[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for sent8:ACF66838.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2bi4A.bssp"
#ERROR : Can't open dsspfile "3bfjA.bssp"
#ERROR : Can't open dsspfile "1dqsA.bssp"
#ERROR : Can't open dsspfile "3ce9A.bssp"
#ERROR : Can't open dsspfile "1dqsB.bssp"
#ERROR : Can't open dsspfile "3ce9B.bssp"
#ERROR : Can't open dsspfile "2d2xB.bssp"
#ERROR : Can't open dsspfile "2d2xA.bssp"
#ERROR : Can't open dsspfile "3clhA.bssp"
#ERROR : Can't open dsspfile "2b99B.bssp"
#ERROR : Can't open dsspfile "2b98B.bssp"
#ERROR : Can't open dsspfile "3c17A.bssp"
#ERROR : Can't open dsspfile "2b98C.bssp"

## Summary of PDB Search
:370
    3e-61  32%  2bi4A  [x.x.x] LACTALDEHYDE REDUCTASE
    1e-55  32%  3bfjA  [x.x.x] 1,3-PROPANEDIOL OXIDOREDUCTASE
    6e-51  14%  1dqsA  [e.22.1] PROTEIN (3-DEHYDROQUINATE SYNTHASE)
    2e-50  15%  3ce9A  [x.x.x] GLYCEROL DEHYDROGENASE
    1e-47  13%  1dqsB  [e.22.1] PROTEIN (3-DEHYDROQUINATE SYNTHASE)
    7e-47  16%  3ce9B  [x.x.x] GLYCEROL DEHYDROGENASE
    2e-43  14%  2d2xB  [x.x.x] 2-DEOXY-SCYLLO-INOSOSE SYNTHASE
    2e-43  12%  2d2xA  [x.x.x] 2-DEOXY-SCYLLO-INOSOSE SYNTHASE
    8e-39  17%  3clhA  [x.x.x] 3-DEHYDROQUINATE SYNTHASE
    6e-10  11%  2b99B  [x.x.x] RIBOFLAVIN SYNTHASE
    1e-09   9%  2b98B  [x.x.x] RIBOFLAVIN SYNTHASE
    2e-04  13%  3c17A  [x.x.x] L-ASPARAGINASE PRECURSOR
    2e-04  10%  2b98C  [x.x.x] RIBOFLAVIN SYNTHASE
:370

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNTFSLQTRLYSGQGSLAVLKRFTNKHIWIICDGFLAHSPLLDTLRNALPADNRISVFSEITPAPTIHTV
2bi4A           MARMILNETAWFGRGAVGEVKRRGYQKALIVTDKTLVQCGVVAKVTDKMDAAGAWAIYDGVVPNPTITVV
3bfjA           MFDYLVPNVNFFGPNAISRCQLLGGKKALLVTDKGLRKDGAVDKTLHYLREAGEVAIFDGVEPNPKDTNV
1dqsA           --SILGRESIIADFGLWRLISDCSSTTYVLVTDTNIG-SIYTPSFEEAFRKRAAIYNRPPGEVSKSRQTK
3ce9A           --RIAIPLILEVGNNKIYIIKKGNFKRVSLYFGEGIYE-LFGETIEKSIKSSNIEIEAVETVKNIDFDEI
1dqsB           --SILGRESIIADFGLWRLISDCSSTTYVLVTDTNIGS-IYTPSFEEAF---RKRAAEITPSPRLLIYNR
3ce9B           --RIAIPLILEVGNNKIYIIKKGNFKRVSLYFGEGIYE-LFGETIEKSIKSSNIEIEAVETVKNIDFDEI
2d2xB           ICFADRCFNFAFGEHVLEYIPRDEFDQYIMISDSGVPDSIVHYAAEYFGKLAPVHILFQGGEEYKTLSTV
2d2xA           ICFADRCFNFAFGEHVLEYIPRDEFDQYIMISDSGVPDSIVHYAAEYFGKLAPVHIRFQGGEEYKTLSTV
3clhA           -----------------ELPEIKLKQKALIISDSIVA-GLHLPYLLERLKALERVCVIESGEKYKNFHSL
2b99B           -----------------------------GIVDTTFARVDMASIAIKKLKELSPIKIIRKTVPGIK-DLP
2b98B           -----------------------------GIVDTTFARVDMASIAIKKLKELSNIKIIRKTVPGIK-DLP
3c17A           ----------------------------------------------------------------------
2b98C           -------------------------KKVGIVDTTFAR-VDMASIAIKKLKELSPNIKIIRKTVPGIKDLP


                         .         .         *         .         .         .         .:140
query           VQGIAQMQALQPQVVIGFGGGSAMDAAKAIVWFSQQSGINIETCVAIPTTSGTGSEVTSACVISDPDKGI
2bi4A           KEGLGVFQNSGADYLIAIGGGSPQDTCKAIGIISNNPEFADVPILAIPTTAGTAAEVTINYVITDEEKRR
3bfjA           RDGLAVFRREQCDIIVTVGGGSPHDCGKGIGIAATHEGDLYQYIVAVNTTAGTASEVTRHCVLTNTETKV
1dqsA           ADIEDWMLSQRDTVVIALGGGVIGDLTGFV-ASTYMRGVRY---VQVPTTLLAMVDSSIGGKTAIDTPLG
3ce9A           GTNA-FKIPAEVDALIGIGGGKAIDAVKYAFLR----KLPF---ISVPTSTSNDGFSSPVASLLINGKRT
1dqsB           PPGEVSKSRQTKADIEDWMLSQNPPCGRDTVVIALGGGVIGDLTVQVPTTLLAMVDSSIGGKTAIDTPLG
3ce9B           GTNA-FKIPAEVDALIGIGGGKAIDAVKYA----FLRKLP---FISVPTSTSNDGFSSPVASLLINGKRT
2d2xB           TNLQERAIALGRTAIVAVGGGLTGNVAGVAAGMMFR-GIAL---IHVPTTFASDSVLSIKQAVNLTSGKN
2d2xA           TNLQERAIALGANAIVAVGGGLTGNVAGVAAGMMFRGIALI--HVPTTFLAASDSVLSIKQAVNLTSGKN
3clhA           ERILNNAFEMQLNLMIALGGGVISDMVGFA-SSIYFRGIDF---INIPTTLLAQVDASVGGKTGINTPYG
2b99B           VACKKLLEEEGCDIVMALGMPGKAEKDKVCAHEASLGLMLAQLMTNKHIIEVFVHEDE------------
2b98B           VACKKLLEEEGCDIVMALGMPGKAEKDKVCAHEASLGLMLAQLIIEVFVHEDEAKDDKELDWLAK-RRAE
3c17A           -------------------GESALDVVTEAV---------RLLEECPLFNAGIGATHELDACVMDGNTLK
2b98C           VACKKLLEEEGCDIVMALGMPGKAEKDKVCAHEASLGLMLAQLMTNKHIIEVFVHEDE------------


                         +         .         .         .         .         *         .:210
query           KYPLFNNALYPDMAILDPELVVSVPPQITANTGMDVLTHALEAWVSPRASDFTDALAEKAAKLVFQYLPT
2bi4A           KFVCVDPHDIPQVAFIDADMMDGMPPALKAATGVDALTHAIEGYITRGAWALTDALHIKAIEIIAGALRG
3bfjA           KFVIVSWRNLPSVSINDPLLMIGKPAALTAATGMDALTHAVEAYISKDANPVTDAAAMQAIRLIARNLRQ
1dqsA           KNLIGA-IWQPTKIYIDLEFLETLPVREFINGMAEVIKTAAISSEEEFTALEENATILKAVRRRFEGTEE
3ce9A           SVPAK----TPDGIVVDIDVIKGSPEKFIYSGIGDLVSNITALFEEENHKSIIDDFAVISKKSVNSFVRT
1dqsB           KNLIGAIWQPT-KIYIDLEFLETLPVREFINGMAEVIKTAAIS----SEEEFTAETILKAVRRTEEILKA
3ce9B           SVP----AKTPDGIVVDIDVIKGSPEKFIYSGIGDLVSNITALFEEENHKSIIDDFAVISKKSVNSFVRT
2d2xB           LVGFY---YPPRFVFADTRILSESPPRQVKAGMCELVKNMLILEND------NKEFTEDDLNSANVYSPK
2d2xA           LVGFY---YPPRFVFADTRILSESPPRQVKAGMCELVKNMLILKEF--TEDDLNSANVYSPKQLETFINF
3clhA           KN-LIGSFHQPKAVYMDLAFLKTLEKREFQAGVAEIIKMAVCFDKNLVERLETKDLKDC-----------
2b99B           ----------------------------------------------------------------------
2b98B           EHAENVYYLLFKPEYLTR----------------------------------------------------
3c17A           AGAVAGVSHLRNPVLAARLVMEQSPHVMMIGEGAENFAFARGMERVSPEIFSTSLRYEQLLAARKEGAPL
2b98C           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AVEKGDCVATRGKMHNASTLAGMAFSQAGLGLNHAIAHQLGGQFHLPHGLANALLLTTVIRFNAGVPXXX
2bi4A           SVA--GDKDAGEEMALGQYVAGMGFSNVGLGLVHGMAHPLGAFYNTPHGVANAILLPHVMRYNA--DFTG
3bfjA           AVALGSNLQAREYMAYASLLAGMAFNNANLGYVHAMAHQLGGLYDMPHGVANAVLLPHVARYNL--IANP
1dqsA           ILKARILASARHKAYVVSADEREGGLRNLLNWGHSIGHAIEAILTPQILHGECVAIGMVKEAEL------
3ce9A           DFKSIKDEVFLKELVDSLTAEIAGNSSPASGAEHLISHALDKFLPNPQLHGIQVGVATYISKVH------
1dqsB           RILAS----ARHKAYVVSADEREGGLRNLLNWGHSIGHAIEAILTPQILHGECVAIGMVKEAEL------
3ce9B           DFKSIKDEVFLKELVDSLTAEIAGNSSPASGAEHLISHALDKFLPNPQLHGIQVGVATYISKV-------
2d2xB           QLETFINFCISAKMSVLSEDIYEKKKGLIFEYGHTIGHAIAEQGGITHGEAIAVGMIYAAKIANRMNLMP
2d2xA           CISA--------KMSVLSEDIYEKKKGLIFEYGHTIGHAIAEQGGITHGEAIAVGMIYAAKIANRMEHDV
3clhA           ----------LEEVIFQSVNIKAQVVRAGLNYGHTFGHAIEDYERFLHGEAIAIGMRMANDLAL------
2b99B           ----------------------------------------------------------------------
2b98B           ----------------------------------------------------------------------
3c17A           DKQKMGAVGAVALDLDGNLAAAT-----------------------------------------------
2b98C           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           XXXXXXXXXCGFCPAEANDIAAINALIQQIELLKQRCVLPSLAVALKEGRSDFSARIPAMVQAALADVTL
2bi4A           EKYRDIARVMGVKVEGMSLEEARNAAVEAVFALNRDVGIPPHLRDVGVRKED----IPALAQAALDDVCT
3bfjA           EKFADIAELMGENITGLSTLDAAEKAIAAITRLSMDIGIPQHLRDLGVKETD----FPYMAEMALKDGNA
1dqsA           --------------ARHLGILK-GVAVSRIVKCLAAYGLPTSLKDARIRKLTAGKHCVDQLMFNMAKKND
3ce9A           ----------------KHREERIKKILSDTGFFN---YVKGLNKK--------SDFKRAISEAHLIPARY
1dqsB           --------------ARHLGILK-GVAVSRIVKCLAAYGLPTSLKDARIRKLTAGKHCSLMFNMALDKKND
3ce9B           ----------------------HKHREERIKKILSDTGFF---NYVKG-LNKKSDFKRAISEAHLIPARY
2d2xB           EHDVSAHYWL-LNKIGALQDIDPDSIFHYLIEDNLGMILLSGVGKPAMYNQTLLTPVRKTLIKEVIR---
2d2xA           SAHYWLLNKIGALQDIPLKSDPDSIFHYLIHEDNLGMILLSGVGKPAMYNQTLLTPVRKTLIKEVIR---
3clhA           ----------------------------------------------------------------------
2b99B           ----------------------------------------------------------------------
2b98B           ----------------------------------------------------------------------
3c17A           ----------------------------------------------------------------------
2b98C           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           RTNPRPANAEAIRxxxxxxx
2bi4A           GGNPREATLEDIV-------
3bfjA           FSNPRKGNEQEIA-------
1dqsA           GPKKKIVLLSAIG-------
3ce9A           TYLHVEKNCETAK-------
1dqsB           GPKKKIVLLSAIG-------
3ce9B           TYLHVEKNCETAK-------
2d2xB           --------------------
2d2xA           --------------------
3clhA           --------------------
2b99B           --------------------
2b98B           --------------------
3c17A           --------------------
2b98C           --------------------