------------------IISKSGEGNKYTINSAIAFVAYASHIDINTTEFSFINDEA
3cm0A           -------------------------GQAVIFLGPPGAGKGTQASRLAQELGKKLSTGDILRDHVA-RGTP
2d3wD           SIKDLHVSVEDKAILRG-LSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLLALS
3dfpC           ----------------------------------------------------------------------
1e9sH           KLKRMTREKAKQVTVAG-VPMPRDAEPRHLVNGATGTGKSVLLRELAYTGLLRGRMVIVDPNGDMLSKFG
2dr3F           ------------------LHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGPGIYVALEEHPVQVRQ
1e9sM           KLKRMTREKAKQVTVAG-VPMPRDAEPRHLLNGATGTGKSVLLRELAYTGLLRDRMVIVDPNGDMLSKFG
2dr3D           ------------------LHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMEPGIYVALEEHPVQVRQ
2c0bL           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
3ch4B           ------------------APLGGAPRLVLLFSGKRKSGKDFVEALQSRLGADVCAVLRLSGPLKEQYAQE
1d2zD           IKKGFKYTAQDVFQIDE-AANRLPPDQSKSQTSGKLNERPTVGVLLQLLVQAEADFVALDFLNESTPARP
1dekA           ------------------------------LSGVKRSGKDTTADFIMSNYSAVYQLAGPIKDALAYAWGV
3be4A           -------------------------KHNLILIGAPGSGKGTQCE-FIKKEYGLAHLSTGDMLRIKNGIGL
1av6A           ------------------------GILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPI
2bhjA           -----------------------------------------------------GEILHDTLHHKATSCLG
2d3wC           SIKDLHVSVEDKAILRG-LSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGTVEFKGKDLLALSP
3ecpA           --------------------------------------------------------------------HR
2awoC           ------------------INLDIHEGEFVVFVGPSGCGKSTLLRMIALETITSGDLFIGE---KRMNDTP
3czjA           ----------------------------------------------------------------------
2d2eA           EIRDLWASIDGETILKG-VNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLDGENILELS
3c14C           ------------------------ATHRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKEAIE
1e9rE           ----------------------------------------------------------------------
1d6aA           -------------------MSFTEKTEAEFLLVAIQMVSEAARFKYIENQVKTNFNRAFNPNPKVLNLQE
3c7kA           ---------------------------KLLLLGAGESGKSTIVKQMKIIFSEDVKQYKPVVYSNTIQSLA
5dfrA           ----------------------------------------------------------------------
2awnA           QLQNVTKAWGEVVVSKD-INLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETTSGDLFIGEKRMNDTPPAE
2a1fE           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
3cr7B           -------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRAYRLDGDNIRFGLNKD
1drbA           ----------------------------------------------------------------------
3bb1G           ------------------LKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSSPFQSEGPRPVMVSRSR
3dfdA           EEVEVPISKRFVDKEGNVVPFIFKAIDRIDELEKENTTKEL------DSQRFYARIAVETTVYPTFKAKE
3dftC           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
3d31A           -----------KNFSLDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHPDSGRILLDGKDVTD--LSP
2ancF           -----------------------AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQVLLDIDWQG
1aldA           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
1eamA           -----KKLPYQGKLLLGELFFLRHGILDGATVVYIGSAPGTHIRYLRDHFNLGVIIKWMLIDGRHHDPIL
6aldA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
3b9qA           DALKESVLEMLAKSKTE-LQLGFRKPAVIMIVGVNGGGK-------------------------------
3dfqD           ----------------------------------------------------------------------
4atjA           ------------------------------------------------------------LHFEDCFVNG
3b55A           ----------------------------------------------------------------------
2bhvD           -----------------------------------------------------------LRTITADKMIP
1dyhA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
1e9sI           KLKRMTREKAKQVTVAG-VPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRDRMVIVDPNGDMLSKFG
3bjqB           ----------------------------------------------------------------------
1azsC           ------------------------ATHRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKEAIE
3bk7A           --------------------GEIRKGEVIGIVGPNGIGKTTFVKMLAGVEEPTEGKVEWDLTVAYKPQYI
4dfrA           ----------------------------------------------------------------------
3cioD           ------------------AMMETENNILMITGATPDSGKTFVSSTLAAVIASDQKVLFIDADLRRGYSHN
3c85A           ----------------------------------------------------HAQVLILGGRIGTGAYDE
1chdA           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
2bbtB           LFEKAKQNNNNTPVLKD-INFKIERGQLLAVAGSTGAGKT-----------------SLLMMIMGELEPS
2bwjB           -------------------MEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFT-HLSTGELLREELASES
3cmuA           ------------------GAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREKTCAFIDAEHALDPIY-
1e2kB           ----------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDWRVLGASETIANIYTT
2bhvA           -----------------------------------------------------------LRTITADKMIP
2a1fC           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
1e2mA           ----------------------MPTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPWRVLGASETIANIYTT
2bhvC           -----------------------------------------------------------LRTITADKMIP
2bwjD           ----------------------LRKCKIIFIIGGPGSGKGTQCEKLVEKYGFT-HLSTGELLREELASES
2e85A           ----------------------------------------------------------------------
1e2mB           ----------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGPMTYWRVLGASETIANIYTT
3dfqC           ----------------------------------------------------------------------
1ckeA           -----------------------AIAPVITIDGPSGAGKGTLCKAMAEAL---QWHLLDSGAIYDVASEP
1cjvC           ------------------------ATHRLLLLGAGESGKSTIVKQMRILHVEKATKVQDIKNNLKEAIET
3dvlD           ------------------SHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEE-TPQD
3bv4A           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
3dkvA           ---------------------------NIVLMGLPGAGKGTQAERIVEKYGI-PHISTGDMFRAAMKTPL
1e2lA           ----------------------MPTLLRVYIDGPHGMGKTTTTQLLDIVYVPEPMTYWRVLGASETIANI
2d7vA           AALSSCHLVFLSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVFSG---TSKPTLQQLEKHH
2d7vB           AALSSCHLVFLSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVFSG---TSKPTLQQLEKHH
1e9rB           GKLKRMTREKAKQVTVAGVPMPRDAEPRHLLVGATGTGKSVLLRELAYTGLLRDRMVIVDPNGDMLSKFG
2bbtA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dm5B           IKIVYEELTKFLGTEAK-PIEIKEKPTILLMVGIQGSGK-------------------------------
3d1mB           ----------------------------------------------------------------------
1e2iA           ----------------------MPTLLRVYIDGPHGMGKTDDIVYVPEPMTYWRANIYTTQHRLDQGEIS
3cqcA           ----------------------------------------------------------------------
1akeA           ------------------------------LLGAPGAGKGTQAQFIMEKYGIPQISTDMLRAAVKSGSEL
1e2jB           ----------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSDIVYVPEPMTYWRVLGASE
3d1mA           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dw9A           -------------------LSKAKKDLFAEIADGTGLAEAFVTAALLGQQAPADAARLVGAKLDLDEDSI
2ancD           -------------------------GTLYIVSAPSGAGKSSLIQALLKTQPLY-----------------
1dekB           -----------------------------FLSGVKRSGKDTTADFIMSNYSAV-KYQLAGPIKDA-----
1d8jA           ----------------------------------------------------------------------
2a78A           -----------------------------IMVGSGGVGKSALTLQFM-----------------------
1b0uA           ----------------------------------------------------------------------
2anbA           -----------------------AQGTLYIVSAPSGAGKSSLIQALLKTQPLY-----------------
1e9sA           KLKRMTREKAKQVTVAG-VPMPRDAEPRHLLVGATGTGKSVLLRELAYTGLLRDRMVIVDPNGDMLSKFG
2bwjF           -------------------------CKIIFIIGGPGSGKGTQCEKLVEKYGFT-HLSTGELLREELASES
3brwA           -------KHFLGKEHFNYYSLDTALGHLVFSLKYDVIGDQEHLRLLLRTKCRTYHDVIPISCLTEFPNVV
3cwzA           -----------------------------VFLGEQSVGKTSLITRFMY----------------------
3cnlA           ------------------KKLSFDRLARVLIVGVPNTGKST-----------------------------
2e9sA           -----------------------------VFLGEQSVGKTSLITRFMY----------------------
3do6A           ------------------LENHEDGKLIAVTPTPAGEGKTTTSIGLSSLNRIKKSIVTLR----------


                         .         .         +         .         .         .         .:490
query           WRQHLSWVGQNPQLPAATLRENVLLARPDASEQELYAALDAAWVSEFLPLLPQGVDTPLGNHASRLSVGX
3b60A           LRNQVALVSQNVHLFNDTVANNIAYARTEEYSREQIEEAARMAYAMDFINKMDGLDTIIGENGVLLSGGQ
3b5jA           LRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQ
2c61B           AQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAYYPGYMYTDLATLYERAGIVKGAK
3dt2A           LRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPG--VTITSWKNKE
3cmvH           RKLG-VDIDNLLCSQPDTGEQALEIC-DALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMLAARMMSQ
3cmvG           YARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMLAARMMSQ
2d3wB           AGEGIFMAFQYPVEIPGFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGE
1accA           -------ITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRDKRFHYDRNNIAVGADE
2dwoA           QYSSYNFFRPDNEEAMKVRKQCALAALRD--------------------VKSYLAKEGGQIAVFDATNTT
2akaB           TTEYAEFLHCKGKKFTDFEEETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIE
3dmdC           QLEEHAKRIGVKVIKHSYGADPAAVAY---------------------DAIQHAKARGIDVVLIDTAGRS
2c9yA           GKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSI
3eiuB           AQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYAAGYPGYMYTDLATLYERAGIVKGAK
2c03B           QLRLLGEKVGVPVLEVMDGESP---------------------ESIRRRVEEKARLEARDLILVDTAGRL
3dtbB           LRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPG--VTITSWKNKE
2ccjB           RKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPA-----LKEGKVVLCDRYIDSSLAYQGYARGIGVEEV
3c95A           VREKVVAIFAESDNVDAQLYNGFFSDADRAAMKIVLETEPRNITFVDKRIEKLLFNYRARNFPGTLDYAE
2dwpA           QYSSYNFFRPDNEEAMKVRKQCALAA--------------------LRDVKSYLAKEGGQIAVFDATNTT
2c04A           QLRLLGEKVGVPVLEVMDGES---------------------PESIRRRVEEKARLEARDLILVDTAGRL
4dcgA           NGLRDVTLVTLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVASSLKWRCPFPAQWIKDFYIPHGN
1e69A           VELVFEENGEEITVARELKRTGENTYYQRVNESFNRFISLLFFGGEGRLEISIRKPGRRDQKLSLLSGGV
3cmvC           ARKLGVDIDNLLCSQPDTGEQALEICDALARS----GAVDVIVVDSVAALT--PKAEIEGLAARMMSQAM
3cmvA           RKLGVDIDNLLCSQPD---TGEQALEICDALARSG--AVDVIVVDSVAALTPK-----------------
1e9fA           GKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTL-----VVDRYAFSGVAFTGAKENFSL
2b8tA           IQSRTGTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRENGFVVIISGLDKNFKGEPFGPI
1e9cA           LLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTL-------VVDRYAFSGVAYTGAKENFSL
2ccgA           IRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAY-----------QGYAR
1d1cA           ILEAFGNAKTTRNNNSSRFGKFIEIQFNNAGFISGASIQSYLL--EKSRVVFQSETERNYHIFYQLLAGA
1bifA           TYKSFEFFLPDNEEGLKIRKQC--------------------ALAALNDVRKFLSEEGGHVAVFDATNTT
2ccgB           RKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKE------------GKVVLCDRYIDSSLAYQGYAR
1dkiA           FNHPKNLFAAISTRQYNWNNILPTYS-------GRESNVQKMAISELMADVGISVDMDYGPSSGSAGSSR
2cjwB           WENHDHMQVGDAYLIVYSITDRASFEKASELRIQ----LRRARQTEDIPIILVGNKSDLVRREVSVSEGR
3dt7A           LRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPG--VTITSWKNKE
2czvA           KPSLVRDTVQVIRYSIEKGVDAIISPWVNRKDPGIDHVLAKLMVKKNVALGFSLRPLLYSNPYERANLLR
1e2dA           LLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTL-------VVDRYAFSGVAFTGAKENFSL
3b2qA           EAQYFMSDFEKTGALERVVFLNLADDPAVERIVTPRMALTAAEYL----AYEHGMHVLVILTDITNYAEA
2c03A           QLRLLGEKVGVPVLEVMDGE---------------------SPESIRRRVEEKARLEARDLILVDTAGRL
3dm5A           QLRQLLDRYHIEVFGNPQEKDA--------------IKLAKEGVDYFKSKGVDIIIVDTAGRHKEDKALI
2c61A           EAQYFMSDFEKTGALERAVVFLNLADDP---AVERIVTPRMALTAAEYLAYEHGMHV-LVILTDITNYAE
1e98A           LLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYA-------FSGVAFTGAKENFSL
2ahvA           VKWALCGHWGQSPRISDLAEQNKII-AYNYPQGVLTQTLRAAAAHQPGIISDIGIGTFVDPRQQGGKLNE
2a5gA           FNVWDVGGLDKIRPLWRHYYTGTIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMK
1e3mB           RHPVVEQVLNEPFIANLSPQRRLIITGPNGGKSTYRQTALIALAYIGSYVPAQKVEIGPIDRIFTRVGTF
2b8wA           PHPKKPGHILVLLDTEGLGDGDNQNDSWIFALVYNSIGTINQQAMDQLYYVTELTHRIRSKSVSFFPDFV
3dt4C           LRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPG--VTITSWKNKE
2bbsA           KHSGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKF-----AEKDNIVLITLSGGQ
3dmdB           QLEEHAKRIGVKVIKHSYGADPAAVAYD---------------------AIQHAKARGIDVVLIDTAGRS
3dt4A           LRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWE--GIDEPLAPGVTITSWKNKE
1aroP           -----------------NDFSDIELAAIPFNTLADHYG--ERLAREQLALEHESYEMGEAR----FRKMF
3eiuA           AQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAYGPGYMYTDLATLYERAGIVKGAK
2dr3A           NMAQFGWDVKPYEEKGMFAMVDAFT-------------------------AGIGKEYEKYIVHDLTDIRE
2a2zA           LQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKEKPVLFF----ERSVYSDRYIFAS---NLYESECMN
1cr4A           AEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSG----
1e9dA           LLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTL-------VVDRYAFSGVAYTGAKENFSL
2dr3E           NMAQFGWDVKPYEEKGMFAMVDAFTAGI-------------------------GKEYEKYIVHDLTDIRE
1cs4C           IVAAMSNLVPPVELANPENQFRVD----------------------------------------------
2dr3B           QQFLWNGLKMGEPGIYVALEEHPVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGEKYIVHDLTDIRE
3cddF           IEQGETPHEQRGVLLTSDTFGNLVITRASKTKAGVSLILGDNV----KAARGRFSWRQRFSKFTIKAAGI
3cddC           IGGERVITGYVDDWVPSYDESTITISYPSGQFNNQTLTQIADIVCKPFGIKVIVNTDVGEPFQRIQIEQG
2a2zD           KPERWSFTFQTYACLSRIRAQLASLNEKPVLFFERSVYSDRYIFASNLYESECMNETEWTI----YQDWH
3a1wA           GYTINLIDLPGTYSLGYSSIDEKIARDYLLKG-DADLVILVADSVNPEQSLYLLLEILEMEKKVILAMTA
3d7wA           AETQDFSGTTSSSQP-----------FNGSYPDLERYAGHRDQIPLGIDQLIQSVTALRFPGGQTKTQA-
3b2qB           EAQYFMSDFEKTGALERVVFLNLADDPAVERIVTPRMALTAAEMGRGYPGYMYTDLATLYERAGIVKGAK
3czpB           AQPYLWRFWRHIPARRQFTIFDRSWYGRVLVERIEGFCAPADWLRAYGEIQLSEYGIIVVKFWLAIDKQT
1culC           IVAAMSNLVPPVELANPENQFRVDYILSVMNVP-------------------------------------
2a30A           LQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNETEWTIYQDWH
1e4yA           GKQAKDIMDAGKLVTDELVIALVKE-------------------------RIAQEDCRNGFLLDGFPRTI
3d3kA           GRHLANHDVQVILFLPNFVKMLESITNELSLFSKTQGQQVSSLKDLPTSPVDLVINCLDCPENVFLRDQP
1e9sG           RDKDIILNPYDQRTKGWSFFNEIDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMR
2ahwD           VKWALCGHWGQSPRISDLAEQNKII-AYNYPQGVLTQTLRAAAAHQPGIISDIGIGTFVDPRQQGGKLNE
2c9oC           TEVLMENFRRAIGLRIKETKKKEIIQDVTLHDLDVAGEINKVVNKYID-QGIAELVPGVLFVDEVHMLDI
2bifA           TYKSFEFFLPDNEEGLKIRKQCALAALND--------------------VRKFLSEEGGHVAVFDATNTT
3ed8A           GPVLLP---DNHYLSYQTVLSK--DPNEKRDHMVLLEFVTAAGIT-------------------------
1e9rA           RDKDIILNPYDQRTKGWSFFNEIRNDY----DWQRYALSVVPRGKTDEA--EEWASYGRLLLRETAKKLA
2awnC           GLGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQL-----AHLLDRKPKALSGGQ
3ec1A           IPLESGATLYDTPGIINHHQMAHFVDARDL---KIITPKREIHPRVYQLNEGQTLFFGGLARLD-YIKGG
2a30D           LQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKPVLFFERSVYSDRYASNLYESECMNETEWTIYQDWH
2akaA           ANPILEAFGNAKTTNNSSRFGKFIEIQFNSAGFISGASIQSYLLEKSRVVFQSETERNYHIFYQLLAGAT
2bofX           IRDR---IASVPQG---TWFAHHNPGQITGQVDALMSAAQAAGKIPILVVS----NAPGRDCGAPSHSAY
1dg3A           LLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSDSAFVSFF
1e1qB           QKRSTVAQLVKRTDADAMKYTIVVSATASDAAPLQYLAPYSGCIYDDLSKQAVAYRQMSLLLRRPPGRE-
3cmxA           YARKLGVDIDNLLSQPDTGEQALEICDALASVAALTPKAEARMMSQAMRLAGNLKQSNTLLIFINQIRNP
3bpbA           RRGETEIIEETVQ----------RFYPGKVERIEAPGTVEAGDIMMVGDHFYIGESARTNAEGARQMIAI
3bb1A           AGFTLNIIDTPGLIEGGYINDMALIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGIWN
1e9sF           RDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYAL-------------------------SVVPRGKTDEA
3b85A           GFLPGDPYLRPLHDALRDVEPEVIPKLEAGIVEVAPLAYRGRTLNDAFVILDEA-QNTTPAQKFLTRLGF
1bmfC           QKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAP----------------------------YS
1cr1A           AEDLIGLHNRVRLRQSDSLKRE---------------IIENGKFDQWFDELFGNDTFHLYDSFAEAETDR
1e2fA           IGKLLSSYLQKKSDV----EDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSL
2a30B           EKPERWSFTFQTYACLSRIRAQLASLNDAEKPVLFFERSVYSDRYIFASNLYESECM-NETEWTIYQDWH
1dhiA           --------------LIAALAVDRVIGMENAMPWNLPAS---------------LAWFKRNTLDKPVIMGR
2bc9A           PHPKKPGHILVLLDTEGLGDVE----------KGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQL-
2cckA           RKIVLEDMDIRTEAMLFAASRR------------------EHLVLKVIPALKEGKVVLCDRYIDSSLAYQ
3cbnA           GHRTTFEVTVDPEI---GETADCIIGVSISTLPDEKRAIARESLVRVILRTENGYDEIRGYGHPELTLDH
2ctsA           SIPECQKMLPKAKGGEEPLPEGLFWLLVTGQIPTEEQVSWLSKEWAKRAALPSHVVTMLDNFPTNLHPMS
2d4hB           SWIFALSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSDSADFVSFFPDFVWTLRDFSLDLEADGQP
2awnB           RGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQV------AEVLQLAHLLDRKPKALSGGQ
3cr7D           KDNIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVAEETGLPFVEVYVDVPKGLYKKAREGVI
3cmvB           ARKL-GVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEI-------GLAARMMSQA
1ckvA           ISELLGRQFNVYDFLVDVSSTIG---RAYTLGNKFTITSELMGLDRKLEDY-------------------
2a2zB           LQMMYEKPERWSFTFQTYACLSRIRAQLASLNGEKPVLFFERSVYSDRYSNLYESECMNETEWTIYQDWH
421pA           ETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLA
2axpA           KLADEDNVIIDRFVYSNLVYAKKFKDYSILTERQLRFIEDKIKAKAKVVYLHADPSVIKKRLRVRIEGKD
2bkhA           PLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAGAS
2aunA           -------SSDQTWQPIDGRVALIAPASAIATEEATLRQLEVH-------GVDYHLGRHVEARYRYLAGTV
3dm9B           QLEEHAKRIGVKVIKHSYGADPAAVAY-DAIQHAKARGIDVVLIDTA------------GRSETNRNLDE
2ck3C           QKRSTVAQLVKRLTDADAMKYTIV----------------------------VSATASDAAPLQYLAPYS
3cddD           IGGERVITGYVDDWVPSYDESTITISYPSGQFNNQTLTQIADIVCKPFGI-KVIVNTDVGEQRIQIEQGE
2bx2L           -----------------------------------------------------------KLYTGEIPLFS
2b8tC           PSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFGPI
2cgtH           SDSKAIAQVGTISASDETVGKLIAEAMDKVGKEGVITVEDGTGLQDEL-----DVVEGMQFDRGYLSPYF
1bg0A           GLDPAGQFIISTRVRCGRSLQGYPFNPCLTAEQYKEMEEKVSSTLSSMEDELKGTYYP----LTGMSKAT
3bjdB           TSRQLAEAGLKGDRQAYAAYQQLLYVSDDVATAQTRRWLARAIYRVEERFPAA--DLSRALSEEDFQKRL
1e0jA           EDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHL---------YDSFAEAETDRLLAKLAY
1e6cA           VVAAEGWPGFRRRESEATPNRVVATGGGMVLLEQNRQFMRAHGTVVYLFAPAEELALRSLQAHQRPTLTG
3da4A           KSGVVGTFPVSTKFTHATGDYNVITGAYGSWTYNGVVRSYDDKYDFNASTHRGIIGESLTRLGAMFSGK-
3adkA           GKMLSEIMEKGQLVPLETVLDMLRDAMVAKVDTSKGFLIDGY---PREVKQGEEFERKIGQPTLLLYVDA
2cckB           VLEGDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAIN
1ai4B           PYPASDLFAFLWGGA--DRVTEIDRLLEQKPRLTADQAWDVIRQTSRQDLNLRLFLPTLQAATSGLTQSD
3bgwA           IKRLIVTAGSINAQKIKAARRD-------------FASEDWGKLSMAIGEISNSNINIFDKAGQSVNYIW
1cr2A           AEDLIGLHNRVRLRQSDSLKREI------IENGKFDQWFDELFGNDTFHLYD----------SFEAETDR
1cjtC           IVAAMSNLVPPVELAN------------------------------------------------------
2axzC           RLTSLQYFSIYLGYISIAHHYNIEVPTF-NKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSI
2ausC           -----------------VIVKDDKAETNPKWGFPPDKRPIELHIQYGVINLDKPPGPTSHEVVAWIKRIL
2awnD           RGVGMVEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVT---HDQVEAMTLADKIVVLDAGR
1e3mA           VLNE-PFIANPLNSPQRRLIITGPNGGKSTYRQTALIALAYIGSYVPA-----QKVEIGPIDRIFTRVGF
3bb1E           AGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDARVDNLDKLVAKAITDSFGKGIWN
2bdtA           WESDELLALTWKNAQNDVVLDYIAFPDEAEALAQTVQAKVDDVEIRFIILWTNREELLRRDAL-------
2bbsB           WIMPGTIKENIIG--------------VSYDEYRYRSVIKACQLEEDISKFAEKDNI--VLGGITLSGGQ
2c4rL           SRPAPFLIHQESNVIVRAFRDYLRQDIGEILIDNPKVLELARQHIAALGRP--DFSSKIKLYTGEIPLFS
1dvrA           GLEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILVGFPRTIPQAELDQMLKEQGTPLEKAIELKV
2d4hA           KPGHILVLLDTEGLGDVENQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSPDES
2b8tB           APEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGF-------VVIISGLDKNFKGEPFGPI
3c8uA           LLEPRGLLPRKGAPETFDFEGFQRLCHALKHQERVIYPL-----------FDRARDIAIAGAAEVGPECR
3cmtD           YARKLGVDIDNLLCSQPTGEQALEICDALAPKAEMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKN
3bb1H           AGFTLNIIDTPGLIEGGYINDMA--LNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKG
3bb1F           AGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDLDKLVAKAITDSFGKGIWN
3bczC           AYKQVDPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGFERSLQTDEDEHSI
1cr0A           AEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHL---------------YDSFAEAETDR
3bb1B           GFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGIWN
1e9sD           RDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSV-------------------------VPRGKTDEA
2d0kA           --------------LIAALAVDRVIGNEN----------------ALPWNLPADLAWFKRNTNKPVIYGR
2bkiA           PLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAGAS
3cmwC           YARKLGVDIDNLLCQPDTGEQALEICDAL-----------------------------------------
3di4A           VTTGERLWSNLPYLRPATIIEDTLGWYGIDQYGGHDVIGTRCDPYTGNLLAGGHYHHCCHSNLTEAELVH
2a5jA           LQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHS-SSNMVIMLIGNKSDLES
3cr7C           KDLG--FSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVTGDPKGLYKKAREGVI
3d3qB           TTEEEGIPHYIDILPPDASFSAYEFKKRAEKYIKITRRGKVPIIAGGTGLYIQSLLYNYAFEDKKQVLKL
2bnlB           ----------------------------------------------------------------------
2aumA           -------SSDQTWQPIDGRVALIAPASAIATEVLEATLRQLEVHG-----VDYHLGRHVEARYRYLAGTV
3bgwD           RLIVTAGSINAQKIKAARRDFA---------SEDWGKLSMAIGEISNSNINIFDKAGQSVNYIWSKTRQT
3a00A           GKDY--NFVSVDEFKSMIKNNEFIE--------------WAQFSGNYYGSTVASVKQVSKSGKTCILDID
1e2gA           LLSS--YLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVD-----RYAFSGVAFTGAKENFSL
2d62A           FVPPKERDVAVFQSYALYPHTVYDNIAFP---LKLRKVPKQEIDKRVREVAELGLTELLNRKPRELSGGQ
2bwjA           ERKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREV--KQGEEFGRRIGDPQLVICMDC
1e9sE           RDKDIILNPYDQRTKGWSFFNEI-----------------------------------------------
2bnlA           ----------------------------------------------------------------------
3cr7A           KDLG--FSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVTGLPKGLYKKAREGVI
1e2hB           QHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAALLCYPAAR
2bjbA           LLDALRELGVAVDGTGVRGNGSLAGGTVAIDASA-----SSQFVSGLLL------------SAASFTDGL
2dpyA           ENILGPDGRARSVVIAAPADVSPL----------------------------------------------
2drcA           --------------LIAALAVDRVIGMENAMPFNLPAD---------------LAWFKRNTLDKPVIMGR
3czpA           QWRFWRRLPPKGRIFFGNWYSQLYARVEGHIKEAKLDQAIDAA---------------------------
2bkeA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
3bo6B           SVQREQVPQAFQALSGLLFSVDSPIDKWKVTDMERVDQQSRVAVGAQFTLYVKP-DQENSQYSASSLHNT
1afrA           RELRERAKEIPDDYFVAWTAEENRHGDLLNKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTENSPYLGFIY
1e9rG           RDKDIILNPYDQRTKGWSFFNEI-----------------------------------------------
3d3qA           TTEEEGIPHYIDILPPKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYNYAFEISED--KKQVKLKLKH
1e3aB           QSGYIANWNNSPQWGGADRVTEIDRLLEQKPRLTADQAWDVIRQTSRQDLNLRLFLPTLQAATSGLTQSD
2eg5G           VFLLPSFYRKLEKENGRKIGSCLIGAYSRLFPEESMHFLHSCYCLQWLSQVPSGLVTEIGTNKGSIYSSK
2b92B           PHPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELKSSFVSFF
2d4uA           NRAGIRYMMDQNIGSGSTVAELMESASISLKQAEKNWADYEALPRDPRQST--AAAAEIKRNYDIYHNAL
1draA           --------------LIAALAVDRVIGMENAMPWNLPAE---------------LAWFKRNTLDKPVIMGR
3cmvE           RKLGVDI-DNLLCSQPDTGEQALEICDALARS----GAVDVIVVDSVAALT--PKAEIEGLAARMMSQAM
3dauA           --------------LIAALAVDRVIGMENAMPWNLPADLAWF---------------KRNTLNKPVIMGR
3bh0A           RLIVTAGSINAQKIKA---------ARRDFASEDWGKLSMAIGEISNSNINIFDKAGQSVNYIWSKTRQT
1dhjA           --------------------ISLIAALAVDRVIGMENAMPWN-------LPASLAWFKRNTLDKPVIMGR
1d6jB           LGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVA--TPGEETGLPFVEVYVDV
3crmA           KPSRELLARYPHRLIDRDPAESYSAAEFRADALAAMAKATARGRIPLLVGGTMLYYKALLEGLPYTVA--
3dlbB           GAFLLEVDPAYRILCEMSLEAWLAQGHPLPKRVRNAYDRRTWELLRLGEEDPKELPLPGGLSLLDKGRLQ
1e59A           AIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGD-EQVKQWRRGFAVTPPELTKDDE
2cvfA           MAETRGLNPEEALSRFILFTPSDFKEVIGSLKKTVDSNFALVVVDSITAHYLIAELSRQLQVLLWIARKH
2a1fF           ----------------------------------------------------------------------
2c7cH           SDSKAIAQVGTISASDETVGKLIAEAMDKVGKEGVITVEDGTGLQDEL-----DVVEGMQFDRGYLSPYF
3dfnC           --------------------------------------------------------------PALTPEQK
1cjuC           IETIVAAMSNLVPP--------------------------------------------------------
1ek0A           EHTVKFEIWDTAGQERFASRNAQAALVVYDVTKPQSFIKARHWVKELHEQASKDIIIALVGNKIDLQEGG
3bm2B           ---------LELLINRRSASRLA---EPAPTGEQLQNILRAGRAPDWHFFVIEGEGRERFSAVLEAAGSD
2dpyB           ENILGPDGRARSVVIAAPADVSPL----------------------------------------------
1e9sB           RDKDIILNPYDQRTKGWSF---------------------------------------------------
3clvA           IKFDIWDTAGQERYASIVPLYYRGATCAIVVFDI---SNSNTLDRAKTWVNQLKISSNYIIILVANKIDK
3e8aC           IETIVAAMSN------------------------------------------------------------
1eilA           -----------------------------------------------------AWDHFLTKSVGLMAAGS
2bnlC           ----------------------------------------------------------------------
1e9sJ           FGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYAL-----------------------SVVPRGKTDEA
3bb1C           AGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDARVDNLDKLVAKAITDSFGKGIWN
1e9sL           RDKDIILNPYDQRTKGWSFFNEI-----------------------------------------------
1e9rF           RDKDIILNPYDQRTKGWSFFNE------------------------------------------------
3dffA           ---NVLVYTVFAGAYSPAAQRHTIWGLAPDDDAVLYRRKEDIAALDHLRV----AHRHGRFLDSIYRKLP
1bglA           ----------------------------------------------------------------------
1e2kA           NIYTTQHRLDQGEISAGDAAVVMT-------SAQITMGMPYAVTDAVLA--------------PHIGGEA
2b8wB           PHPKKPGHILVLLDTEGLGD------VEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTE
1e0jB           AEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHL--------YDSFAEAETDRLLAKLAY
2dr3C           NMAQFGWDVKPYE--------------------------EKGMFAMVDAFTAGIGEYEKYIVHDLTDIRE
2b8tD           GTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFFGPI
3c15C           TIVAAMSNLVPPVE--------------------------------------------------------
3dhwC           LTKARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELL-SLVGLGDKHDSYPSNLSGGQ
3cueF           KLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKD
1cfrA           IRLGGKISDGSFNKCNGDWYEWLIGIRAIEFESETFIVVKMPNATEFIYDLRSKLSL---NNVNLITSNP
3cm0A           LGERVRPIMERGDLILELIREELVIFDGFPRTLAQAEALDRLL--SETGTRLLGVEVPEEELVRRI----
2d3wD           PEDRAGEGIFMAFQYPVELQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGE
3dfpC           --------------------------------------------------------------PALTPEQK
1e9sH           RDKDIILNPYDQRTKGWSFFNEI-----------------------------------------------
2dr3F           NMAQFGWDVKPYEEKG-----------------------MFAMVDAFTAGIGKSKEYEKYIVHDLTDIRE
1e9sM           RDKDIILN-PYDQRTKGWSFFNEI----------------------------------------------
2dr3D           NMAQFGWDVKPYEEKG-----------------------MFAMVDAFTAGIGKSKEYEKYIVHDLTDIRE
2c0bL           KAAESRPAPFLIHVIVRAFRDYLRQDIGEILIDNPKVLELARQHIAALG--RPDFSSKIKLYTGEIPLFS
2a1fD           ----------------------------------------------------------------------
3ch4B           HGLNFQYKEAFRKD--------------------------------------------------------
1d2zD           VDGPGALISLELL---------------------------------------------------------
1dekA           FAANTDYPLTRKEFEGIDYDRETNLNLTKLEVITIMEQAFCYLNGKSP----------------------
3be4A           EAKSIIESGNFVGIVLGLVKEKFDLGVCVNGFVLDGFPRTIPQAEGLAKILSEIGDSLTSVIIERIS-GR
1av6A           LNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLS----NYALQNVMISILNPVASSL
2bhjA           SIKSLTRGPRDPTPLEELLPHAIEFINQYYGSKEAKIEEHLARLEAVTKEI--ETTGTYQLTLDELIFAT
2d3wC           EDRAGEGIFMAFQYPVEIPGVSNQFFLSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGE
3ecpA           AADWAKSVFSSAALPRRTARLVNVAAQL-AKYSGKSITISSEGSKAAQEGAYRFIRNPNVSAEAIRKAGA
2awoC           PAERGVGMVALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVA-------EVLQLAHLLDRKPKALSGGQ
3czjA           ----------------------------------------------------------------------
2d2eA           PDERARKGLFLAFQYPVVPGVTIANFLRLALQAKLGREVGVAEFWTKVKKALELLDWDESYLSRYLNEGE
3c14C           TIVAAMS---------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
1d6aA           TWGKISTAIHDAK---NGVLPKPLELVDASGAKWIVLRVDEIKPDVALLNYVGG----------------
3c7kA           AIVRAMDTLG------------------------------------------------------------
5dfrA           ------------------------------------LAVDRVIGPWNLPAD--LAWFKRNTLDKPVIMGR
2awnA           RGVGMVF---------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
3cr7B           LGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVETGLVDVPVEVAEQR---DP
1drbA           --------------LIAALAVDRVIGMENA-------------MPWNLPAC--LAWFKRNTLDKPVIMGR
3bb1G           AGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRDNLDKLVAKAITDSFGKGIWN
3dfdA           LREAYKTEDPVEVARVLSVGGEY-----------------------------------------------
3dftC           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
2aumB           -------------QPIDGRVALIAPASAIATEVLEATLRQLEVHG-----VDYHLGRHVEARYRYLAGTV
3d31A           EKHDIAFVYQNYSLFPHMNVKKNLEFGMRMKKIKDPKRVLDTA-------RDLKIEHLLDRNPLTLSGGE
2ancF           AQQIRQKMPHARSIFILPPSKIELDRRLRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDL
1aldA           ----------------------------------------------------------------------
3dfqA           --------------------------------------------------------------PALTPEQK
1eamA           NGLRDVTLVEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRC-------
6aldA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
1adoA           --------------------------------------------------------------PALTPEQK
3dfnD           --------------------------------------------------------------PALTPEQK
3b9qA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
4atjA           CDASILLDNTTSFRTEKDAFGNANSARG-FPVIDRMKAAVESACPRTVSCA--DLLTIAAQQSVTLAGGP
3b55A           -------------------------------------------------IAKWLEAHAKPLKTTNPTASL
2bhvD           AFLITPISSQIAGKVIAQVESDIFAHMGKA-------------------VLIPKGSKVIGYYSNNNKMGE
1dyhA           --------------LIAALAVDRVIGMENAMPWNLPADLAWFKRNTL---------------DKPVIMGR
3dymA           ----------------------------------------------------------------------
1e9sI           RDKDIILNPYDQRTKGWSFFNEI-----------------------------------------------
3bjqB           ----------------------------------------------------------------------
1azsC           TIVA--AMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSN-----
3bk7A           KAEYEGTVYELLSKIDSSKLNS--------------------NFYKTELLKPLGIIDLYDRNVEDLSGGE
4dfrA           --------------LIAALAVDRVIGMENAMPWNLPADLAWF-----------KRNTLDKP----VIMGR
3cioD           LFTVSNEHGLSEYLAGKDENKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDHLVIVDTPP
3c85A           LRARYGKISLREEAAQQHRSEGRNVISGDATDPDFWERILDTGHVKLVLLAPHHQGNQTALEQLQRRNYK
1chdA           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
2bbtB           EGKIKHSGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGITLSGGQ
2bwjB           ER--------------------------------------------------------------------
3cmuA           ARKLGVDIDNLLCSQPDTGEQALEIC--------------------------------------------
1e2kB           QHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAHAPPPALTLIFDRHP-----------
2bhvA           AFLITPISSQIAGKVIAQVESDIFAHMGKA-------------------VLIPKGSKVIGYYSNNNKMGE
2a1fC           ----------------------------------------------------------------------
2aunB           --------------TWQPIDGRVLIAPASAIATEVLEATLRQL--EVHGVDYH-LGRHVEARYRYLAGTV
2b0lB           ----------------------------------------------------------------------
1e2mA           QHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGE---------------------------
2bhvC           AFLITPISSQIAGKVIAQVESDIFAHMGKA-------------------VLIPKGSKVIGYYSNNNKGEY
2bwjD           ER--------------------------------------------------------------------
2e85A           ----------------ASAVTDVLLCV------GNSMMGDDGAGPLLAEKCAAAPKGNWVV----IDGGS
1e2mB           QHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGE-AGSPPALTLIFDRHPIAALLCYPAAR
3dfqC           --------------------------------------------------------------PALTPEQK
1ckeA           LASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLIAD---
1cjvC           IVAAMSNLVPPVELANPENQFRVD----------------------------------------------
3dvlD           IIKNARSFGWDLAKLVDEGKLFILDASPDPEGQEVVGGFDLSALIERINYAIQKYRARR-----------
3bv4A           -------------------------------------------------------------HPALTPEQK
2bv7A           ----------------------------------------------------------------------
3dfoC           --------------------------------------------------------------PALTPEQK
2d2fA           ----------------------------------------------------------------------
3dkvA           GLEAKSYIDKGELVPDEVTIGIVRER--------------------------------------------
1e2lA           HRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAPPALTLIFDRHPIAALLCYPAARYLMG
2d7vA           LAHENCFIANSVE---------------------------------------------------------
2d7vB           LAHENCFIAN-------SVETEVVT---------------------------------------------
1e9rB           RDKDIILNPYDQRTKGWSFFNE------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2boeX           --------------PNMSSAEWVRNNPNDPRTPVIRDRPQGTWFAHHNP--------------GQITGQV
2cbzA           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
3d1mB           --------------------------------------LTPLAYKQFIPNVAEKTLGA----SGRYEGKI
1e2iA           AGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGPPPALTLIFDRHPIAALLC----------------
3cqcA           ----------------------------------------------------------------------
1akeA           GKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQ----ADAMKEAGINVDYVLEFDV
1e2jB           TIANIYTTQHRLDQGEISAGDAAVVMTSA-----------------------------------------
3d1mA           ----------------------------------------------------------------------
3dyoA           -----------------------------------------GDKKQLLTPLRDQFTRAPLDNDIGVSEAT
1dw9A           LLLQIPLRGCIDD---------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1dekB           -------LAYAWGVFA--ANTDYPLTRKEFEGIDYDRETNLN-------LTKLEVITIMEQAFCYLNGKS
1d8jA           ----------------GSSGYKF------GVLAKIVNYMKT--RHQRGDTHPLTLDE-ILDETQHLDIGL
2a78A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
1e9sA           RDKD------------------------------------------------------------------
2bwjF           ER--------------------------------------------------------------------
3brwA           QMAKLVCEDVNVDRFYPV--------LYPKASRLIVTFDEHVISNNFKFGVIYQKLGATSEEELFS----
3cwzA           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
2e9sA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           XXXXXXXXXXXNPCQLLLLDEPAASLDAHSEQRVMQALKAASKRQTTLMVTHQLEDLADWDAIWVMQDGA
3b60A           RQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLSTIEQADEIVVVEDGI
3b5jA           RQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGK
2c61B           GSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELH---RKGIYPPINVLPSLSRLMNSGIGAGKTR
3dt2A           WRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGRPAGVPLVYEALSWQHGVFVGAAMAEHKGK
3cmvH           AMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEENVVGSETRVKVVKNKAEFQILYGEG
3cmvG           AMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVGSETRVKVVKNKIAAPFKQAEF
2d3wB           KKRNDILQMAVLEPELCILDESDSLDIDALKVVADGVNSLRDGKRSFIVTHYRILDYIKPDYVHVLYQGR
1accA           SVV--------KEAHREVINSSTEGLLLNIDKDIRKILS----GYIVEIEDTEGLKEVINDRYDMLNISS
2dwoA           RERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQP
2akaB           FQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGDARDVLENKL
3dmdC           ETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVDGIILTKLDADARGGALSISYVIDA
2c9yA           PDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEY
3eiuB           GSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVA---RELHRKGIYPPINVLPSLSRLMNSGIGAGKTR
2c03B           QIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVTGLVLTKLDGDARGGAASARHVTGK
3dtbB           WRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIIFGVPLVYEALSWQHGVFVGAAMRSEAKV
2ccjB           RALNEFA-------INGLYPDLTIYLNVSAEVGRERIIKNRLDQEDLKFHEKVIEGYQEIQRFKSVNADQ
3c95A           QQRWLEHRRQV--FTPEFLQGYADELQMLVQQYADDKLKALWQYADEI----------------------
2dwpA           RERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQP
2c04A           QIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVTGLVLTKLDGDARGGLSARHVTGKP
4dcgA           KMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDPNQEYDYFHMYF
1e69A           GLALLFALMEIKPSPFYVLDEVDSPLDDYNAERFKRLLKENSKHTQFIVITHNKIEAADLLHGVTMVNG-
3cmvC           RKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVVKVVKNKIAAPFKAEFQILYGEG
3cmvA           -----------AE-IEGEIGDSHMGLAARMMSQAMRKLAGNLKQSLLIFINQGGNALKFYSVRLDIRRIG
1e9fA           DWCKQPDVGLPKPDLVLFLQLQLADAAKRYENGAFQERKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIA
2b8tA           AKLFTYADKITKLTAICNECGAEATHSLRKIDGKHADYN------DDIVKIGCQEFYSAVCRHHHKVPNR
1e9cA           DWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHE---RYENGAFQERALRCFHQLMKDTLNWKMVDASK
2ccgA           GIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQRLDQEDLKFHEKVIEGQEIIHNESQR
1d1cA           TAEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFKITRQAMDIVGFSQEEQMSIFKIIAGILHLGNIK
1bifA           RERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDVNRDSDEATEDFMRRECYENSYESLD
2ccgB           GIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSLDQEKFHEKVIEEIIHNESQRFKSVNADQ
1dkiA           VQRALKENFGYNQSVHQINRGDFSKQDWEAQIDKEL-----SQNQPVYYQGVGKVG----GHAFVI-DGA
2cjwB           A-------------AVVFD-----CKFIETSAAVQHNVKELFEGIVRQVRLRRDSKEKNERRLAYQKRK-
3dt7A           WRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGRPAGVPLVYEALSWQHGVFVGAAMAEHKGK
2czvA           FMMKAWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISLGVVIGM--EIPQAKASISMYPE-----------
1e2dA           DWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENG--AFQERALRCFHQLMKDTTLNWKMVDASK
3b2qA           LRQMGAARN--EV-PGRRGYPGYMYTDLATLYERAGIVKGAKGSVTQIPLSMPGDDITHPIPDLSGYITE
2c03A           QIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVTGLVLTKLDGDARGGLSARHVTGKP
3dm5A           EEMKQIS-------NVIHPHEVILVIDGTIGQQAYNQALAFKEATGSIIVTKLDGSAKGGALSAVAATGA
2c61A           ALRQMGAARNEVPGRRGYPGYMYTDLATLYERAGIVKGAKGSVTQILSMPGDDITHPIPDLSGYITEGQI
1e98A           DWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYEN---GAFQERALRCFHQLMKDTLNWKMVDASK
2ahvA           VTKEDLIKLVEFDNKEYLYYKAIAPDIAF-----IRATTCDSEGYATFEDEVMYLDALVIAQAVHNNGGI
2a5gA           PHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLT-------------------------------
1e3mB           VETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWACAENLANKLTLFATHYFELTQLPKEGVANVHLD
2b8wA           WTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLRKFFPKKKCFVFDRVHRRKLAQLEK
3dt4C           WRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIERRPAGVPLVYEALSWQHGVFVGAAMAEHKGK
2bbsA           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHKKADKILILHEGS
3dmdB           ETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVDGIILTKLDADARGGALSISYVIDA
3dt4A           WRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIIFGVPLVYEALSWQHGVFVGAAMAEHKGK
1aroP           ERQLLITTLLPKMIARINDWFEEVKAKRGKRPTAFQFLQEKPEAVAYITIKTTLACLTSANTTVQAVASA
3eiuA           GSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELH----RKGIYPPINVLPSLSRLNSGIGAGKTR
2dr3A           FIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQLAGTGCTSIFVSQVSGFGPGVDGIIRLDLDE
2a2zA           ETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRNEEQGIPLYLEKLHYKHESWLLHRTL
1cr4A           -----------LGCDVIILDHISIRKMIDNLMTKLKGFAKSTGV-VLVVICHLKALRQLSDTIIALERNQ
1e9dA           DWCKQPDVGLPKPDLVLFLQLQLADAAKRG---AFGHERYENGAFQERALRCFHQLMKDTLNWKMVDASK
2dr3E           FIEVLRQAIRDINAKRVVVDSVTTLYINKPAMALKRVLAGTGCTSIFVSQVSVGPGVEHGDGIIRLDLDE
1cs4C           ----------------------------------------------------------------------
2dr3B           FIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQLAGTGCTSIFVSQVSVGERGFPGVEHGVDGI
3cddF           KADVTDSEIGRYRPLIIVNEEVTTAEGAAKRGQWERQRSIGKSNAEYTVTGWRIPQTGKLWNINVIDEIG
3cddC           ETPHELLARLAKQRGVLLTSDTFGNLVITRASKTKAGVSLI-LGDNVKAARGRFSWRQRFSKFTIKADSA
2a2zD           DWMNNQFGQSLELDGIIYLQATPETCLHRIYLRPLEYLEKLHYKSWLLHRTLKTNFYLQEVPILTLDVNE
3a1wA           IDEAKKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEYAQ---------------------------
3d7wA           ---------RSILILIQMISEAARFNPILWRA-----RQYINSGASFLPDVYMLELETSWGQVQHSTDGV
3b2qB           GSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVAR----ELHRKGIYPPINVLPSLSRLNSGIGAGKTR
3czpB           QERFKEREKTPYK-RYKITEEDWRNRDKWDQ---YVDAVGDVDRTSTEIAPWTLVEANDKARVKVLRT--
1culC           ----------------------------------------------------------------------
2a30A           DWMNNQFGQSLELDGIIYLQATPETCLHRIYLRPLEYLEKLHYKSWLLHRTLKTNFDYLQVPILTLDVNE
1e4yA           PQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQ
3d3kA           WYKAAVAWANQNRAPVLSIDPP-VHIDAKWSLALGLPLPLEHAGRIYLCDIGIPQQVFQVGINYHSPFG-
1e9sG           ELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFSIRSWLE----
2ahwD           VTKEDLIKLVEFDNKEYLYYKA-IAPDIAFIRATTCDS----EGYATFEDEVMYLDALVIAQAVHNNGGI
2c9oC           ECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRA
2bifA           RERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDVNRDSDEATEDFMRRECYENSYESL-
3ed8A           ----------------------------------------------------------------------
1e9rA           LIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNSKALTSARFVLSDKLPEHVTMPDGDFSIRS-
2awnC           RQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLTMIYVTHDQVEAMTLDKIVVLDAGR
3ec1A           RRSFVCYMANELTVHRTKLEKADSLYANQLGELLSPPSKRY-AAEFPPLVPRSLSVKERKTDIVFSGLGW
2a30D           DWMNNQFGQSLELDGIIYLQATPETCLHREQGIPLEYLEKLHYKSWLLHRTLKTNFDYLQVPILTLDVNE
2akaA           AEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFKI--TRQAMDIVGFSQEEQSIFKIIAGILHLGNIK
2bofX           RSWIDEFAAGLKNRPAYIIVEPDLISLMSSCMQHVQQEVLETMAYAGKALKAGS------SQARIYFDAG
1dg3A           PDFVWTLRDFSLDLQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHELDPEF
1e1qB           -----AYPGDVFYLHSRLLERAAKMNDAFGGGSLTLPVIETQAGDVSAYIPTNVISIT--DGQIFL-ETE
3cmxA           ETTTGGNALKFYASVRLDIRRIGAVKEGENVVGSETRV----KVVKNKIAAPFKQAEFQIYGEGINFYGE
3bpbA           LEKHGLSGSVVRLEKVLGLKTGLAYLEHNNLLAAGEFVSKPEFQDFNIEIPE---EESYAANCIWVNERV
3bb1A           KAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKSDIPVVLIENSGRCNKNDSDEK-VLPNGI
1e9sF           EEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATRGFLEGTLAESLFAGSNEASKALTSARFVLSDK
3b85A           GSKVVTGDGLRL-VRHILRGVDDVHFSELTSSDVVR----------------------------------
1bmfC           GCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAKMNDAFGGGS
1cr1A           LLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGFAKSTGV-VLVVICHLKTDLRGSDTIIALERNQ
1e2fA           DWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQE-RALRCFHQLMKDTTLNWKMVDASKS
2a30B           DWMNNQFGQSLELDGIIYLQATPETCLHEEQGIPLEYLEKLHYKSWLLHRTLKTFDYLQEVPILTLDVNE
1dhiA           HTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPMVIGGGRVYEQFLPKQKLYLTHIDA
2bc9A           ------YYVTELT-HRIRSKSDFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQ----
2cckA           GYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNEDLKFHEKVIEGYQEIRFKSVNADQP
3cbnA           PTDIVCRKSDYICSRTLIRADKAAFDLDENLVRDL-------RKGRELKVEIIVEYEG------------
2ctsA           QLSAAITALNSESNFARAYA-EGIHRTKYWELIYEDCMDLIAKLPCVAAKIYRNLYREGSSIGAIDSKLD
2d4hB           LTPDEYLTYSLKLKKCFVFDRPVHRRKLAQLEKLQDEELDEFVQQVADFCSYIFKTKTLSGGIQVNGPRL
2awnB           RQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLTMIYVTHDQVEAMTLDKIVVLDAGR
3cr7D           KEFTGISAPYEAP-ANPEVHVKNYELPV--QDAVKQIIDYLDTKGYL-----------------------
3cmvB           MRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEF
1ckvA           ----------------------------------------------------------------------
2a2zB           DWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYWLLHRTLKTFDYLQEVPILTLDVNE
421pA           ARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH-------------------------
2axpA           IDSILELYREVSNAGLHTYSWDTGQWSDEIAKDIIFLVEL------------------------------
2bkhA           EDIRERLHLSSDNFRYLNRGCTRYFANKETDKQILQNPEYLKAGSLKDPLLDDHGDFIRMTAMKKIGLDD
2aunA           EQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPGFSDISVLLSAFHRHGLPAIHGP
3dm9B           KK----------IARVTKPNLVIFVGDALAGNAIVEQARQFNEAVDGIILTKLDADARGGAALSSYVIDA
2ck3C           GCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAKMNDAFGGGS
3cddD           TPHELLARLAKQR-GVLLTSDTFGNLVITRASKTKAGVSLI-LGDNVKAARGRFSWRQRFSKFTIKDSAG
2bx2L           HYQIESQIESAFQREVRLPSGGSIVIDSTEALTAIDINSAR-GDIEETAFNTNLEAADEARQLRLRDLGG
2b8tC           AKLFTYADKITKLTAICNECGAEATHSLRKIDGKHADYN------DDIVKIGCQEFYSAVRHHHKVPNRP
2cgtH           INKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLLIEDVEGEALATLVVNTRGIVKVAAVK
1bg0A           QQQLIDDHFLFKEGDRFLQTANACRYWPTGRGIFHNDAKTDHLRIISMQKGGDLKTVYKRVTAVDNIESK
3bjdB           EQEIAAQSRERPSQYVFSGSASRAQLQVFLRHQWFRTFRLYRDAADLLVNLTDVDEAAALARYLYGELGE
1e0jA           MRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVCHLKNPDKLSDTIIALERNQ
1e6cA           RPIAEEMEAVLREREALYQDVAHYVVDATQPCELMQTMR-------------------------------
3da4A           ----------------------------------------------------------------------
3adkA           GPETMTKRLLKRGETSGRVDDNEETIKKRLEYKATEPVIAFYEKRRKVNAEGSVDDVFS-----------
2cckB           GLYPDLTIYLNVSAEVGRERIIKNRLDQEDLKFHEKVIEGYQEIIKSVNADQPLENVVEDYQTIIKY---
1ai4B           PRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSMKRTVVAAVPMPFDKWYSASGETTQDGPTGS
3bgwA           SKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISARELDVVVIALSQLSRQVEQRDKRPMLSDLR
1cr2A           LLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGFAKSTGV-VLVVICHLKSGALRQLSIIALERNN
1cjtC           ----------------------------------------------------------------------
2axzC           IKPYPIVDSFGKDYDLTIQTVLKNALTISINRNLKEAQYLKTIKNISINGYYDLEINYLKQIYIDSYLNA
2ausC           NLE--------KAGHGGTLDPKVSGVLPVALERATRVVQALPAGKEYVALMHLHGDVPEDKIRAVMKEFE
2awnD           VAQVGKPLELYHYPADRFVAPKMNFLPVKVTATAIDQVQVELPMPQQVWLPVESRDVQVGNMSLGIRPEH
1e3mA           VETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWACAENLANKLTLFATHYFELTQLPKEGVANVHLD
3bb1E           KAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKKASDPVVLIENSGRCNKNDSDEKVLPNGI
2bdtA           RKKGERCLELVEEFESKGIDERYFYNTSHLQPTNLNDIVKNLKTNPR-----------------------
2bbsB           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGS
2c4rL           HYQIESQIESAFPSGGSIVIDSTEALTAIDINSARGDIEAFNTNLEAADEIARQLRLRDLGGLIVIDFID
1dvrA           DDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQISDDNADALKKRLAAYHAQTEPIVDF
2d4hA           ADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTIRKFFPKKKCFVFDRPVHRRKLAQLE
2b8tB           AKLFTYADKITKLTAICNECGAEATHSL---RKIDGKHADY---NDDIVKIGCQEFYSAVCRHHHKVPNR
3c8uA           VAI--------IEGNYLLFDAPGWRDLTAIWDVSVPADLEARLVQRWLDHGLNHDAAVARQGNDLANARA
3cmtD           PETTTGGNALKFYASVRLDIRRIGAVKEGENVVGSETRV---KVVKNKIAAPKQAEFQILYGEGINFYGE
3bb1H           I----------WNKAIVALTH-AQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKKDSDIPVVLIENSGR
3bb1F           KAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKKDIPVVLIENSGRCNKNDSDEKVLPNGIA
3bczC           EHLPYTAKAESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCHWGQRFRYSYYDES
1cr0A           LLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGF--AKSTGVVLVVICHLKDLRLSDTIIALERNQ
3bb1B           KAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLASDIPVVLIENSGRCNSDELPNGIAWIPHL
1e9sD           EEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLAESLFAGSNASKALTSARFVLSDKL
2d0kA           HTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAAAGDVPFVIGGGRVYEQFLPAQKLYLTHIDA
2bkiA           EDIRERLHLSSPDNFRYLNRGCTRYFANKETDKQILQNRKSPEYLKAGSLKDLLDDHGDFIRMCTAMKKI
3cmwC           ----------------------------------------------------------------------
3di4A           DVLNVFCTGFTRDTGQYFKASPVRPGDYLEFFAEIDLLGNLSACPGGDCSSEASCHP---LLVEIFAPAE
2a5jA           RRDVKREEGEAFAREHGLIFMETSAKTACNVEEAFINTKEIYRKIQQGL---------------------
3cr7C           KEFTGISAPYEAPA-NPEVHVKNYELPVQDAKQIIDYLD-------------------------------
3d3qB           KELEHLNNNKLHEYLASFDKESAKDIHPNNRKRVLRAIEYYLKTKTLLIGIESRETLYLRKRVDILGHGL
2bnlB           ----------------------------------------------------------------------
2aumA           EQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFADI----SVLLSAFHRHGL
3bgwD           KRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISRDMARELDVVVIALSQLSQVEQRQDKRPMLSDLG
3a00A           MQGVKSVKAIPELNARFLFIAPPSVTGAHDKVIVNDDLDKAYKELKDFIFAEK-----------------
1e2gA           DWCKQPDVGLPKPDLVLFLQLQLADAAKRGERYENGAF-------QERALRCFHQLMKDTLNWKMVDASK
2d62A           RQRVALGRAIIRRPKVFLDEPLSNLDAKLRVKRAELKKLQRQLGVTTIYVTHDQVEATGD--RIAVNKGE
2bwjA           SADTMTNRLLQMSRSSLPVDDTTKTIAKRLEAYYRASIPVIAYYEKTQLHKIGTPEDVFLQLCTAIDSIF
1e9sE           ----------------------------------------------------------------------
2bnlA           ----------------------------------------------------------------------
3cr7A           KEFTGISAPYEPANPEVHVKNYELPVQDAVKQIIDYLDT-------------------------------
1e2hB           YLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRLAMLAAIRRVY-GLLANTVRYLQCGG
2bjbA           TVQHTGSSLPSAPH-IAMTAAMLRQAGVDIDDSTPNRWQPGPVAARRWDIEPDLTNAVAFLSAAVVSGGT
2dpyA           ----------------------------------------------------------------------
2drcA           HTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIIGGGRVYEQFLPKQKLYLTHIDA
3czpA           ----------------------------------------------------------------------
2bkeA           --------------------RENLAVRQQKLNKHLHQLTRLAEVYAVIITNQVVPGIRIQ--LKKSRGNR
2b0lC           --------------VVQMAISSLSYSELEAIEHIFEELDGNEGLLVASKIAVIVNALRKLESAGVIESRS
3bo6B           RQFIECLESRLSESGLMPGQYPESDVHPENWKYVSYRNELRSGRDGGEMQSQALRE--------------
1afrA           TSFQERATFISHGNTARQAKEHGDIKLAQICGTIAAD-----EKRHETAYTKIVEKLFEIPDGTVLAFAD
1e9rG           ----------------------------------------------------------------------
3d3qA           EYLASFDKESAKDIHPNNRKRVLRAIEYYLKSRKKVQQFTENYDTLLIGIESRETLYLRIKRVDILGHGL
1e3aB           PRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSMLKRTVVAVPMPFDKWYSASGETTQDGPTGS
2eg5G           ASRLPVQKAYLDQFTKDFTTFLRIHSEELFSHGRMLLTCICKGVELDARNAIDLLEMAINDLVV------
2b92B           PDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQ--KDETFNLPRLCIRKFFPKKKCFVFDRPVH
2d4uA           AELIQLLGAG---KINEFFDQPTQGYQDGFEKQYVAYMEQNDRLHDIAV---------------------
1draA           HTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPMVIGGGRVYEQFLPKQKLYLTHIDA
3cmvE           RKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENGSETRVKVVKNKIAAFKQAEFQILY
3dauA           HTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPMVIGGGRVYEQFLPKQKLYLTHIDA
3bh0A           KRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISRDLKKMAREVVIALSQLSQVEQRQDKRPMLSDLR
1dhjA           HTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPMVIGGGRVYEQFLPKQKLYLTHIDA
1d6jB           PVEVAEQRAPYEAPANPEVHVKNYELPVDAVKQIIDYLDT------------------------------
3crmA           ------QLAIAPEQRQVLHARIAQRFRQMLEQGFIAEVEALHARSDLHAG-LPSIRAVGYRQVWDYLDGK
3dlbB           GREGGRVAWV---ADPKDPRKPIPHLTGLLVPVGSLALSLPWEERRTREIASWIGRRLGLTPEAVRAQAY
1e59A           RYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGEVIIAAHGNSLRALVKYLDNMSEEE
2cvfA           NIPVIVINQVHFD-SRTEMTKPVAEQTLGYRCKDILRLDLPKPGLRVAVLERHFRPEGLMAYFRITERG-
2a1fF           ---------------EALQGEDGLGIDPAILDRMAVEIELVEMGVEVSVVLGGGNLFRGALAKAGMNRVV
2c7cH           INKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLLIEDVEGEALATLVVNTRGIVKVAAVK
3dfnC           KELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFRQLLLTADDRVNPCIGVILFHETLY
1cjuC           ----------------------------------------------------------------------
1ek0A           ERKVAREEGEKLAEEKGLLFFETSAKTGENVNDVFLGIGEKIPLK-------------------------
3bm2B           DKAIDKARNAPFRAPLIITVVAKVPRWEQESAGCAVAQAAVAQGFGGIWRSGALTESPVVREAFGCREQD
2dpyB           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
3clvA           NFQVDILEVQKYAQDNNLLFIQTSAKTGTNIKNIFYMLAEEIYKNI------------------------
3e8aC           ----------------------------------------------------------------------
1eilA           AGDAALYRADQRAWRIAVQPGELDDLAYAGLEVDDAAALERMADKQAGVAFTRGDEALMQQRKVMGLLCL
2bnlC           ----------------------------------------------------------------------
1e9sJ           EEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASARFVLSDKL
3bb1C           KAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKSDIPVVLIENSGRCNKNDSDEKVLPNGI-
1e9sL           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
3dffA           DGRWLTAHVEGRQKLAVNDHSPDSDHDLVGE--VADDIRSIIDEFDPTLVVTCAAIGEHPDHEATRDAAL
1bglA           --------------GHYQAEAALLQCTADTLADAVLITTAHAWQHKTLFISRKTYRIDGSGQMAITVDVE
1e2kA           GPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKQR
2b8wB           LTHRIRSKSSVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKKGTSQKDETFNLPRLCIRKFPKKK
1e0jB           MRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTVLVVICHLKNPDKGKDTIIALERNQ
2dr3C           FIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQLAGTGCTSIFVSQVSGVEHGVDGIIRLDLDE
2b8tD           AKLFTYADKITKLTAICNECGAEATHSLRKIDGKHADYND-----DIVKIGCQEFYSAVCRHHHKVPNRP
3c15C           ----------------------------------------------------------------------
3dhwC           KQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDINRRLTILLITHEMDVVKRCDCVAVISNGE
3cueF           KRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMS-----------------------
1cfrA           DFSIIDIRGRREELKSMLKDISFSNISLSTISEIDNLYKNFIDYLEHIKSFLSVK-----TTFRPDRRLQ
3cm0A           ---LRRAELEGRSD---DNEETVRRRLEVYREKTEPLVGYYEARGKRVDGLGTPDE--------------
2d3wD           KKRNDILQMAVLEPELCILDESDGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIDYVHVLYQGR
3dfpC           KELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFRQLLLTADDRVNPCIGVILFHETLY
1e9sH           ----------------------------------------------------------------------
2dr3F           FIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQLAGTGCTSIFVSQVSGFGPGVDGIIRLDLDE
1e9sM           ----------------------------------------------------------------------
2dr3D           FIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQLAGTGCTSIFVSQVSVGERGFPGVEHGVDGI
2c0bL           HYQIESQIESAFQREVRLPSGGSIVIDSTEEETAFNTNLEAADEIARQLRLRDLGDFIDM--TPVRHQRA
2a1fD           ---------------EALQGEDGLGIDPAILDRMAVEIKELVEMVEVSVVLGGGNLFRGALAKAGMNRVV
3ch4B           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
3be4A           CTHPASGRIYHVKYNPPKQPGIDDVTGEPLVWRDDDNAEAVKVRVFHKQTAPLVKDLGILKR--VNAKLP
1av6A           KWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYGENMRLTRVTKSDAV---NYEKKMYYLNKI
2bhjA           KMAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHYATNNGNIRSAITVFPRSDGKHDFRLWNSQ
2d3wC           KKRNDILQMAVLEPELCILDESDDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGR
3ecpA           MQTVKLAQE----FPELLAIEDTTSLSYRHQVAEELGKLGSIQDKSRGWWVHSVLLLEATFRTVGLLHQE
2awoC           RQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRRTMIYVTHDQVEATLADKIVVLDAGR
3czjA           ------------AAGHYQAEAALLQCTADTLADAVLITTAHAWQHKTLFISRKTYRIDGSGMAITVDVEV
2d2eA           KKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGNAMRGPNFGALVITHYQRILNYIQPVHVMMDGR
3c14C           ----------------------------------------------------------------------
1e9rE           ---------------KKLALIGTPSMRELFHWTTIATFDDLRGFLEGSLFAGSNEASKATSARFVLSDKL
1d6aA           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
5dfrA           HTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPMVIGGGRVYEQFLPKQKLYLTHIDA
2awnA           --------------------EPLSNLDAALRVQMRIEISRLHKRLTMIYVTHDQVEAMTLDKIVVLDAGR
2a1fE           ---------------EALQGEDGLGIDPAILDRMAVEIKELVEMGVESVVLGGGNLFRGALAKAGMNRVV
3dfpD           -----------PGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILHETLY
3cr7B           KGLYKKAREGVIKEFTGISAPYEAPANPEVHVKNYELPVQDAVKQIIDY---------------------
1drbA           HTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAGDVPEIMVIGGGRVYEQFLPKQKLYLTHIDA
3bb1G           KAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASL--SDIPVVLIENSGRCNKNDSDEKVLPNGI
3dfdA           ----------------------------------------------------------------------
3dftC           -----------PGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILHETLY
3dftD           -----------PGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILHETLY
3dfoD           -----------PGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILHETLY
2aumB           EQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFADIS----VLLSAFHRHGL
3d31A           QQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLHKKNTVLHITHDQTEARIADRIAVVMDGK
2ancF           KTIIRAERLRMSR-QKQRHDALISKLLA------------------------------------------
1aldA           -----------PGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILHETLY
3dfqA           KELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFRQLLLTADDRVNPCIGVILFHETLY
1eamA           ---------PFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYNMRLTRVTKSDAVNYKKMYYLNKIV
6aldA           -----------PGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILHETLY
3dfnA           -----------PGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGVILFHETLY
1adoA           KELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTENRRFYRQLLLTADDRVNPCIGVILFHETLY
3dfnD           KELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLTADDRVNPCIGVILFHETLY
3b9qA           ----------------------------------------------------------------------
3dfqD           -----------PGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILHETLY
4atjA           SWRVPLGRRDSLDLANANLPAPFFTLPQLKDSFRNVGLNRSSDLVALSGHTFGKNQCRFIDRLYNF-SNT
3b55A           NDLKPLKNVG-SA-SIVGLGEATHGAHEVFTKHRIVKYLVSEKGFTNLVLEEGWDRALELDRYVLTGKG-
2bhvD           YRLDIVWSRIITPHINIMLTNGYNGLVGELIERNFQRYGVPGDYLLMQLMRQILRDKSKIAPIVVIREGS
1dyhA           HTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPMVIGGGRVYEQFLPKQKLYLTHIDA
3dymA           -----------KAAGHYQAEAALLQCTADTLADAVLITTAHAWQHKTLFISRKTYRIDGGQMAITVDVEV
1e9sI           ----------------------------------------------------------------------
3bjqB           ---------------PILSTHARGYRQSTLIGKKLFPVAPVAQYGGKILTEAFRLYNTKRNTIDFGYEGD
1azsC           ----------------------------------------------------------------------
3bk7A           LQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLMEKNTALVVEHDVLMIDYVSDRLIVFEGE
4dfrA           HTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPMVIGGGRVYEQFLPKQKLYLTHIDA
3cioD           MLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILN-------------------
3c85A           GQIAAIAEYPDQL-EGLLESGVDAAFNIYSEGFARHVCKQLEPQFTSI----------------------
1chdA           --------------KLIAIGASTGGTEAI--RHVLQPLPL--SSPAVIITQHMPPGFTRAERLNKLCQIS
2aexA           --------------ELAHRCSSFMAPPVTDLGELRRRPGQAQVCQALAQVDGGARKEGGGGISCVLQDGC
2bbtB           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESVCKLMANKTRILVTSKMEHLKKADKILILHEGS
2bwjB           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
2bhvA           YRLDIVWSRIITPGINIMLTNAYNGLVGELIERNFQRYGVP-----------------------------
2a1fC           ---------------EALQGEDGLGIDPAIDRMAVEIKELVEMGVEVSVVLGGGNLFRGALAKAGMNRVV
2aunB           EQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFSDISVLLSARHGLPAIHGP
2b0lB           ---------------VQMAISSLSYSELEAIEHIFEELDGNEGLLVAITRSVIVNALRKLESAGVIESRS
1e2mA           ----------------------------------------------------------------------
2bhvC           RLDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRYGVP-----------------------------
2bwjD           ----------------------------------------------------------------------
2e85A           APENDIVAIRERPTRLLIVDATDMGLNPGEIRIIDPDDI----AEMFMMTTHNMPDQLKEDIGEVIFLGI
1e2mB           YLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRNTVRYLQCGGSWREDWGQLSGPQSNA
3dfqC           KELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFRQLLLTADDRVNPCIGVILFHETLY
1ckeA           --------GRDMGTVVFPDAPVKIFLDASSEHRRMLQLQVKGFSVNFERLLAEIKLVPAADALVLDSTTL
1cjvC           ----------------------------------------------------------------------
3dvlD           -------VSIDSVTSVFQQYDA----SSVVRRELFRLVARLKQIATTVMTTEEYGPIARYGVEEFVSDNV
3bv4A           KELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTETEENRRFYRQLLLTADDRVNPCIGVILFHETLY
2bv7A           --------------YKSDFLKALSKGQNVTEEECLEKVRLFLVNTATIDVIYEMMNAEL-----------
3dfoC           KELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRLLLTADDRVNPCIGVILFHETLY
2d2fA           -----------------------------------------------ITHYQRILNYIQPDKVHVMMDGR
3dkvA           ----------------------------------------------------------------------
1e2lA           SMTPQAVLAFVALIPPTLPGTNIVLGALPEDDRLAKRQRPGERLDLAMLAAIRRVYGLLANTVRYLQCGG
2d7vA           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
2bbtA           ------------------------------------------ANKTRILVTSKMEHLKKADKILILHEGS
2bboA           ------------------------------------------------LVTSKMEHLKKADKILILHEGS
2e85B           -----------RPTRLLIVDATDMGLNPGE----IRIIDPDDIAEMFMMTTHNMPDQLKEDIGEVIFLGI
2ccjA           ---------------------LTIYLNVSAEVGRERIIKNRLDQEDLKFHEKVIEGYQEIHRFKSVNADQ
2d3wA           -----------------ILDESDSGLDIDALKVVADGVNSLRDGKRSFIVTHYQRILDYIDYVHVLYQGR
2boeX           DALMSAAQAAGKIPILVVSNAPGRDCGGGAYRSWIDEFGLKNRPAYIIVEPDLISLMSSCQHVQQEVLET
2cbzA           ------------------------------------------------LVTHSMSYLPQVDVIIVMSGGK
3dm5B           ----------------------------------------------------------------------
3d1mB           TRNSERFKELTYNPDIIFKDEENTGADRLMTQRCKDKLNMNQWPGVKLRVTEGWDEDGHHSEESLHYEGR
1e2iA           ----------------------------------------------------------------------
3cqcA           ------------------------------------------LLHTILHSTGQYQECLQLADMVSSERHK
1akeA           PDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRTAPLIGYYSKEAEAGTKYAKVDGTK
1e2jB           ----------------------------------------------------------------------
3d1mA           ------------------KDEENTGADRLMTQRCKDKLNALAISVMNRVTEGWDEDGHHSEES-LHYEGR
3dyoA           RIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAWQHQGKTLFISRKTYRIDGSGMAITVDVEV
1dw9A           ----------------------------------------------------------------------
2ancD           ------------------------------------------------IVNDDFDTALTDKTIIRAERLR
1dekB           PIKGVFVFDDEGK-ESVNFVAFNKITDVINNIEDQWSVRRLMQATDLIVNNFDRMYWVKLALDYLDKFNS
1d8jA           KQKQWLMTEALNNPKIEVIDGKYAFKPKYNVR--------------------------------------
2a78A           ----------------------------------------------------------------------
1b0uA           ---------------------------------------------TMVVVTHEMGFARHVSHVIFLHQGK
2anbA           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
2bwjF           ----------------------------------------------------------------------
3brwA           -----------TNEESPAFVEFLEFLGQKVKLQDFKGFRGGQTGTESVYCNFRNKEIMFHDAQQLQRKRH
3cwzA           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
2e9sA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           IVEQGSYAELSAANGAFATLLAHRQEDI
3b60A           IVERGTHSELLAQHGVYAQLHKMQ----
3b5jA           IVEQGKHKELLSEPESLYSYLYQLQSD-
2c61B           EDHKAVSDQMYAGYAEGRDL--------
3dt2A           VIMHDPFAMRPFFGYNFGKYLAHWLS--
3cmvH           INFYGELVDLGVKEKLIEK---------
3cmvG           QILYGEGINFYGELVDLGVKEKLIEK--
2d3wB           IVKSGDFTLV------------------
1accA           LRQDGKTFID------------------
2dwoA           LDPDKCDRDLSLIKVIDVGRRFLVNRV-
2akaB           LPLRRGYIGVVNRSQKDIDGKKDITA--
3dmdC           PILFVGVGQG------------------
2c9yA           YRKRGIHSAI-DASQTPDVVFASILA--
3eiuB           EDHKAVSDQMYAGYAEGRDL--------
2c03B           PIYFAGVSEK------------------
3dtbB           IMHDPFAMRPFFGYGKYLAHWLSMAHRP
2ccjB           PLENV-VEDTYQTIIKY-----------
3c95A           ----------------------------
2dwpA           LDPDKCDRDLSLIKVIDVGRRFLVN---
2c04A           IYFAGVSEKPEGLEPFYPERLAGR----
4dcgA           MLRTVYCNKT------------------
1e69A           ----------------------------
3cmvC           INFYGELVDLGVKEKLIEKAGAWYSY--
3cmvA           AVKEGENVVGSETRVKVVK---------
1e9fA           TATEKPLGEL------------------
2b8tA           PYLNSNSEEF------------------
1e9cA           SIEAVHEDIRVLSEDAIATATEKPLKEL
2ccgA           FKSVNADQPLENVVEDTYQTI-------
1d1cA           FEKGAGEGAVLKDKTALNAASTVFG---
1bifA           EEQDRDLSYIKIMDVGQSYVVNRVADHI
2ccgB           PLENV-VEDTYQTIIKY-----------
1dkiA           DGRNFYHVNWGVSDGFFRLDALYQSA--
2cjwB           ----------------------------
3dt7A           VIMHDPFAMRPFFGYNFGKYLAHWLSMA
2czvA           ----------------------------
1e2dA           SIEAVHEDIRVLSEDAIA----------
3b2qA           GQIVV-----------------------
2c03A           IYFAGVSEKPEGLEPFYPERLAGR----
3dm5A           PIKFIGTGEKID----------------
2c61A           VVARELHRKG------------------
1e98A           RIEAVHEEIRVLSEDAIRTATEKPLGEL
2ahvA           VMMQ------------------------
2a5gA           ----------------------------
1e3mB           ALEHGDTIAF------------------
2b8wA           LQDEELDPEFVQQVADFCSYIFSNSKTK
3dt4C           VIMHDPFAMRPFFGYNFGKYLAH-----
2bbsA           SYFYGTFSELQNLRPDFSSKLMSFDQ--
3dmdB           PILFVGVGQG------------------
3dt4A           VIMHDPFAMRPFFGYNFGKYLAHWLSMA
1aroP           IGRAIEDEAR------------------
3eiuA           EDHKAVSDQMYAGYAEGRDLRGLVA---
2dr3A           IDGELKRSLI------------------
2a2zA           KTN-------------------------
1cr4A           LVLVRILKCR------------------
1e9dA           SIEAVHEDIRVL----------------
2dr3E           IDGELKRSLIVWKM--------------
1cs4C           ----------------------------
2dr3B           IRLDLDEIDG------------------
3cddF           LDEELIASILFSDAGRLAVISVV-----
3cddC           GLPTVGGIKADVTDSEIGRYRPLII---
2a2zD           DFKD------------------------
3a1wA           ----------------------------
3d7wA           FNNPIALAIA------------------
3b2qB           EDHKAVSDQMYAGYAEGRDL--------
3czpB           INDAIEAAYK------------------
1culC           ----------------------------
2a30A           YES-------------------------
1e4yA           EETVRKRLVE------------------
3d3kA           ----------------------------
1e9sG           ----------------------------
2ahwD           V---------------------------
2c9oC           QTEGINISE-------------------
2bifA           ----------------------------
3ed8A           ----------------------------
1e9rA           ----------------------------
2awnC           VAQVGKPLEL------------------
3ec1A           VTCNDPGAQLVVHAPKGVDVFIRQS---
2a30D           YES-------------------------
2akaA           FEKGAGEGAVLKDKTALNA---------
2bofX           HSA-------------------------
1dg3A           VQQVADFCSYIFSNSKTKTLSGGIQ---
1e1qB           LFYKGIR---------------------
3cmxA           LVDLGVKEKLIEKAGA------------
3bpbA           IMPAGYPRTREKIARLGYRVI-------
3bb1A           AWIPHLVQTIT-----------------
1e9sF           L---------------------------
3b85A           ----------------------------
1bmfC           LTALPVIETQ------------------
1cr1A           LVLVRI----------------------
1e2fA           IEA-------------------------
2a30B           YES-------------------------
1dhiA           EVEGDTHFPD------------------
2bc9A           ----------------------------
2cckA           LEN-------------------------
3cbnA           ----------------------------
2ctsA           WSHNF-----------------------
2d4hB           ESLVLTYVNA------------------
2awnB           VAQVGKPLELYHYPADRFVAGFIGS---
3cr7D           ----------------------------
3cmvB           QILYGEGINFYGELVDLGVKEKLIEK--
1ckvA           ----------------------------
2a2zB           DFKD------------------------
421pA           ----------------------------
2axpA           ----------------------------
2bkhA           EEKLDLFRVVAG----------------
2aunA           VATGLGLQERLASLASVSRLLAG-----
3dm9B           PILFVGVGQ-------------------
2ck3C           LTALPVIETQ------------------
3cddD           LPTVGGIKA-------------------
2bx2L           LIVIDFIDMT------------------
2b8tC           YLN-SNSEEF------------------
2cgtH           APGFGDRRKAMLQDIATLTGGTVISE--
1bg0A           LPFSHDDRFG------------------
3bjdB           EDEKGSHPRLLAKLLEAIGLEADFQA--
1e0jA           QGDMPNLVLVRILKCRFT----------
1e6cA           ----------------------------
3da4A           ----------------------------
3adkA           ----------------------------
2cckB           ----------------------------
1ai4B           LNISVGAKILYEAVQGDKSPIPQAVD--
3bgwA           ESEQDADIIEFLYRDDYYDKESESKN--
1cr2A           LVLVRI----------------------
1cjtC           ----------------------------
2axzC           VNIINIFKII------------------
2ausC           GEIIQRTRKVYYIEILEID---------
2awnD           LLPSDIADVI------------------
1e3mA           ALEHGDTIAF------------------
3bb1E           AWIPHLVQTITEVALNKSESIFVDKN--
2bdtA           ----------------------------
2bbsB           SYFYGTFSELQNLRDSFDQFSAERRNS-
2c4rL           MTPVRHQRAV------------------
1dvrA           YKKTGIWAGVDASATVWADILNKLGKN-
2d4hA           KLQDEELDPE------------------
2b8tB           PYLNSNSEEF------------------
3c8uA           IEAARLPADL------------------
3cmtD           LVDLGVKEKL------------------
3bb1H           CNKNDSDEKVLPNGIAWIPHLVQTITEV
3bb1F           WIPH------------------------
3bczC           QGE-------------------------
1cr0A           LVLVRILKCRFTGDTGIAGYMEYNKE--
3bb1B           VQTITE----------------------
1e9sD           PEHVTMPDG-------------------
2d0kA           EVEGDTHFPD------------------
2bkiA           GLDDEEKLDLFRVVAGV-----------
3cmwC           ----------------------------
3di4A           GLGDWPSPSVNGYDRSHG----------
2a5jA           ----------------------------
3cr7C           ----------------------------
3d3qB           FNEVQHLVEQ------------------
2bnlB           ----------------------------
2aumA           PAIHGPVATGLGL---------------
3bgwD           QLEQDADIIEFLYRDDYYDKESESKN--
3a00A           ----------------------------
1e2gA           SIEAVHEDIRVLSED-------------
2d62A           LQQVGTPDEV------------------
2bwjA           L---------------------------
1e9sE           ----------------------------
2bnlA           ----------------------------
3cr7A           ----------------------------
1e2hB           SWREDWGQLSGPQSNAGPRPHIGDT---
2bjbA           VRITGWPRVSVQPADHIL----------
2dpyA           ----------------------------
2drcA           EVEGDTHFPD------------------
3czpA           ----------------------------
2bkeA           RIARVVDAPHLPEGEVVFALTEEGIRDA
2b0lC           LGMKGTYIKVLNNKF-------------
3bo6B           ----------------------------
1afrA           MMRKKISMP-------------------
1e9rG           ----------------------------
3d3qA           FNEVQHLVEQGFEASQSQAI--------
1e3aB           LNISVGAKIL------------------
2eg5G           ----------------------------
2b92B           RRKLAQLEKL------------------
2d4uA           ----------------------------
1draA           EVEGDTHFPD------------------
3cmvE           GEGINFYGEL------------------
3dauA           EVEGDTHFPD------------------
3bh0A           ELEQDADIIEFLYRDDYYDKESESKN--
1dhjA           EVEGDTHFPD------------------
1d6jB           ----------------------------
3crmA           LS--------------------------
3dlbB           RLSIPKLMG-------------------
1e59A           ILELNIPTGV------------------
2cvfA           ----------------------------
2a1fF           GDHMGMLATV------------------
2c7cH           APGFGDRRKA------------------
3dfnC           QKADD-----------------------
1cjuC           ----------------------------
1ek0A           ----------------------------
3bm2B           KIVGGTPQLVPDPTPFVTYFH-------
2dpyB           ----------------------------
1e9sB           ----------------------------
3clvA           ----------------------------
3e8aC           ----------------------------
1eilA           QDPFGLPLEIYYGPAEIFHEPFLPS---
2bnlC           ----------------------------
1e9sJ           PEHVTMPDGD------------------
3bb1C           AWIPHLVQTITELNKSESIFVDKNLID-
1e9sL           ----------------------------
1e9rF           ----------------------------
3dffA           FATHEKNVPVRLWEDLPYAV--------
1bglA           VASDT-----------------------
1e2kA           PGERLDLAMLAAIRRVYGLL--------
2b8wB           CFVFDRPVHRRKLAQLEKLQDEELDPEF
1e0jB           QGDMPNLVLVRILKCRFT----------
2dr3C           IDGELKRSLI------------------
2b8tD           YLNSNSEEFIKF----------------
3c15C           ----------------------------
3dhwC           LIEQDTVSEVFSHPK-------------
3cueF           ----------------------------
1cfrA           LAHEGSLM--------------------
3cm0A           ----------------------------
2d3wD           IVKSGDFTLV------------------
3dfpC           QKAD------------------------
1e9sH           ----------------------------
2dr3F           IDGELKRSLIVWKM--------------
1e9sM           ----------------------------
2dr3D           IRLDLDEIDG------------------
2c0bL           VENRLREAVRQDRARIQ-----------
2a1fD           GDHMGMLATV------------------
3ch4B           ----------------------------
1d2zD           ----------------------------
1dekA           ----------------------------
3be4A           PKE-------------------------
1av6A           VRNKVVVNFDYPNQEYDYFHMYFMLRTV
2bhjA           LIRYAGYQMPDG----------------
2d3wC           IVKSGDFTLV------------------
3ecpA           WWMRPDDPADADEKESGKWLAAAAT---
2awoC           VAQVGKPLELYHYPADRFV---------
3czjA           ASDT------------------------
2d2eA           VVATGGPELALELEAKGYEWL-------
3c14C           ----------------------------
1e9rE           PEHVT-----------------------
1d6aA           ----------------------------
3c7kA           ----------------------------
5dfrA           EVEGDTHFPD------------------
2awnA           VAQVGKPLELYHYPADRFVAGFIGS---
2a1fE           GDHMGMLATVMNGLAMRDSLFRADV---
3dfpD           QKADD-----------------------
3cr7B           ----------------------------
1drbA           EVEGDTHFPDYEPDDWESVFSEFHDAD-
3bb1G           AWIPHLVQTITE----------------
3dfdA           ----------------------------
3dftC           QKA-------------------------
3dftD           QKADD-----------------------
3dfoD           QKADD-----------------------
2aumB           PAIHGPVATGLGLE--------------
3d31A           LIQVGKPEE-------------------
2ancF           ----------------------------
1aldA           QKADD-----------------------
3dfqA           QKADD-----------------------
1eamA           RNKVVVNFDYP-----------------
6aldA           QKADD-----------------------
3dfnA           QKADD-----------------------
1adoA           QKA-------------------------
3dfnD           QKA-------------------------
3b9qA           ----------------------------
3dfqD           QKA-------------------------
4atjA           GLPDPTLNTT------------------
3b55A           -NPSQHLTPV------------------
2bhvD           RVFISPNTDIFFPI--------------
1dyhA           EVEGDTHFPD------------------
3dymA           ASDTP-----------------------
1e9sI           ----------------------------
3bjqB           PYSIVPSALE------------------
1azsC           ----------------------------
3bk7A           PGRHGRALPPMGMREGMNRFLASVGITF
4dfrA           EVEGDTHFP-------------------
3cioD           ----------------------------
3c85A           ----------------------------
1chdA           VKEAEDGERVLPGHAYIAPGDKH-----
2aexA           VFEKAGVSIS------------------
2bbtB           SYFYGTFSELQNLRPDFSSKLMDSFDQF
2bwjB           ----------------------------
3cmuA           ----------------------------
1e2kB           ----------------------------
2bhvA           ----------------------------
2a1fC           GDHMGMLATV------------------
2aunB           VATG------------------------
2b0lB           LGMKGTYIKV-LNNKFLIELENLK----
1e2mA           ----------------------------
2bhvC           ----------------------------
2bwjD           ----------------------------
2e85A           QPDIVGFYYPMTIKDAVETVYQRLEGWE
1e2mB           GPRPHIGDTLFTLFRAPELLAPNG----
3dfqC           QKAD------------------------
1ckeA           SIEQ------------------------
1cjvC           ----------------------------
3dvlD           VILRNVLEG-------------------
3bv4A           QKA-------------------------
2bv7A           ----------------------------
3dfoC           QKA-------------------------
2d2fA           VVATGGPELALELEAKGYEWLKEKVK--
3dkvA           ----------------------------
1e2lA           SWREDWGQLSGPRPHIGDTLFTLFR---
2d7vA           ----------------------------
2d7vB           ----------------------------
1e9rB           ----------------------------
2bbtA           SYFYGTFSEL------------------
2bboA           SYFYGTFSELQNLQPDFSSKLMSFDQFS
2e85B           QPDIVGFYY-------------------
2ccjA           PLENV-VEDT------------------
2d3wA           IVKSGDFTLV------------------
2boeX           MAYAG-----------------------
2cbzA           ISEMGSYQELLARDGAFAEFL-------
3dm5B           ----------------------------
3d1mB           AVDITTSDRDRSKYGMLARLAVEAGFDW
1e2iA           ----------------------------
3cqcA           LYLVFSKEEL------------------
1akeA           PVAEVRADLEKI----------------
1e2jB           ----------------------------
3d1mA           AVDITTSDRDRSKYGMLARLAVEAGFDW
3dyoA           ASDTPHPARI------------------
1dw9A           ----------------------------
2ancD           MSRQKQRHDALISK--------------
1dekB           GYDYY-----------------------
1d8jA           ----------------------------
2a78A           ----------------------------
1b0uA           IEEEGDPEQVFGQSPRLQQFLKGSLKKL
2anbA           ----------------------------
1e9sA           ----------------------------
2bwjF           ----------------------------
3brwA           IGNDIVAVVF------------------
3cwzA           ----------------------------
3cnlA           ----------------------------
2e9sA           ----------------------------
3do6A           ----------------------------