[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for sent8:ACF67239.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1bl0A.bssp"
#ERROR : Can't open dsspfile "2ao9H.bssp"
#ERROR : Can't open dsspfile "2ao9C.bssp"
#ERROR : Can't open dsspfile "2dg6A.bssp"
#ERROR : Can't open dsspfile "3bcyA.bssp"
#ERROR : Can't open dsspfile "1d5yA.bssp"

## Summary of PDB Search
:309
    1e-18  23%  1bl0A  [a.4.1 - a.4.1] PROTEIN (MULTIPLE ANTIBIOTIC RESISTANCE
    1e-15   8%  2ao9H  [x.x.x] PHAGE PROTEIN
    3e-15   8%  2ao9C  [x.x.x] PHAGE PROTEIN
    3e-14  19%  2dg6A  [x.x.x] PUTATIVE TRANSCRIPTIONAL REGULATOR
    6e-08   7%  3bcyA  [x.x.x] PROTEIN YER067W
    6e-04  22%  1d5yA  [a.4.1 - a.4.1 - d.60.1] ROB TRANSCRIPTION FACTOR
:309

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bl0A           ----------------------------------------------------------------------
2ao9H           ----------------------------------------------------------------------
2ao9C           ----------------------------------------------------------------------
2dg6A           ----------------------------------------------------------------------
3bcyA           ----------------------------------------------------------------------
1d5yA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bl0A           ----------------------------------------------------------------------
2ao9H           ----------------------------------------------------------------------
2ao9C           ----------------------------------------------------------------------
2dg6A           ----------------------------------------------------------------------
3bcyA           ----------------------------------------------------------------------
1d5yA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLSSAQITLKER
1bl0A           --------------------------------------------------------------------HS
2ao9H           -----------------------------------------------------------LTAKQIQAAYL
2ao9C           -----------------------------------------------------------LTAKQIQAAYL
2dg6A           ----------------------------------------------------------------------
3bcyA           ------------------------------------------------------------NSHSKKFVRH
1d5yA           --------------------------------------------------------------------RD


                         .         .         .         +         .         .         .:280
query           VYNIISSSPSRQWKLTDVADHIFMSTSTLKRKLAEEGTSFSDIYLSARMNQAAKLLRIGNHNVNAVALKC
1bl0A           ILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKEGHSLGQYIRSRKMTEIAQKLKESNEPILYLAERY
2ao9H           LVENELMESEEKRTQDEMANELGINRTTLWEWRTKQDFIAFKSEVADSFLAEKREQVYSKLMQLILGPQP
2ao9C           LVENELMESEEKRTQDEMANELGINRTTLWEWRTKQDFIAFKSEVADSFLAEKREQVYSKLMQLILGPQP
2dg6A           -------------RLADLSKRSGVSTATIKYYLREGLPPGYDEDHLRRLRLVRALIQVGKVPVATAREVL
3bcyA           LHQHIEKHLLKDIKQAVRKPELKFHEKSFDKITWHYGEETEYHGRPFKIDVQVVCTHEDAVFVDYKTHPV
1d5yA           LLIWLEGHLDQPLSLDNVAAKAGYSKWHLQMFKDVTGHAIGAYIRARRLSKSAVALRLTARPILDIALQY


                         .         *         .         .         .         .         +:350
query           GYDSTSYFIQCFKKYFKTTPSTFIKxxxx
1bl0A           GFESQQTLTRTFKNYFDVPPHKYRM----
2ao9H           SVKAMQLYMQRFGLLT-------------
2ao9C           SVKAMQLYMQRFGLLTDKK----------
2dg6A           GHVDDDSLGRTVRLGA-------------
3bcyA           GAN--------------------------
1d5yA           RFDSQQTFTRAFKKQFAQTPALYRR----