[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for sent8:ACF67354.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2b6eA.bssp"
#ERROR : Can't open dsspfile "2b6eD.bssp"
#ERROR : Can't open dsspfile "2b6eB.bssp"
#ERROR : Can't open dsspfile "3e1eC.bssp"
#ERROR : Can't open dsspfile "3e1eD.bssp"
#ERROR : Can't open dsspfile "2cy9A.bssp"
#ERROR : Can't open dsspfile "3e1eB.bssp"
#ERROR : Can't open dsspfile "3dkzB.bssp"
#ERROR : Can't open dsspfile "3e1eA.bssp"
#ERROR : Can't open dsspfile "3dkzA.bssp"
#ERROR : Can't open dsspfile "3e8pA.bssp"
#ERROR : Can't open dsspfile "2av9A.bssp"
#ERROR : Can't open dsspfile "2cwzA.bssp"
#ERROR : Can't open dsspfile "2cwzB.bssp"
#ERROR : Can't open dsspfile "2dslA.bssp"
#ERROR : Can't open dsspfile "3e29B.bssp"
#ERROR : Can't open dsspfile "2av9E.bssp"
#ERROR : Can't open dsspfile "3bbjB.bssp"
#ERROR : Can't open dsspfile "2av9B.bssp"
#ERROR : Can't open dsspfile "3bnvB.bssp"
#ERROR : Can't open dsspfile "3bbjA.bssp"
#ERROR : Can't open dsspfile "2av9G.bssp"
#ERROR : Can't open dsspfile "3e29D.bssp"
#ERROR : Can't open dsspfile "1c8uA.bssp"
#ERROR : Can't open dsspfile "2cy9B.bssp"
#ERROR : Can't open dsspfile "3d6lA.bssp"
#ERROR : Can't open dsspfile "2cyeD.bssp"
#ERROR : Can't open dsspfile "3b7kA.bssp"
#ERROR : Can't open dsspfile "3e29A.bssp"
#ERROR : Can't open dsspfile "3b7kC.bssp"
#ERROR : Can't open dsspfile "2cyeA.bssp"

## Summary of PDB Search
:137
    2e-14  38%  2b6eA  [x.x.x] HYPOTHETICAL UPF0152 PROTEIN HI1161
    2e-14  38%  2b6eD  [x.x.x] HYPOTHETICAL UPF0152 PROTEIN HI1161
    7e-14  38%  2b6eB  [x.x.x] HYPOTHETICAL UPF0152 PROTEIN HI1161
    9e-12  13%  3e1eC  [x.x.x] THIOESTERASE FAMILY PROTEIN
    3e-11  14%  3e1eD  [x.x.x] THIOESTERASE FAMILY PROTEIN
    3e-11   9%  2cy9A  [x.x.x] THIOESTERASE SUPERFAMILY MEMBER 2
    7e-11  13%  3e1eB  [x.x.x] THIOESTERASE FAMILY PROTEIN
    2e-10  14%  3dkzB  [x.x.x] THIOESTERASE SUPERFAMILY PROTEIN
    2e-10  13%  3e1eA  [x.x.x] THIOESTERASE FAMILY PROTEIN
    8e-10  13%  3dkzA  [x.x.x] THIOESTERASE SUPERFAMILY PROTEIN
    1e-08  10%  3e8pA  [x.x.x] UNCHARACTERIZED PROTEIN
    3e-08  10%  2av9A  [x.x.x] THIOESTERASE
    5e-08  14%  2cwzA  [x.x.x] THIOESTERASE FAMILY PROTEIN
    5e-08  15%  2cwzB  [x.x.x] THIOESTERASE FAMILY PROTEIN
    3e-07  13%  2dslA  [x.x.x] PHENYLACETIC ACID DEGRADATION PROTEIN PAAI
    1e-06  14%  3e29B  [x.x.x] UNCHARACTERIZED PROTEIN Q7WE92_BORBR
    2e-06  10%  2av9E  [x.x.x] THIOESTERASE
    6e-06  21%  3bbjB  [x.x.x] PUTATIVE THIOESTERASE II
    1e-05  10%  2av9B  [x.x.x] THIOESTERASE
    1e-05   5%  3bnvB  [x.x.x] CJ0977
    2e-05  22%  3bbjA  [x.x.x] PUTATIVE THIOESTERASE II
    3e-05  11%  2av9G  [x.x.x] THIOESTERASE
    4e-05  11%  3e29D  [x.x.x] UNCHARACTERIZED PROTEIN Q7WE92_BORBR
    5e-05   7%  1c8uA  [d.38.1 - d.38.1] ACYL-COA THIOESTERASE II
    1e-04   8%  2cy9B  [x.x.x] THIOESTERASE SUPERFAMILY MEMBER 2
    2e-04   9%  3d6lA  [x.x.x] PUTATIVE HYDROLASE
    6e-04  10%  2cyeD  [x.x.x] CONSERVED HYPOTHETICAL PROTEIN, TTHA1846
    6e-04   4%  3b7kA  [x.x.x] ACYL-COENZYME A THIOESTERASE 12
    7e-04  17%  3e29A  [x.x.x] UNCHARACTERIZED PROTEIN Q7WE92_BORBR
    7e-04   7%  3b7kC  [x.x.x] ACYL-COENZYME A THIOESTERASE 12
    0.001  10%  2cyeA  [x.x.x] CONSERVED HYPOTHETICAL PROTEIN, TTHA1846
:137

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xIWKRHLTLDELNATSQNTLVAHLGIVYTRLGDDVLEAEMPVDARTHQPFXXXXXXXXXXXXETLGSMAG
2b6eA           -LWKKTFTLENLNQLCSNSAVSHLGIEISAFGEDW--IEATPVDHRTQPFGVLHGGVSVALAETIGSLAG
2b6eD           -LWKKTFTLENLNQLCSNSAVSHLGIEISAFGE--DWIEATPVDHRTQPFGVLHGGVSVALAETIGSLAG
2b6eB           -LWKKTFTLENLNQLCSNSAVSHLGIEISAFGEDWIE--ATPVDHRTQPFGVLHGGVSVALAETIGSLAG
3e1eC           ------------DSFARQPVMATLGARIDTLLPGRVELCMPYDRALTQQHGFLHAGIVSTVLDSACGYAA
3e1eD           ---------------ARQPVMATLGARIDTLLPGRVELCMPYDRALTQQHGFLHAGIVSTVLDSACGYAA
2cy9A           ---------------KVPGFDVLEKVTLVSAAPEKLIC-EKVEEQHTNKLGTLHGGLTATLVDSISTALC
3e1eB           -----------RDSFARQPVMATLGARIDTLLPGRVELCMPYDRALTQQHGFLHAGIVSTVLDSACGYAA
3dkzB           ------------DFFGLTIPFQLLGVVPEHSGNGTARTRLPARADLVNSRGDIHGGTLSVLDFT----LG
3e1eA           ------------DSFARQPVMATLGARIDTLLPGRVELCMPYDRALTQQHGFLHAGIVSTVLDSACGYAA
3dkzA           ------------DFFGLTIPFQLLGVVPEHSGNGTARTRLPARADLVNSRGDIHGGTLS----VLDFTLG
3e8pA           ------IQAEVLKRVAEVPFHNLLGLDIKRYDIDGVEVAINKPELIGNIHQILHGGVTATVLDVVGGLTA
2av9A           ----------------------------PLREQYLHFQPISTRWHDNDIYGHVNNVTYYAFFDTAVNTYG
2cwzA           ----------------------------PEGYEAVFETVVTPETVRFEELGPVHPVYATYWVELAGRKII
2cwzB           ----------------------------PEGYEAVFETVVTPETVRFEELGPVHPVYATYWVELAGRKII
2dslA           -----------------DPFMEALGLKVLHLAPGEAVVAGEVRADHLDLHGTAHGGFLYALADSAFALAS
3e29B           -------TALEASRFVNRPFNRWLGSVLEAGEQGILGIKWREELISSPEIRSTHGGILATLVDA----AG
2av9E           -----------------------------LREQYLHFQPISTRWHDNDIYGHVNNVTYYAFFDTAVNTYG
3bbjB           ----------------------DSATEVVRVGENRYAVELDP----GYLIGTANGGYLTVLQRSALAESD
2av9B           -----------------------------LREQYLHFQPISTRWHDNDIYGHVNNVTYYAFFDTAVNTYG
3bnvB           ----------------CPELNTSLAGTIIEIDKNYAKSILITTSEVADDQGLIFDAFIFAAANYVAQASI
3bbjA           ----------------------------VRVGENRYAVELDPG----YLIGTANGGYLTVLQRSALAESD
2av9G           --------------------------------QYLHFQPISTRWHDNDIYGHVNNVTYYAFFDTAVNTYG
3e29D           -------TALEASRFVNRSPFNRWLGSVLEAGEQGIVLGIKWREESSPEIRSTHGGILATLVDA----AG
1c8uA           ---------------------------------------------------------------VALQPHG
2cy9B           ------STQNLREVKVFGFDRVLEKVTLVSAAPEKLIC-EKVEEQHTNKLGTLHGGLTATLVDSISTALC
3d6lA           --------------------------------MGEPKLKIVAMPSDTNPAGNIFGGWILSQIDLAGAIA-
2cyeD           --------------------------------------------------------------ARIRYFQR
3b7kA           -------------------------------RGTSVQSIELVLPPHANHHGNTFGGQIMAWMETVATISA
3e29A           --------------------------------------------------------------------AG
3b7kC           ----------------------AAERRKVRLQHTSVQSIELVLPPHANHHGNTFGGQIMAWMETVATISA
2cyeA           --------------------------------------------------------------LARIRYFQ


                         .         .         *         .         .         .         .:140
query           YLMTRDGQCVVGTELNATHHRAVSQGKVRGVCLPLHLGRQNQSWEITLFDEQGRRCCTCRLGTAVMG
2b6eA           SLCLEEGKTVVGLDINANHLRPVRSGKVTARATPINLGRNIQVWQIDIRTEENKLCCVSRL------
2b6eD           SLCLEEGKTVVGLDINANHLRPVRSGKVTARATPINLGRNIQVWQIDIRTEENKLCCVSRL------
2b6eB           SLCLEEGKTVVGLDINANHLRPVRSGKVTARATPINLGRNIQVWQIDIRTEENKLCCVSRL------
3e1eC           FSLMEEEAAVLTVEFKVNFLNPAEGERFAFRAEVVKPGRTLTVATATAYAFRDGE------------
3e1eD           FSLMEEEAAVLTVEFKVNFLNPAEGERFAFRAEVVKPGRTLTVATATAYAFRDGE------------
2cy9A           T--------PGVSVDNITYSPAKIGEEIVITAHILKQGKTLAFASVDLTNKTGKLIAQGRHTKHL--
3e1eB           FSLMEEEAAVLTVEFKVNFLNPAEGERFAFRAEVVKPGRTLTVATATAYAFRDG-------------
3dkzB           AAIRGDTPEVGVATIDNTSFSPGRGD-LVIETRCLRRGASIAFCEGEIRDSAGELVAKAT-------
3e1eA           FSLMEEEAAVLTVEFKVNFLNPAEGERFAFRAEVVKPGRTLTVATATAYAFRDGE------------
3dkzA           AAIRGDTPEVGVATIDNTSFSPGRGD-LVIETRCLRRGASIAFCEGEIRDSAGELVAKATATFKII-
3e8pA           FAELQQRLQTLGTIDRVDYLRPGRGQIFTGTGSVIRAGNRVSVCRELHNEQ-GTHIAFGTG------
2av9A           LDIQGGEVIGLVVSSSCDYFAPVAFPQRIEGLRVARLGNSSVQYELALFLEGREACAAGRFVHVFV-
2cwzA           LPFLEEGEEGIGSYVEARHLASALPGRVRVVARHEKTEGNRVYARVEAYNELGDLIGVGRTEQVIL-
2cwzB           LPFLEEGEEGIGSYVEARHLASALPGRVRVVARHEKTEGNRVYARVEAYNELGDLIGVGRT------
2dslA           NTRGP----AVALSCRMDYFRPLGAGRVEARAVEVNLSRRTATYRVEVVSE-GKLVALFTG------
3e29B           DYAVALKTGHPVPTDHVDYHRVATPGDLRAEGQVIHFGKRFATAHARVLDD-GNLVASGRA------
2av9E           LDIQGGEVIGLVVSSSCDYFAPVAFPQRIEGLRVARLGNSSVQYELALFLEGREACAAGRFVHVFV-
3bbjB           HLHAVS--------SSYHFHRPASSGPAEIETRVLKRGRTVTTVQTTLFQE-GRTILTGTLATATL-
2av9B           LDIQGGEVIGLVVSSSCDYFAPVAFPQRIEGLRVARLGNSSVQYELALFLEGREACAAGRFVHVFV-
3bnvB           -----NKEFSVIIGSKCFFYAPLKLGDLELEAHALKKRDVKVVGHVKEIKFEGTIQVVSTDEHIFK-
3bbjA           HLHAVS--------SSYHFHRPASSGPAEIETRVLKRGRTVTTVQTTLFQE-GRTILTGTLATATLD
2av9G           LDIQGGEVIGLVVSSSCDYFAPVAFPQRIEGLRVARLGNSSVQYELALFLEGREACAAGRFVHVFV-
3e29D           DYAVALKTGHPVPTDHVDYHRVATPGDLRAEGQVIHFGKRFATAHARVLDD-GNLVASGRALYLI--
1c8uA           IGFLEPGIQIATIDHSMWFHRPFNLNELLYSVESTSASSARGFVRGEFYTQDGVLVASTVQEGVMR-
2cy9B           T--------EPGVSVDNITYSPAKIGEIVITAHILKQGKTLAFASVDLTNKTGKLIAQGRHTKHL--
3d6lA           ARELSPERVVTISMDKVVFKEPVFIGIISCYSKVVNVGNTSISVEVEVTAQRVDSQGCTSCINVTSA
2cyeD           ISPDWLEEGHFVVAREVDYLRPILLGEVFVGVRTVGLGRSSLREHLVTAN--GESAAKGLGVLVWL-
3b7kA           SRLCW-AHPFLKSVDMFKFRGPSTVGDLVFTAIVNNTFQTCVEVGVRVEAFDCQEWAE---------
3e29A           DYAVALKTGHPVPTDHVDYHRVATPGDLRAEGQVIHFGKRFATAHARVLDD-GNLVASGRALYLI--
3b7kC           -SRLCWAHPFLKSVDMFKFRGPSTVGRLVFTAIVNNTFQTCVEVGVRVEAFDCQEWAEGR-------
2cyeA           R-IDWLEEGHFVVAREVDYLRPILLGEVFVGVRTVGLGRSSLREHLVTAN--GESAAKGLGVLVWL-