[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for sent8:ACF67677.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1e3dA.bssp"
#ERROR : Can't open dsspfile "1cc1S.bssp"
#ERROR : Can't open dsspfile "3e7jA.bssp"

## Summary of PDB Search
:220
    6e-33  16%  1e3dA  [e.19.1] [NIFE] HYDROGENASE SMALL SUBUNIT
    1e-23  15%  1cc1S  [e.19.1] HYDROGENASE (SMALL SUBUNIT)
    1e-14   7%  3e7jA  [x.x.x] HEPARINASE II PROTEIN
:220

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLHDMVNWGRKNSIWPYNFGLSCCYVEMVT
1e3dA           -------------------------------------------------RPSVVYLHAAECTGCSEALLR
1cc1S           -----------------------------------NAVHPRIKEILLDV-ISLEFHPTVMASEGELAHMY
3e7jA           LNYLMTKDPKVGRETSIIDTLETATFKPA-GDISRGIGLF--MVTGAIVYDWCYDQLKPEEKTRFVKAFR


                         .         .         *         .         .         .         .:140
query           SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
1e3dA           TYQPFIDTLILDTISLDVNGPDGFICLVEGAIPTGMDNMYDICKNILPKAKAVVSIGTCACYGGIQAAKG
1cc1S           EIAEKFNGNFFLL-VEGAIPTAKECIVGEAKAHHHEVTMMELIRDLAPKSLATVAVGTCSAYGGIPKSVR
3e7jA           LAKMLECGYPPVKDKSAASEWMIMRDLIAIYDEFPEMYNLRFFKEHLVARNWFYPSHNYHQGMSALNVLF


                         +         .         .         .         .         *         .:210
query           VVQGVDKFIPVDVYIPGCPPRPEAYMQALMLLQESIGKERRPLSWVVGDQGVYRANMQPERERKRGERIA
1e3dA           INDCYADLGVKAINVPGCPPNPLNMVGTLVAFLKGQKIELDEVGPVMFFGQSVHDLCERRKHFDAGEFAP
1cc1S           DFFADEKIEKLLVNVPGCPPHPDWMVGTLVAAWSHVLNPTEHPLPELDDDGRPL----------------
3e7jA           ALWILDRMGAGNVFNPGQQFILYDAIYKRRPDGQILA---------------------------------


                         .         .         .         +         .         .         .:280
query           VTNLRTPDEx
1e3dA           SFNSEEARK-
1cc1S           ----------
3e7jA           ----------