[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for sent8:ACF67448.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2a3lA.bssp"
#ERROR : Can't open dsspfile "1ejuC.bssp"
#ERROR : Can't open dsspfile "2bb0A.bssp"
#ERROR : Can't open dsspfile "1ejrC.bssp"
#ERROR : Can't open dsspfile "3dugC.bssp"
#ERROR : Can't open dsspfile "1a5nC.bssp"
#ERROR : Can't open dsspfile "1a5lC.bssp"
#ERROR : Can't open dsspfile "3be7A.bssp"
#ERROR : Can't open dsspfile "1a5oC.bssp"
#ERROR : Can't open dsspfile "1a5kC.bssp"
#ERROR : Can't open dsspfile "3d6nA.bssp"
#ERROR : Can't open dsspfile "1ejxC.bssp"
#ERROR : Can't open dsspfile "3be7C.bssp"
#ERROR : Can't open dsspfile "1ejwC.bssp"
#ERROR : Can't open dsspfile "3dugA.bssp"
#ERROR : Can't open dsspfile "3be7B.bssp"
#ERROR : Can't open dsspfile "3e0lA.bssp"
#ERROR : Can't open dsspfile "1ejsC.bssp"
#ERROR : Can't open dsspfile "1a4mA.bssp"
#ERROR : Can't open dsspfile "3e74C.bssp"
#ERROR : Can't open dsspfile "3dc8B.bssp"
#ERROR : Can't open dsspfile "1a5mC.bssp"
#ERROR : Can't open dsspfile "1e9yB.bssp"
#ERROR : Can't open dsspfile "2aqvB.bssp"
#ERROR : Can't open dsspfile "2aqoA.bssp"
#ERROR : Can't open dsspfile "3e74B.bssp"
#ERROR : Can't open dsspfile "3dc8A.bssp"
#ERROR : Can't open dsspfile "3egjA.bssp"
#ERROR : Can't open dsspfile "3e74A.bssp"
#ERROR : Can't open dsspfile "1ejtC.bssp"
#ERROR : Can't open dsspfile "2aqvA.bssp"
#ERROR : Can't open dsspfile "3egjB.bssp"
#ERROR : Can't open dsspfile "2amxA.bssp"
#ERROR : Can't open dsspfile "2aqoB.bssp"
#ERROR : Can't open dsspfile "1e9zB.bssp"
#ERROR : Can't open dsspfile "2amxB.bssp"
#ERROR : Can't open dsspfile "3c86A.bssp"
#ERROR : Can't open dsspfile "3e3hA.bssp"
#ERROR : Can't open dsspfile "1cr5A.bssp"
#ERROR : Can't open dsspfile "2d2gA.bssp"
#ERROR : Can't open dsspfile "1bf6A.bssp"
#ERROR : Can't open dsspfile "1dpmA.bssp"
#ERROR : Can't open dsspfile "2bb0A.bssp"
#ERROR : Can't open dsspfile "3d6nA.bssp"
#ERROR : Can't open dsspfile "1a4mA.bssp"
#ERROR : Can't open dsspfile "1e9yB.bssp"

## Summary of PDB Search
:566
    2e-16  10%  2a3lA  [x.x.x] AMP DEAMINASE
    2e-14  19%  1ejuC  [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
    2e-12  15%  2bb0A  [x.x.x] IMIDAZOLONEPROPIONASE
    2e-12  19%  1ejrC  [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
    4e-12  15%  3dugC  [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE
    4e-12  20%  1a5nC  [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)
    5e-12  32%  1a5lC  [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)
    5e-12  16%  3be7A  [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE
    6e-12  19%  1a5oC  [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)
    6e-12  20%  1a5kC  [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)
    8e-12  20%  3d6nA  [x.x.x] DIHYDROOROTASE
    1e-11  21%  1ejxC  [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
    1e-11  13%  3be7C  [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE
    2e-11  19%  1ejwC  [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
    2e-11  18%  3dugA  [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE
    4e-11  16%  3be7B  [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE
    9e-11  16%  3e0lA  [x.x.x] GUANINE DEAMINASE
    1e-10  18%  1ejsC  [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
    1e-10  13%  1a4mA  [c.1.9] ADENOSINE DEAMINASE
    3e-10  15%  3e74C  [x.x.x] ALLANTOINASE
    4e-10  18%  3dc8B  [x.x.x] DIHYDROPYRIMIDINASE
    2e-09  20%  1a5mC  [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)
    2e-09  13%  1e9yB  [b.92.1 - c.1.9] UREASE BETA SUBUNIT
    2e-09  12%  2aqvB  [x.x.x] ISOASPARTYL DIPEPTIDASE
    3e-09  16%  2aqoA  [x.x.x] ISOASPARTYL DIPEPTIDASE
    4e-09  16%  3e74B  [x.x.x] ALLANTOINASE
    5e-09  23%  3dc8A  [x.x.x] DIHYDROPYRIMIDINASE
    1e-08  18%  3egjA  [x.x.x] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE
    2e-08  17%  3e74A  [x.x.x] ALLANTOINASE
    3e-08  20%  1ejtC  [b.92.1 - c.1.9] UREASE ALPHA SUBUNIT
    3e-08  15%  2aqvA  [x.x.x] ISOASPARTYL DIPEPTIDASE
    5e-08  14%  3egjB  [x.x.x] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE
    7e-08  12%  2amxA  [x.x.x] ADENOSINE DEAMINASE
    7e-08  16%  2aqoB  [x.x.x] ISOASPARTYL DIPEPTIDASE
    7e-07  21%  1e9zB  [b.92.1 - c.1.9] UREASE BETA SUBUNIT
    2e-06  14%  2amxB  [x.x.x] ADENOSINE DEAMINASE
    8e-06  24%  3c86A  [x.x.x] PHOSPHOTRIESTERASE
    9e-06  23%  3e3hA  [x.x.x] PARATHION HYDROLASE
    1e-05   9%  1cr5A  [b.52.2 - d.31.1] SEC18P (RESIDUES 22 - 210)
    2e-05  21%  2d2gA  [x.x.x] PHOSPHOTRIESTERASE
    2e-05  10%  1bf6A  [c.1.9] PHOSPHOTRIESTERASE HOMOLOGY PROTEIN
    1e-04  16%  1dpmA  [c.1.9] PHOSPHOTRIESTERASE
    7e-07  31%  2bb0A  [x.x.x] IMIDAZOLONEPROPIONASE(query 32->104)
    1e-07  12%  3d6nA  [x.x.x] DIHYDROOROTASE(query 251->561)
    1e-05   7%  1a4mA  [c.1.9] ADENOSINE DEAMINASE(query 37->185)
    2e-06  25%  1e9yB  [b.92.1 - c.1.9] UREASE BETA SUBUNIT(query 32->111)
:566

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDIILHNGNIITLNDAQPQASALAISGSRIVAIGDDTATD
2a3lA           ----------------------------------------------------------------------
1ejuC           -------------------------------DLVLTNALIVDHW--GIVKADIGVKDGRIFAIGKAGNPD
2bb0A           ----------------------------------------------------------------------
1ejrC           -------------------------------DLVLTNALIVD--HWGIVKADIGVKDGRIFAIGKAGNPD
3dugC           -------------------------------DFLIKSKGYLDIQTGEIIKADLLIRNGKIAEIGKI----
1a5nC           -------------------------------DLVLTNALIVD--HWGIVKADIGVKDGRIFAIGKAGNPD
1a5lC           -------------------------------DLVLTNALIVD--HWGIVKADIGVKDGRIFAIGKAGNPD
3be7A           -------------------------------DFLIKSKGYLDIQTGEIIKADLLIRNGKIAEIGKINTKD
1a5oC           -------------------------------DLVLTNALIVD--HWGIVKADIGVKDGRIFAIGKAGNPD
1a5kC           -------------------------------DLVLTNALIVD--HWGIVKADIGVKDGRIFAIGKAGNPD
3d6nA           -------------------------------KLIVKNGYVIDPSQNLEGEFDILVENGKIKKID-----K
1ejxC           -------------------------------DLVLTNALIVD--HWGIVKADIGVKDGRIFAIGKAGNPD
3be7C           -------------------------------DFLIKSKGYLDIQTGEIIKADLLIRNGKIAEIGKI----
1ejwC           -------------------------------DLVLTNALIVDHWGIVKAD--IGVKDGRIFAIGKAGNPD
3dugA           -------------------------------DFLIKSKGYLDIQTGEIIKADLLIRNGKIAEIGKIN---
3be7B           -------------------------------DFLIKSKGYLDIQTGEIIKADLLIRNGKIAEIGKI----
3e0lA           -------------------------------AHIFRGTFVHSTWTCPRDHLLGVSDSGKIVFLEEASQQE
1ejsC           -------------------------------DLVLTNALIVD--HWGIVKADIGVKDGRIFAIGKAGNPD
1a4mA           ----------------------------------------------------------------------
3e74C           -------------------------------DLIIKNGTVIL--ENEARVVDIAVKGGKIAAIGQDLGDA
3dc8B           --------------------------------TVIKGGTIVT--ADLTYKADVKVEGGRIVEIGPN----
1a5mC           -------------------------------DLVLTNALIVD--HWGIVKADIGVKDGRIFAIGKAGNPD
1e9yB           ----------------------------------------------------------------------
2aqvB           -------------------------------FTLLQGAHLYA--PEDRGICDVLVANGKIIAVAS--NIP
2aqoA           -------------------------------FTLLQGAHLYA--PEDRGICDVLVANGKIIAVAS--NIP
3e74B           -------------------------------DLIIKNGTVIL--ENEARVVDIAVKGGKIAAIGQDLGDA
3dc8A           --------------------------------TVIKGGTIVT--ADLTYKADVKVEGGRIVEIGPN----
3egjA           -------------------------------MYALTNCKIYTGNDVLVKH-AVIINGDKIEAVCPIESLP
3e74A           -------------------------------DLIIKNGTVIL--ENEARVVDIAVKGGKIAAIGQD----
1ejtC           -------------------------------DLVLTNALIVD--HWGIVKADIGVKDGRIFAIGKAGNPD
2aqvA           -------------------------------FTLLQGAHLYA--PEDRGICDVLVANGKIIAVASNIPSD
3egjB           -------------------------------MYALTNCKIYTGNDVLVKH-AVIINGDKIEAVCPIES--
2amxA           ----------------------------------------------------------------------
2aqoB           -------------------------------FTLLQGAHLYA--PEDRGICDVLVANGKIIAVAS--NIP
1e9zB           -------------------------------DLIITNALIVDIKDGKGKGGNKDMQDGVKNNLSVGPATE
2amxB           ----------------------------------------------------------------------
3c86A           ----------------------------------------------------------------------
3e3hA           ----------------------------------------------------------------------
1cr5A           -------------------------------SYALANVAAVSPNDFPN-NIYIIIDNLFVFTTRHS---N
2d2gA           ----------------------------------------------------------------------
1bf6A           ----------------------------------------------------------------------
1dpmA           ----------------------------------------------------------------------
2bb0A           -------------------------------TILINIGQLLTMESSGPRAGVVGIHEQKIVFAGQKGAEA
3d6nA           ----------------------------------------------------------------------
1a4mA           ------------------------------------NKPKVELHDGAIKPETILYFGKKRGIALPA----
1e9yB           -------------------------------DLIITNALIVDIKDGKGKGGNKDMQDGVKNNLSVGPATE


                         .         .         *         .         .         .         .:140
query           EWRGDHTRTIDLQGKTVIPGLTDTHIHAIRGGQTWTFETYWYDSPSLKDALDKLRADANRRPHDQWVAVV
2a3lA           ----------------------------------------------------------------------
1ejuC           IQIGAATEVIAAEGKIVTAGGIDTHIHWICPQQA------------------------------------
2bb0A           -------------------------------------------------------------MESSGPRAG
1ejrC           IQIGAATEVIAAEGKIVTAGGIDTHIHWICPQQA------------------------------------
3dugC           --NTKDATVISIPDLILIPGLMDSHVHI--VGNDSKGEESIADSSHMGTVWGVVNAEKTLMAGFTTVRNV
1a5nC           IQIGAATEVIAAEGKIVTAGGIDTHIHWICPQQA------------------------------------
1a5lC           IQIGAATEVIAAEGKIVTAGGIDTHIHWICPQQAEEA---------------------------------
3be7A           ------ATVISIPDLILIPGLMDSHVHIVGNDSKGEESIADSSHMGTVWGVVNAEKTLMAGFTTVRNVGA
1a5oC           IQIGAATEVIAAEGKIVTAGGIDTHIHWICPQQA------------------------------------
1a5kC           IQIGAATEVIAAEGKIVTAGGIDTHIHWICPQQA------------------------------------
3d6nA           NILVPEAEIIDAKGLIVCPGFIDIHVHLRDPGQTYKEDIESGSRCAVAGGFTTIVCMPNTNPPIDNTTVV
1ejxC           IQIGAATEVIAAEGKIVTAGGIDTHIHWICPQQA------------------------------------
3be7C           --NTKDATVISIPDLILIPGLMDSHVHIVGNDSKGEESIADSSHMGTVWGVVNAEKTLMAGFTTVRNVGA
1ejwC           IQIGAATEVIAAEGKIVTAGGIDTHIHWICPQQA------------------------------------
3dugA           ---TKDATVISIPDLILIPGLMDSHVHIVGND--SKGEESIADSSHMGTVWGVVNAEKTLMAGFTTVRNV
3be7B           --NTKDATVISIPDLILIPGLMDSHVHIVGNDSKGEESIADSSHMGTVWGVVNAEKTLM--AGFTTVRNV
3e0lA           KLFKPCEIRELSHHEFFMPGLVDTHIHASQYSFAGS----SIDLPLLEWLTKYTFPAEHRFQNIDFAEEV
1ejsC           IQIGAATEVIAAEGKIVTAGGIDTHIHWICPQQA------------------------------------
1a4mA           ----------------------------------------------------------------------
3e74C           K--------EVDASGLVVSPGVDAHTHIYETGTRAAEPLNQLPATVDRASIELKFDAAKGKLTIDAAQLG
3dc8B           ---LSGAETLDATGCYVMPGGIDPHTHLEMPFMGTYSSDDFE----------------------------
1a5mC           IQIGAATEVIAAEGKIVTAGGIDTHIHWICPQQA------------------------------------
1e9yB           ----------------------------------------------------------------------
2aqvB           SDIVPNCTVVDLSGQILCPGFIDQHVHLIGGGGEAGP---------------------------------
2aqoA           SDIVPNCTVVDLSGQILCPGFIDQHVH-LIGGGGQAGPTTRTPEVALSRLTEAGVTSVVGLLGTDSISRH
3e74B           K--------EVDASGLVVSPGVDAHTHISHWEGYETGTRAA-----------------------------
3dc8A           ---LSGAETLDATGCYVMPGGIDPHTHLEMPFMGTYSSDDF-----------------------------
3egjA           S----EMNVVDLNGANLSPGFIDLQLN-GCGGVMFNDEITAETIDTMHKANLKSGCTSFLPTLITSSDEN
3e74A           ---LGDAKEVDASGLVVSPGVDAHTHAAAKGGITTIEPLNQLPATVDRASIELKAAKGKLTIDAAQLGGL
1ejtC           IQIGAATEVIAAEGKIVTAGGIDTHIHWICPQQA------------------------------------
2aqvA           I--VPNCTVVDLSGQILCPGFIDQHVHLIGGGGEAGPTTRTPEV--------------------------
3egjB           --LPSEMNVVDLNGANLSPGFIDLQLNGC-----GGVMFNDEITAETIDTMHKANLKS------------
2amxA           ----------------------------------------------------------------------
2aqoB           SDIVPNCTVVDLSGQILCPGFIDQHVHLIGGGGQAGPTTRTPEV--------------------------
1e9zB           --------ALAGEGLIVTAGGIDTHIHFISPQQIPTAFASG-----------------------------
2amxB           ----------------------------------------------------------------------
3c86A           ---GDLINTVRGPIPVSEAGFTLTHEHICGSSAGFLR---------------------------------
3e3hA           ---GDRINTVRGPITISEAGFTLTHEHIC-----GSSAGFLRAWPEFFGSRKALAEKAVR----------
1cr5A           DIPPGTIGFNGNQRTWGGWSLNQAFDLFKYSGDIDISFRAVFDQDELAKQFVR--CYESQIFSPTQYLIM
2d2gA           ---GDLINTVRGPIPVSEAGFTLTHEHICGSSAGFLRAWPEF----------------------------
1bf6A           ----------------------------------------------------------------------
1dpmA           -----RINTVRGPITISEAGFTLTHEHIC-----GSSAGFLRAWPEFFGSRKALAEKALRRARAAGVRTI
2bb0A           GY--EADEIIDCSGRLVTPGLVDPHTHLVFGGSR------------------------------------
3d6nA           ----------------------------------------------------------------------
1a4mA           DTVEELRNIIGMDKPLSLPGFLAKFDYYMPVIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANS
1e9yB           A--------LAGEGLIVTAGGIDTHIHFISPQQIPTAFASG-----------------------------


                         +         .         .         .         .         *         .:210
query           GSWIPAQFAENRAPTVAELSHALPDHPAYIQYLYDYALVNQRGIDVLGLNDTPPPDLAGIGVERDAKGSA
2a3lA           ----------------------------------------------------------------------
1ejuC           ----------------------------------------------------------------------
2bb0A           KSMQDLHVIEDAVVGIHEQKGAEAGYEADEIIDCSGRLVTPGLVDP----HTHLVFGGSREKEMNLKLQG
1ejrC           ----------------------------------------------------------------------
3dugC           GAANYADVSVRDAIERGVINGPTMLVSGPA----------------------------------------
1a5nC           ----------------------------------------------------------------------
1a5lC           ----------------------------------------------------------------------
3be7A           ANYADVS---------------------------------------------------------------
1a5oC           ----------------------------------------------------------------------
1a5kC           ----------------------------------------------------------------------
3d6nA           NYIL------------------------------------------------------------------
1ejxC           ----------------------------------------------------------------------
3be7C           ANYA--DVSVRDAIERGVINGPTMLVSGP-----------------------------------------
1ejwC           ----------------------------------------------------------------------
3dugA           GAANYADVSVRDAIERGVINGPTMLVSGP-----------------------------------------
3be7B           GAANYADVSVRDAIERGVINGPTMLVSGP-----------------------------------------
3e0lA           YTRVVRRTLKNGTTTACYFATIHTDSS-------------------------------------------
1ejsC           ----------------------------------------------------------------------
1a4mA           ----------------------------------------------------------------------
3e74C           GSYNIDRLHELDEVGVVGFCFVRDVNDWQFFKGAQKL---------------------------------
3dc8B           ----------------------------------------------------------------------
1a5mC           ----------------------------------------------------------------------
1e9yB           -------------------------------------------------------------KNNLSVGPA
2aqvB           ----------------------------------------------------------------------
2aqoA           PESLLAKTRALNE---------------------------------------------------------
3e74B           ----------------------------------------------------------------------
3dc8A           ----------------------------------------------------------------------
3egjA           MRQAIAAARE------------------------------------------------------------
3e74A           VSYNIDRLHELDEVGVVGFCFVRDVNDWQFFKGAQK----------------------------------
1ejtC           ----------------------------------------------------------------------
2aqvA           ----------------------------------------------------------------------
3egjB           --GCTSFLPTLITSSDENMRQAIAAAREYQAKYPNQSLGLHLEGPDDTMIDTICANSDVIAKVTLAPENN
2amxA           ----------------------------------------------------------------------
2aqoB           ----------------------------------------------------------------------
1e9zB           ----------------------------------------------------------------------
2amxB           ----------------------------------------------------------------------
3c86A           ----------------------------------------------------------------------
3e3hA           ----------------------------------------------------------------------
1cr5A           EFQGHF----------------------------------------------------------------
2d2gA           ----------------------------------------------------------------------
1bf6A           ----------------------------------------------------------------------
1dpmA           VDVSTFDIGRD-VSLLAEVSRAADVH-----------IVAATGLWFDPPLSMRLRSVEELTQFFLREIQY
2bb0A           ----------------------------------------------------------------------
3d6nA           ----------------------------------------------------------------------
1a4mA           KVDPMPWNQTEGDVTPDDVVDLVNQGLQEGEQAFGIKVRSILCCM-------------------------
1e9yB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           TGKLFGDIAAFNQLFASISSNADREGGLRQFFADMNARGVTGIIDPSAGPAAAYEPLFAMRNQGDLPLRV
2a3lA           ----------------------------------------------------------------------
1ejuC           ----------------------------------------------------------------------
2bb0A           IILAQGGGILSTVKDTRAASEEELLQKAHFHLQRMLSYGTTTAEVKSGYGLEKETELKQLRVAKKLHESQ
1ejrC           ----------------------------------------------------------------------
3dugC           ----------------------------------------------------------------------
1a5nC           ----------------------------------------------------------------------
1a5lC           ----------------------------------------------------------------------
3be7A           ----------------------------------------------------------------------
1a5oC           ----------------------------------------------------------------------
1a5kC           ----------------------------------------------------------------------
3d6nA           ----------------------------------------------------------------------
1ejxC           ----------------------------------------------------------------------
3be7C           ----------------------------------------------------------------------
1ejwC           ----------------------------------------------------------------------
3dugA           ----------------------------------------------------------------------
3be7B           ----------------------------------------------------------------------
3e0lA           ----------------------------------------------------------------------
1ejsC           ----------------------------------------------------------------------
1a4mA           -----------------------------EFVEMKAKEGVVYVEVYSPHLLANSKVDPMPWNQTEGDVTP
3e74C           ----------------------------------------------------------------------
3dc8B           ----------------------------------------------------------------------
1a5mC           ----------------------------------------------------------------------
1e9yB           TEALAGETAGGIDTHIHFISPQQIPTAFASGVTTMIGGGTGPADGTNATTITPGRRNLKWMLRAAEEYSM
2aqvB           ----------------------------------------------------------------------
2aqoA           ----------------------------------------------------------------------
3e74B           ----------------------------------------------------------------------
3dc8A           ----------------------------------------------------------------------
3egjA           ----------------------------------------------------------------------
3e74A           ----------------------------------------------------------------------
1ejtC           ----------------------------------------------------------------------
2aqvA           ----------------------------------------------------------------------
3egjB           KPEHIEKLVKAGIVVSIGHTNATYSEARKSFESGITFATLFNAMTPMVGREPGVVGAIYDTPEVYAGIIA
2amxA           -----------------------------------------------------KWAVIEKYKEGVVLMEF
2aqoB           ----------------------------------------------------------------------
1e9zB           ----------------------------------------------------------------------
2amxB           ----------------------------------------------------------------------
3c86A           ----------------------------------------------------------------------
3e3hA           ----------------------------------------------------------------------
1cr5A           ----------------------------------------------------------------------
2d2gA           ----------------------------------------------------------------------
1bf6A           ----------------------DQYAFICQEMNDLMTRGVRNVIEMTNRYMGRNAQFML-----DVMRET
1dpmA           GIEDTGIRAGIIKVATTGKATPFQELVLKAAARASLATGVPVTTHTAASQRDGEQQAAIFESEGLSPSRV
2bb0A           ----------------------------------------------------------------------
3d6nA           ----------------------------------------PNTNPPIDNTTVVNYILQKSKSVGLCRVLP
1a4mA           ----------------------------------------------------------------------
1e9yB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GYRIPVQPEAKGHEAQWFSNLMAFRPARADDGQLAFLGLGESLVAGMNDGVRMAPGFSSSDQDKTALRQV
2a3lA           ------------------------------------------------------------------LNKL
1ejuC           -----------------------------------------------------------------AIDCA
2bb0A           PVDLVSTFMGAHAIPPEYQNDPDDFLDQMLSLLPEIKEQELASFADIFTETGVFTV--------SQSRRY
1ejrC           -----------------------------------------------------------------AIDCA
3dugC           -------------------------------------------------------------------KAI
1a5nC           ------------------------------------------------------------------IDCA
1a5lC           ----------------------------------------------------------------------
3be7A           -----------------------------------------------------------------EMKAI
1a5oC           ----------------------------------------------VAAGVIGLCIHEDWGATPAAIDCA
1a5kC           ----------------------------------------------VAAGVIGLEIHEDWGATPAAIDCA
3d6nA           ----------------------------------------------------------------------
1ejxC           --------------------------------------------------------------LNESGFVE
3be7C           -------------------------------------------------------------------KAI
1ejwC           -----------------------------------------------------------------AIDCA
3dugA           ----------------------------------------------------------------------
3be7B           -----------------------------------------------------------------EMKAI
3e0lA           -----------------------------------------------------------------LMGEL
1ejsC           ----------------------------------------------------HSDTLNESGFVEDTLAAI
1a4mA           DDVVDLVNQGLQEGEQAFGIKVRSILCCMRHQPSWSLEVLELCKKYNQKTVVAMDLAGDETIEGSGHVEA
3e74C           -----------------------------------------------------------------AIRRV
3dc8B           ----------------------------------------------------------------------
1a5mC           ----------------------------------------------VAAGVIGLAIHEDWGATPAAIDCA
1e9yB           NLGFLAKGNASNDASLADQIEAGAIGFIHEDWGTTPSAINHALDVADKYDVQVAIHTDTLNE---AGCVE
2aqvB           ----------------------------------------------------------------------
2aqoA           ----------------------------------------------------------------------
3e74B           ------------------------------------------------------------------IRRV
3dc8A           ----------------------------------------------------------------------
3egjA           -----------------------------------------------------------------ATYSE
3e74A           ----------------------------------------------------------------------
1ejtC           -----------------------------------------------------------------AIDCA
2aqvA           -----------------------------------------------------------------AESRV
3egjB           DGFHVDYANIRIAHKIKGEKLVLVTDATAPAGAEMDYFIFVGKKVYYRDGKCVDENGTLGGSALTMIEAV
2amxA           RYSPTFVSSSYGLDVELIHKAFIKGIKNATELLNNKIHVALIGDFAIKHKHDFVGFDHGGREIDLKHKDV
2aqoB           -------------------------------------------GVCAISDHRSAAPDVYHLANMAAESRV
1e9zB           ----------------------------------------------------------------------
2amxB           -------------------------------------------------------------------KDV
3c86A           ----------------------------------------------------------------------
3e3hA           ----------------------------------------------------------------------
1cr5A           ----------------------------------------------------------------------
2d2gA           ----------------------------------------------------------------------
1bf6A           GINVVACTGYYQDAFFPEHVATRSVQELAQEMDEIEQGIDGTELKAGIIAEIGTSEGKITPLEEKVFIAA
1dpmA           C---------------------------------------------------------------------
2bb0A           ----------------------------------------------------------------------
3d6nA           TGTITKGRKGKEIADFYSLKEAGCVAFTDDGSPVMD-------SSVMRKALELASQLGVPIMDHCEDDKL
1a4mA           ----------------------------------------------------------------------
1e9yB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           ATFAAKRGIPLEIHAYTDDSADAILTIFEQVAQQYDLRPLRWSIAHLNTGSPQTLERMRKLGLAYTVQMG
2a3lA           RESKGMTTITLRPHSGEAGDIDHLA--------ATFLTCHSIAHGINLRKSPVLQYLYYLAQIGLAMSP-
1ejuC           LTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHT---FHTEGAGGGHAPDIITACAHPNILPSSTN
2bb0A           LQKAAEAGFGLKIHADEIDPLGGAELAG---------KLKAVSADHLVGTSDEGIKKLAEAGTIAVLLPG
1ejrC           LTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFH---TEGAGGGHAPDIITACAHPNILPSSTN
3dugC           VDEAHNHGMKVAAHAHGLIGIKAAIKAGVDSVEHASF--IDDETIDMAIKNNTVLSMDIFVSDYILGEGA
1a5nC           LTVADEMDIQVALHSDTLNESGFVEDTL---AAIGGRTIHTFHTEGAGGGHAPDIITACAHPNILPSSTN
1a5lC           ----------------------------------------------------------------------
3be7A           VDEAHNHGMKVAAHAHGLIGIKAAI------------KAGVDSVEHASFIDDETIDMAIKNNLSMDIFVS
1a5oC           LTVADEMDIQVALHS---DTLNESGFVEDTLAAIGGRTIHTFHTEGAGGGAPDIITACAHPNILPSSTNP
1a5kC           LTVADEMDIQVALHS---DTLNESGFVEDTLAAIGGRTIHTFHTEGAGGGHPDIITACAHPNILPSSTNP
3d6nA           ----------------------------------------------------------------------
1ejxC           DTLAAIGGRTIHTFHTEGAGGGHAPDIITACAHPNILPS---STNPTLPYTLNTIDEHLDMLMVCV--AF
3be7C           VDEAHNHGMKVAAHAHGLIGIKAAIKAGVDSVEHASF----IDDETIDMAIKNNTVLSMDIFVSDYILGE
1ejwC           LTVADEMDIQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGGGHAPDIITACAHPNILPSSTNPTLID
3dugA           ----------------------------------------------------------------------
3be7B           VDEAHNHGMKVAAHAHGLIGIKAAIASFIDDETIDMAIKNNTVLSMDIFVSDYILGEGAKAGIREESLNK
3e0lA           GNIAKTRDLHIQSHISENRDEVEAVKNLYSVYDKNNLLTNKTVMAHGCYLSAEELNVFHERGASIAHC--
1ejsC           GGRTIHTFHTEGAGGGAPDIITACAHPNILPSSTNPTLP-YTLNTIDEHLDMLMVCHHLDPDIAEDVAFA
1a4mA           YEGAVKNGIHRTVHAGEVGS------PEVVREAVDILKTERVGHGYHTIEDEALYNRLLKENMHFEVCPW
3e74C           LYLAKVAGCRLHVCHVSSPEGVEEV-------TRARQEGQDITCESCPHYFVLDTDQFEEIG--------
3dc8B           -----------CPVYIVHTSCEQAHEAIRRARAKGMRVFGEPLIQHLTLDETEYFDKDWDHAARRVMSPP
1a5mC           LTVADEMDIQVALHSDTLNESGFV---EDTLAAIGGRTIHTFHTEGAGGGAPDIITACAHPNILPSSTID
1e9yB           DTMAAIAGRTMHTFHTEGAGGGHAPDIIKVAGEHNILPTIPFTVNTEAEHMDMLMVCHHKDKSIKEDVQF
2aqvB           ----------------------------SRVGGLLGGKPGVTVFHMGDSKKALQPIYDLLENCDVPISKL
2aqoA           ----------------------------------------------------------------------
3e74B           LYLAKVAGCRLHVCHVSSPEGVEEV-------TRARQEGQDITCESCPHYFVLDTDQFEEIGTLAKC---
3dc8A           ----------------------------------------------------------------------
3egjA           ARKSFESGITFATHLFNAMTPMVGREPGVVGAIYDTPEVYAGIIADGFHVDYANIRIAHKIK-------G
3e74A           --------------------------------------------HVSSPEGVEEVTRARQEGQDITCESC
1ejtC           LTVADEMDIQVALHSDTLN---ESGFVEDTLAAIGGRTIHTFHTEGAGGGAPDIITACAHPNILPSSTNP
2aqvA           GGLLGGKPGVTVFHMGDSKKALQPIYDLLENCDVPI--SKLLPTHVNRNVPLFEQALEFARK--------
3egjB           QNTVEHVGIALDLRMATLYPAKAI----------------------------------------------
2amxA           YHSVRDHGLHLTVHAGEDA---TLPNLNTLYTAINILNVERIGHGIRVSESDELIELVKKKDILLEVCPI
2aqoB           GGLLGGKPGVTVFHMGDSKKA-------------------LQPIYDLLENCDVPISKLLPTHVNRNVPLF
1e9zB           ----------------------------------------------------------------------
2amxB           YHSVRDHGLHLTVHAG---EDATLPNLNTLYTAINILNVERIGHGIRVSESDELIELVKKKDILLEVCPI
3c86A           ----------------------------------------------------------------------
3e3hA           ----------------------------------------------------------------------
1cr5A           ----------------------------------------------------------------------
2d2gA           ----------------------------------------------------------------------
1bf6A           ALAHNQTGRPISTHTSFSTMGLEQL---ALLQAHGVDLSRVTVGHCDLKDNLDNILKMIDLGAYVQFDTI
1dpmA           ----------------------------------------------------------------------
2bb0A           ----------------------------------------------------------------------
3d6nA           AYGVINEGEVSALLGLSSRAPEAEEIQIARDGILAQRTGGHVHIQHVSTKLSLEIIEFFKEGVKITCEVN
1a4mA           ----------------------------------------------------------------------
1e9yB           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           PYFEGLAIRDANPPGATDNSPPVRLALDKGLVVAGGTDSTRIGIAGVWHAIEYHITGIASGGSVRKPASE
2a3lA           -----------------LSNNSLFLDYHRNPFPVFFLRGLNVSLST-DDPLQIHLTKEPLVEEYSIAASV
1ejuC           PTLNTIDEHLDFAEIRRETIAAEDVLHDLGAFSLTSSDSQA----MGRVGEVILRTWQVAHRMKVQRGND
2bb0A           T----------TFYLGKSTYARARAMIDEGVCVSLATDFNPGSSPTENIQLIMS----------IAALHL
1ejrC           PTLNTIDEHLDFAEIRRETIAAEDVLHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQREETGDND
3dugC           KAGIREESLNKERLVGKKQRENFMNAHRRGAIITFGTDAGIFDHGDNAKQFAYMVEWG------------
1a5nC           PTLPHLDMAFAESRIRRETIAAEDVLHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQREETGDND
1a5lC           ----------------------------------------------------------------------
3be7A           DYILGEGAKAGIREESLNKEENFMNAHRRGAIITFGTDAGIFDHGDNAKQFAYMVEW-------------
1a5oC           TLPYTLNTIDEHLDMLMETIAAEDVLHDLGAFSLTSSDSQAMGRVGEVILRTWQVAHRMKVQREETGDND
1a5kC           TLPYTLNTIDEHLDMLMETIAAEDVLHDLGAFSLTSSDSQAMGRVGTWQVAHRMKVQRGALAE-ETGDND
3d6nA           ----------------------------------------------------------------------
1ejxC           AESRIRRETIA----------AEDVLHDLGAFSLTSSDSQAMGRVGEVIL--RTWQVAHRMKVQRGALAE
3be7C           GAKAGIREESLNKERLVGKKENFMNAHRRGAIITFGTDAGIFDHGDNAKQFAYMVEW-------------
1ejwC           EHLDMLMVCHHLDPDIAETIAAEDVLHDLGAFSLTSSDSAMGRVGEVILRTWQVAHRMKVQRGAETGDND
3dugA           --------------------ENFMNAHRRGAIITFGTDAGIFDHGDNAKQFAYMVEWG------------
3be7B           ----------ERLVGKKQR-ENFMNAHRRGAIITFGTDAGIFDHGDNAKQFAYMVEWG------------
3e0lA           ---------PNSNLSLSSGFLNVLEVLKHEVKIGLGTDVAGGYSYSMLDAIRRAVMVSNILL-INKVNEK
1ejsC           ESRI-----------RRETIAAEDVLHDLGAFSLTSSDSQAMVILRTWQVAHRMKVQRGALA-EETGDND
1a4mA           SSYLTGAWDP-------KTTHAVVRFKNDKANYSLNTDDPLIFKSTLDTD-------------YQMTKKD
3e74C           ------TLAKCSPPIRDLENQKGWEKLFNGEIDCLVSDHSPCPPEKAGNIKAWGGIAGLQSCDVFDEAV-
3dc8B           FRNK-------------LHQDSLWAGLASGSLQVVATDHCGVGDFTRIPNGTGGLEDRMPMLWTYGVATG
1a5mC           EHLDMLMVCHHLDPDIAETIAAEDVLHDLGAFSLTSSDSQAEVILRTWQVAHRMKVQRGALAEETGDN-D
1e9yB           ADSRIRPQTIA----------AEDTLHDMGAFSITSSDSQAMGRVGEVITRTWQTADKNKKEFGRLKEED
2aqvB           LPTHVNRNVPLFEQALEFARKGGTIDITSSIDEPVAPAEGIARAVQAGIPLARVTLSSDGNGSQVLVKDY
2aqoA           ----------------------------------------------------------------------
3e74B           -----------SPPIRDLENQKGWEKLFNGEIDCLVSDHSPCPPEKAGNIKAWGGIAGLQSC-DVFDEAV
3dc8A           ----------------------------------------------------------------------
3egjA           EKLVLVTDATAPAGAEMDYFIFVGKKVYYRDGKCVDENGTLGGSALTMIEAVQNT-----------VEHV
3e74A           PHYFVLDTDQCSPPIRDLENQKGWEKLFNGEIDCLVSDHSPCPPEKAGNIKAWGGIAGLQSCDVFDEA-V
1ejtC           TLPYTLNTIDAFAESRIRREAAEDVLHDLGAFSLTSSDSAMGRVGEVILRTWQVAHRMKVQRGAETGDND
2aqvA           ---GGTIDITSSIDEPVAPAEGIARAVQAGIPLARVTLSSDGNGGVAGFETLLETVQVLV-------KDY
3egjB           ----------------------------------------------------------------------
2amxA           SNLLLNNVKS-------MDTHPIRKLYDAGVKVSVNSD----DPGMFLSNINDNY---------EKLYIH
2aqoB           EQALEFARKGGTIDITSSIDEGIARAVQAGIPLARVTLSSDGNGSVAGFETLLET--------VQVLVKD
1e9zB           ---------------------AEDTLHDMGAFSITSSDSQ----AMGRVGEVITRTWQTADKNKKEFGRD
2amxB           -------SNLLLNNVKSMDTHPIRKLYDAGVKVSVNSD----DPGMFLSNINDNYEKLYIHL--------
3c86A           ----------------------------------------------------------------------
3e3hA           ----------------------------------------------------------------------
1cr5A           ----------------------------------------------------------------------
2d2gA           ----------------------------------------------------------------------
1bf6A           GKN-------------------------------------------------------------------
1dpmA           ----------------------------------------------------------------------
2bb0A           ----------------------------------------------------------------------
3d6nA           PNHREVLNSGANPLRKKEDRLALIEGVKRGIIDCFATDHAP-HQTFEKELVEFAMPGIIGLQTLELYRKG
1a4mA           ----------------------------------------------------------------------
1e9yB           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           RLTRLEALALYTRHAAWLAFAEQHRGQLSVGKQADLAVLNQPFMTMPEDRIDTIRAVLTLVDGRIVHESP
2a3lA           WKLSACDLCEIARNSVYQSGFSHALKSHWIGKDYYKRGPDNDIHKTNVPHIRVEEMQQVYLGKAVISD--
1ejuC           NFRVKRYIAKYTINPALTHGIAHEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIP
2bb0A           KMTAEEIWHAVTVNAAYAIGKGEEAGQLKAGRSADLVIWQAPNYMYIPYHYGVNHVHQVMKNGTIVVN--
1ejrC           NFRVKRYIAKYTINPALTHGIAHEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIP
3dugC           -MTPLEAIQASTIKTAT-LFGIENIGQIKEGFDADIVGVIENPL---ANIRTLEEVAFVMKEGKVY----
1a5nC           NFRVKRYIAKYTINPALTHGIAHEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIP
1a5lC           ----------------------------------------------------------------------
3be7A           GMTPLEAIQASTIKTAT-LFGIENIGQIKEGFDADIVGVI---ENPLANIRTLEEVAFVMKEGKVYKR--
1a5oC           NFRVKRYIAKYTINPALTHGIAHEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIP
1a5kC           NFRVKRYIAKYTINPALTHGIAHEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIP
3d6nA           ----------------------------------------------------------------------
1ejxC           EFRVKRYIAKYTINPALTHGIAHEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIP
3be7C           GMTPLEAIQASTIKTATL-FGIENIGQIKEGFDADIVGVI---ENPLANIRTLEEVAFVMKEGKVY----
1ejwC           NFRVKRYIAKYTINPALTHGIAHEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIP
3dugA           -MTPLEAIQASTIKTAT-LFGIENIGQIKEGFDADIVGVI---ENPLANIRTLEEVAFVMKEGKVY----
3be7B           -MTPLEAIQASTIKTAT-LFGIENIGQIKEGFDADIVGVI---ENPLANIRTLEEVAFVMKEGKVY----
3e0lA           SLTLKEVFRLATLGGSQALGLDGEIGNFEVGKEFDAILINPKASDSPIDLFYGDFFGDVYVGGKQVVP--
1ejsC           NFRVKRYIAKYTINPALTHGIAHEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIP
1a4mA           MGFTEEEFKRLNINAAKSSF--------------------------------------------------
3e74C           QKRGSLPFGKLATNAAD-IFGLQQKGRIAPGKDADFVFIQPSSYVLTNDRTIGARITKTILRGDVIYD--
3dc8B           RITMNEFVAVTSTNIAKILNIYPKKGAILVGADADLVVWDAIDYNVFEGKTVTGLPRFTLTRGVVSIEEG
1a5mC           NFRVKRYIAKYTINPALTHGIAHEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIP
1e9yB           NFRIKRYLSKYTINPAIAHGISEYVGSVEVGKVADLVLWSPAFFGVKPNMIQMGDANASIPTPQPVYYRE
2aqvB           DFSISDALRPLTSSVAG-FLNLTGKGEILPGNDADLLVMT-----------PELRIEQVYARGKLMVK--
2aqoA           DFSISDALRPLTSSVAG-FLNLTGKGEILPGNDADLLVMT-----------PELRIEQVYARGKLMVK--
3e74B           QKRGSLPFGKLATNAAD-IFGLQQKGRIAPGKDADFVFIQNSSYVLTNDRTIGARITKTILRGDVIYD--
3dc8A           RITMNEFVAVTSTNIAKILNIYPKKGAILVGADADLVVWDPKRSKTISAKTQQSAIDYNVFEGKTVTGLP
3egjA           GIALDEALRMATLYPAKAIGVDEKLGRIKKGMIANLTVFD-----------RDFNVKATVVNGQY-----
3e74A           QKRGSLPFGKLATNAAD-IFGLQQKGRIAPGKDADFVFIQNSSYVLTNDRTIGARITKTILRGDVIYD--
1ejtC           NFRVKRYIAKYTINPALTHGIAHEVGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIP
2aqvA           DFSISDALRPLTSSVAG-FLNLTGKGEILPGNDADLLVMT-----------PELRIEQVYARGKLMVK--
3egjB           ----------------------------------------------------------------------
2amxA           LNFTLEEFMIMNNWAFEKSFVSDDVKSELKAL--------------------------------------
2aqoB           YDFSISALRPLTSSVAG-FLNLTGKGEILPGNDADLLVMT-----------PELRIEQVYARGKLMVK--
1e9zB           NFRIKRYLSKYTINPAIAHGISEYVGSVEVGKVADLVLWSPAFFGVKPNMIIKGGFIALSQMGDANASIP
2amxB           -NFTLEEFMIMNNWAFEKSFVSDDVKSELKAL--------------------------------------
3c86A           ----------------------------------------------------------------------
3e3hA           ----------------------------------------------------------------------
1cr5A           ----------------------------------------------------------------------
2d2gA           ----------------------------------------------------------------------
1bf6A           ----------------------------------------------------------------------
1dpmA           ----------------------------------------------------------------------
2bb0A           ----------------------------------------------------------------------
3d6nA           IISLKKLIEMFTINPAR--IIGVDLGTLKLGSPADITIFDPNKEWILNEETNLSKSRNTPLWGKVLKGKV
1a4mA           ----------------------------------------------------------------------
1e9yB           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           DLNAxx
2a3lA           ------
1ejuC           T-----
2bb0A           ------
1ejrC           T-----
3dugC           ------
1a5nC           T-----
1a5lC           ------
3be7A           ------
1a5oC           T-----
1a5kC           T-----
3d6nA           ------
1ejxC           T-----
3be7C           ------
1ejwC           T-----
3dugA           ------
3be7B           ------
3e0lA           ------
1ejsC           T-----
1a4mA           ------
3e74C           ------
3dc8B           TVKT--
1a5mC           T-----
1e9yB           MFAH--
2aqvB           ------
2aqoA           ------
3e74B           ------
3dc8A           R-----
3egjA           ------
3e74A           ------
1ejtC           T-----
2aqvA           ------
3egjB           ------
2amxA           ------
2aqoB           ------
1e9zB           T-----
2amxB           ------
3c86A           ------
3e3hA           ------
1cr5A           ------
2d2gA           ------
1bf6A           ------
1dpmA           ------
2bb0A           ------
3d6nA           I-----
1a4mA           ------
1e9yB           ------