[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for sent8:ACF67711.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2byzA.bssp"
#ERROR : Can't open dsspfile "2bz4D.bssp"
#ERROR : Can't open dsspfile "2byyA.bssp"
#ERROR : Can't open dsspfile "1dd8A.bssp"
#ERROR : Can't open dsspfile "1e5mA.bssp"
#ERROR : Can't open dsspfile "2buhA.bssp"
#ERROR : Can't open dsspfile "3e60A.bssp"
#ERROR : Can't open dsspfile "2c9hA.bssp"
#ERROR : Can't open dsspfile "1ek4A.bssp"
#ERROR : Can't open dsspfile "1b3nA.bssp"
#ERROR : Can't open dsspfile "2bywA.bssp"
#ERROR : Can't open dsspfile "2almA.bssp"
#ERROR : Can't open dsspfile "1ee0A.bssp"
#ERROR : Can't open dsspfile "2d51B.bssp"
#ERROR : Can't open dsspfile "1eb4A.bssp"
#ERROR : Can't open dsspfile "1ee0B.bssp"
#ERROR : Can't open dsspfile "1d6iA.bssp"
#ERROR : Can't open dsspfile "1e1cB.bssp"
#ERROR : Can't open dsspfile "2ccaA.bssp"
#ERROR : Can't open dsspfile "1d6hA.bssp"
#ERROR : Can't open dsspfile "2d51A.bssp"
#ERROR : Can't open dsspfile "2c7yB.bssp"
#ERROR : Can't open dsspfile "2ccdA.bssp"
#ERROR : Can't open dsspfile "1afwA.bssp"
#ERROR : Can't open dsspfile "2d3mB.bssp"
#ERROR : Can't open dsspfile "1chwA.bssp"
#ERROR : Can't open dsspfile "1cgkA.bssp"
#ERROR : Can't open dsspfile "2ahbA.bssp"
#ERROR : Can't open dsspfile "1cmlA.bssp"
#ERROR : Can't open dsspfile "2d3mA.bssp"
#ERROR : Can't open dsspfile "1aw1B.bssp"
#ERROR : Can't open dsspfile "1bq6A.bssp"
#ERROR : Can't open dsspfile "3e1hA.bssp"
#ERROR : Can't open dsspfile "2c7yA.bssp"
#ERROR : Can't open dsspfile "2dv1A.bssp"
#ERROR : Can't open dsspfile "1bi5A.bssp"
#ERROR : Can't open dsspfile "1eblA.bssp"
#ERROR : Can't open dsspfile "2aj9A.bssp"
#ERROR : Can't open dsspfile "2eknA.bssp"
#ERROR : Can't open dsspfile "1aw1A.bssp"
#ERROR : Can't open dsspfile "2dv2A.bssp"
#ERROR : Can't open dsspfile "1ekrA.bssp"
#ERROR : Can't open dsspfile "2eknB.bssp"
#ERROR : Can't open dsspfile "1eksA.bssp"
#ERROR : Can't open dsspfile "2ebdB.bssp"
#ERROR : Can't open dsspfile "2ebdA.bssp"
#ERROR : Can't open dsspfile "3dtvA.bssp"
#ERROR : Can't open dsspfile "3bbnE.bssp"
#ERROR : Can't open dsspfile "1afwB.bssp"
#ERROR : Can't open dsspfile "1dluA.bssp"
#ERROR : Can't open dsspfile "1d1qB.bssp"
#ERROR : Can't open dsspfile "3do6A.bssp"
#ERROR : Can't open dsspfile "1d1pB.bssp"
#ERROR : Can't open dsspfile "3d2eA.bssp"
#ERROR : Can't open dsspfile "2d0oA.bssp"
#ERROR : Can't open dsspfile "2d0pC.bssp"
#ERROR : Can't open dsspfile "1d1pA.bssp"
#ERROR : Can't open dsspfile "3cfiB.bssp"
#ERROR : Can't open dsspfile "2d0oC.bssp"

## Summary of PDB Search
:404
    1e-97  91%  2byzA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE I
    8e-94  91%  2bz4D  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE I
    2e-67  91%  2byyA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE I
    6e-67  91%  1dd8A  [c.95.1 - c.95.1] BETA-KETOACYL [ACYL CARRIER PROTEIN]
    2e-62  33%  1e5mA  [c.95.1 - c.95.1] BETA KETOACYL ACYL CARRIER PROTEIN SYNTHASE
    8e-62  91%  2buhA  [c.95.1 - c.95.1 (1og8A)] 3-OXOACYL-[ACYL-CARRIER-PROTEIN]
    2e-61  36%  3e60A  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN ] SYNTHASE II
    2e-59  33%  2c9hA  [x.x.x] MITOCHONDRIAL BETA-KETOACYL SYNTHASE
    2e-58  91%  1ek4A  [c.95.1 - c.95.1] BETA-KETOACYL [ACYL CARRIER PROTEIN]
    7e-58  34%  1b3nA  [c.95.1 - c.95.1] PROTEIN (KETOACYL ACYL CARRIER PROTEIN
    7e-55  91%  2bywA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE I
    3e-47  31%  2almA  [x.x.x] 3-OXOACYL-(ACYL-CARRIER-PROTEIN) SYNTHASE II
    9e-38   9%  1ee0A  [c.95.1 - c.95.1] 2-PYRONE SYNTHASE
    4e-37   8%  2d51B  [x.x.x] PENTAKETIDE CHROMONE SYNTHASE
    4e-37  14%  1eb4A  [a.127.1] HISTIDINE AMMONIA-LYASE
    5e-37  10%  1ee0B  [c.95.1 - c.95.1] 2-PYRONE SYNTHASE
    6e-37  10%  1d6iA  [c.95.1 - c.95.1] CHALCONE SYNTHASE
    1e-35   7%  1e1cB  [c.1.19 - c.23.6] METHYLMALONYL-COA MUTASE BETA CHAIN
    1e-34  10%  2ccaA  [x.x.x] PEROXIDASE/CATALASE T
    1e-33  10%  1d6hA  [c.95.1 - c.95.1] CHALCONE SYNTHASE
    4e-33   8%  2d51A  [x.x.x] PENTAKETIDE CHROMONE SYNTHASE
    5e-33  10%  2c7yB  [x.x.x] 3-KETOACYL-COA THIOLASE 2
    8e-32  11%  2ccdA  [x.x.x] PEROXIDASE/CATALASE T
    2e-31  11%  1afwA  [c.95.1 - c.95.1] 3-KETOACETYL-COA THIOLASE
    1e-30   8%  2d3mB  [x.x.x] PENTAKETIDE CHROMONE SYNTHASE
    6e-30  10%  1chwA  [c.95.1 - c.95.1] PROTEIN (CHALCONE SYNTHASE)
    3e-29  10%  1cgkA  [c.95.1 - c.95.1] PROTEIN (CHALCONE SYNTHASE)
    6e-29  13%  2ahbA  [x.x.x] BETA- KETOACYL-ACP SYNTHASE III
    3e-28  10%  1cmlA  [c.95.1 - c.95.1] PROTEIN (CHALCONE SYNTHASE)
    1e-26   9%  2d3mA  [x.x.x] PENTAKETIDE CHROMONE SYNTHASE
    9e-26   9%  1aw1B  [c.1.1] TRIOSEPHOSPHATE ISOMERASE
    1e-25  10%  1bq6A  [c.95.1 - c.95.1] CHALCONE SYNTHASE
    9e-25  10%  3e1hA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    2e-24  10%  2c7yA  [x.x.x] 3-KETOACYL-COA THIOLASE 2
    4e-24  10%  2dv1A  [x.x.x] PEROXIDASE/CATALASE
    3e-23  10%  1bi5A  [c.95.1 - c.95.1] CHALCONE SYNTHASE
    3e-23  11%  1eblA  [c.95.1 - c.95.1] BETA-KETOACYL-ACP SYNTHASE III
    6e-23  13%  2aj9A  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE III
    7e-23   8%  2eknA  [x.x.x] PROBABLE MOLYBDENUM COFACTOR BIOSYNTHESIS
    3e-21   9%  1aw1A  [c.1.1] TRIOSEPHOSPHATE ISOMERASE
    1e-20  10%  2dv2A  [x.x.x] PEROXIDASE/CATALASE
    3e-20  10%  1ekrA  [d.58.21] MOLYBDENUM COFACTOR BIOSYNTHESIS PROTEIN C
    4e-20   8%  2eknB  [x.x.x] PROBABLE MOLYBDENUM COFACTOR BIOSYNTHESIS
    2e-19  10%  1eksA  [d.58.21] MOLYBDENUM COFACTOR BIOSYNTHESIS PROTEIN C
    3e-19  14%  2ebdB  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 3
    1e-18  14%  2ebdA  [x.x.x] 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE 3
    4e-18  11%  3dtvA  [x.x.x] ARYLMALONATE DECARBOXYLASE
    9e-18   7%  3bbnE  [x.x.x] RIBOSOMAL PROTEIN S5
    1e-17  13%  1afwB  [c.95.1 - c.95.1] 3-KETOACETYL-COA THIOLASE
    2e-17  12%  1dluA  [c.95.1 - c.95.1] BIOSYNTHETIC THIOLASE
    3e-15   8%  1d1qB  [c.44.1] TYROSINE PHOSPHATASE (E.C.3.1.3.48)
    5e-15  10%  3do6A  [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
    6e-11   8%  1d1pB  [c.44.1] TYROSINE PHOSPHATASE
    6e-09  11%  3d2eA  [x.x.x] HEAT SHOCK PROTEIN HOMOLOG SSE1
    1e-07  15%  2d0oA  [x.x.x] DIOL DEHYDRATASE-REACTIVATING FACTOR LARGE
    1e-07  18%  2d0pC  [x.x.x] DIOL DEHYDRATASE-REACTIVATING FACTOR LARGE
    1e-07  12%  1d1pA  [c.44.1] TYROSINE PHOSPHATASE
    1e-06   8%  3cfiB  [x.x.x] TYPE II SECRETORY PATHWAY, PSEUDOPILIN EPSJ
    3e-05  18%  2d0oC  [x.x.x] DIOL DEHYDRATASE-REACTIVATING FACTOR LARGE
:404

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVKLDTTGLIDRKVVRFMSD
2byzA           MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSD
2bz4D           MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSD
2byyA           MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSD
1dd8A           MKRVVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSD
1e5mA           -KRVVVTGLGAITPIGNTLQDYWQGLMEGRNGIGPITRFDASDQACRFGGEVKFDATQFLDRKEAKRMDR
2buhA           MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSD
3e60A           MRRVVITGLGLVSPLAGDVEYSWKRLLEGKSGVRRITEFDVSDLSCQIAARIPYNADLHMESKEQRKVDA
2c9hA           -RRVVITGIGLVTPLGVGTHLVWDRLIGGESGIVSLVGEEYKSIPCSVAAYVPRNEQNFVSKSDIKSMSS
1ek4A           MKRVVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSD
1b3nA           -RRVVVTGLGMLSPVGNTVESTWKALLAGQSGISLIDHFDTSAYATKFAGLVKFNCEDIISRKEQRKMDA
2bywA           MKRVVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSD
2almA           LNRVVVTGYGVTSPIGNTPEEFWNSLATGKIGIGGITKFDHSDFDVHNAAEIQFPFDKYFVKKDTNRFDN
1ee0A           --LATILAIGTATPPNCVAQADYDYYFRVTKSEHMVDLKEKFKRICEKTAIKK-------RYLALTEDYL
2d51B           -GTATVMAIGTAHPPHFPQDTYADVYFRATNSEHKVELKKKFDHICKKTMIGK-------RYFNYDEEFL
1eb4A           -------------------------------------------------------------------AED
1ee0B           --LATILAIGTATPPNVAQADYADYYFRVTKSEHMVDLKEKFKRICEKTAIKKRYLALTEDYLQENPTMC
1d6iA           -GPATILAIGTANPANCVEQSTYDFYFKITNSEHKTELKEKFQRMCDKSMIKR-------RYMYLTEEIL
1e1cB           MTKVEVFSRYDQGAAAEALVSVYERSDKPAKDLALNLGLDPIGFAALQGTEPDLTVLGDNIYHNAGAGDV
2ccaA           ------------------------------------------------------------------KVLH
1d6hA           -GPATILAIGTANPANCVEQSTYDFYFKITNSEHKTELKEKFQRMCDKSMIKRRYMYLTEEILKENPNVC
2d51A           DGTATVMAIGTAHPPHFPQDTYADVYFRATNSEHKVELKKKFDHICKKTMIGK-------RYFNYDEEFL
2c7yB           GDDVVIVAAHR-TPLCKSKRGNFKDLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQ--RASECRMAAF
2ccdA           ----------------------------------------------------------------------
1afwA           PEDVVIVAAN-RSAIGKGFKGAFKDLYNFLNEFIGRFPEPLRADLNLIEEVACGNLNVGAGATEHRAACL
2d3mB           -GTATVMAIGTAHPPHFPQDTYADVYFRATNSEHKVELKKKFDHICKKTMIGKRYFNYDEEFLKKYPNIT
1chwA           -GPATILAIGTANPANCVEQSTYDFYFKITNSEHKTELKEKFQRMCDKSMIKRRYMYLTEEILKENPNVC
1cgkA           -GPATILAIGTANPANVEQSTYPDFYFKITNSEHKTELKEKFQRMCDKSMIKRRYMYLTEEILKENPNVC
2ahbA           -RSVGLLSVGAYRPERVVTNDEICQHIDSSDEWIYTA-------------------TGIKTRRFAADDES
1cmlA           -GPATILAIGTANPANVEQSTYPDFYFKITNSEHKTELKEKFQRMCDKSMIKR-------RYMYLTEEIL
2d3mA           DGTATVMAIGTAHPPHFPQDTYADVYFRATNSEHKVELKKKFDHICKKTMIGKRYFNYDEEFLKKYPNIT
1aw1B           ----------------------------------------------------------------------
1bq6A           -GPATILAIGTANPANVEQSTYPDFYFKITNSEHKTELKEKFQRMCDKSMIKR-------RYMYLTEEIL
3e1hA           --GLSITGLGVQYPPYSLGPDAIILSKRYHPESPAMKKVLAINRYTGIDQRSSIGNPDHPLVNKPNPMSD
2c7yA           ----------------------------------------------------------------------
2dv1A           ----------------------------------------------------------------------
1bi5A           -GPATILAIGTANPANVEQSTYPDFYFKITNSEHKTELKEKFQRMCDKSMIKR-------RYMYLTEEIL
1eblA           ----------------------------------------------------------------------
2aj9A           -RSVGLLSVGAYRPERVVTNDEICQHIDSSDEAIYTR-------------------TGIKTRRFAADDES
2eknA           ----------------------------------------------------------------------
1aw1A           ----------------------------------------------------------------------
2dv2A           ----------------------------------------------------------------------
1ekrA           ----------------------------------------------------------------------
2eknB           ----------------------------------------------------------------------
1eksA           ----------------------------------------------------------------------
2ebdB           ----------------------------------------------------------------------
2ebdA           ----------------------------------------------------------------------
3dtvA           ----------------------------------------------------------------------
3bbnE           ----------------------------------------------------------------------
1afwB           PEDVVIVAANR-SAIGKGFKGAFKDVNTDYLLYNFLNEFIGRFPEPLRADLNLIEEVACGNVLNVGAGAT
1dluA           ----------------------------------------------------------------------
1d1qB           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1d1pB           ----------------------------------------------------------------------
3d2eA           ----------------------------------------------------------------------
2d0oA           ----------------------------------------------------------------------
2d0pC           ----------------------------------------------------------------------
1d1pA           ----------------------------------------------------------------------
3cfiB           ----------------------------------------------------------------------
2d0oC           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADAMRSPRGLKAVGPYVVTKAMAS
2byzA           ASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMAS
2bz4D           ASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMAS
2byyA           ASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMAS
1dd8A           ASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMAS
1e5mA           FCHFAVCASQQAINDAKLVINEL-NADEIGVLIGTGIGGLKVLEDQQTILLD-KGPSRCSPFMIPMMIAN
2buhA           ASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMAS
3e60A           FIVYAIAAADQALADAEWFPKSDEDQICTGVLIGSGIGGIE-GIVEAGYTLRDKGPRRISPFFIPGRLIN
2c9hA           PTIMAIGAAELAMKDSGWHPQSEADQVATGVAIGMGMIPLEVVSETA-LNFQTKGYNKVSPFFVPKILVN
1ek4A           ASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMAS
1b3nA           FIQYGIVAGVQAMQDSGLEITEENAT-RIGAAIGSGIGGLGLIEENHTSLMN-GGPRKISPFFVPSTIVN
2bywA           ASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMAS
2almA           YSLYALYAAQEAVNHANLDVEALNRDRFGVIVASGIGGIKEIEDQVLRLHE--KGPKRVKPMTLPKALPN
1ee0A           QENPTMCEFMAPSLNARQDLVVTGV-PMLGKEAAVK------AIDEWGLPKSKITHLIFCTTAGVDMPGA
2d51B           KKYPNITSYDEPSLNDRQDICVP-GVPALGTEAAVKAIEE------WGRPKSEITHLVFCTSCGVDMPSA
1eb4A           RTAYGINTGFGLLASTRIASHDLENLQRSLVLSHAAGI---GAPLDDDLVRIMVLKINSLSRGFSGIRRK
1ee0B           EFMAPSLNARQDLVVT--------GVPMLGKEAAVKAIDE------WGLPKSKITHLIFCTTAGVDMPGA
1d6iA           KENPNVCEYMAPSLDARQDMV-VVEVPRLGKEAAVKAIKE------WGQPKSKITHLIVCTTSGVDMPGA
1e1cB           AELAWALATGAEYVRALVEQGFTATFDTINFRVTATHDQF-LTIARLRALREAWAIGEVFGVDEDKRGAR
2ccaA           QNPAVADPMGAAFDYAEVATIDVDALTRDIEEVMTTSQPWWPADYGHYGPLFIRMAAGTYRIHDGRGGAG
1d6hA           EYMAPSLDARQDMVV--------VEVPRLGKEAAVKAIKE------WGQPKSKITHLIVCTTSGVDMPGA
2d51A           KKYPNITSYDEPSLNDRQDICVP-GVPALGTEAAVKAIEE------WGRPKSEITHLVFCTSCGVDMPSA
2c7yB           YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGI-GAGLESMTTNPMAWEKKFAQAQNCLLPMG
2ccdA           ----------AVADPMGAAFD-YAAEVATIDVDALTRDI-EEVMTTSQPWWPADYGHYGPLFIRMRGGAG
1afwA           ASGIPYSTPFVALNRQCSSGLTAVNQIDIGLALGVESMTNNYKNVNPLGMISSEELQKNREAKKCLIPMG
2d3mB           SYDEPSLNDRQDICV--------PGVPALGTEAAVKAI------EEWGRPKSEITHLVFCTSCGVDMPSA
1chwA           EYMAPSLDARQDMVV--------VEVPRLGKEAAVKAIKEWGQ-----PKSKITHLIVCTTSGVDMPGAD
1cgkA           EYMAPSLDARQDMVV--------VEVPRLGKEAAVKAIKEWGQP-----KSKITHLIVCTTSGVDMPGAD
2ahbA           AASMATEACRRALSNAGLSAADI-------------------------------DGVIVTTNTHFLQTPP
1cmlA           KENPNVCEYMAPSLDARQDMVV-VEVPRLGKEAAVKAIKEWGQP-----KSKITHLIVCTTSGVDMPGAD
2d3mA           SYDEPSLNDRQDICVPGV--------PALGTEAAVK------AIEEWGRPKSEITHLVFCTSCGVDMPSA
1aw1B           ----------------------------------------------------------VMGNWKLNGSKE
1bq6A           KENPNVCEYMAPSLDARQDMVVVEV-PRLGKEAAVKAIKEWGQPKS------KITHLIVCTTSGVDMPGA
3e1hA           GVPLAVEASRKAMAEARL-----VPAQITHMVSTTCTDSANPGYDHY-----------------------
2c7yA           ----------------------------------------------------------------------
2dv1A           ---------------------------------------------------------------ADGRGGA
1bi5A           KENPNVCEYMAPSLDARQDMVV-VEVPRLGKEAAVKAIKEWGQPK------SKITHLIVCTTSGVDMPGA
1eblA           ----------------------------------------------------------VVATTSATHAFP
2aj9A           AASMATEACRRALSNAGLSAADI-------------------------------DGVIVTTNTHFLQTPP
2eknA           ----------------------------------------------------------------------
1aw1A           ----------------------------------------------------------VMGNWKLNGSKE
2dv2A           -------------------------------------------------------------RTADGRGGA
1ekrA           ----------------------------------------------------------------------
2eknB           ----------------------------------------------------------------------
1eksA           ----------------------------------------------------------------------
2ebdB           ----------------------------------------------------------ILATLTPQKRFP
2ebdA           ----------------------------------------------------------ILATLTPQKRFP
3dtvA           ----------------------------------------------------------------------
3bbnE           ----------------------------------------------------------------------
1afwB           EHRAACLASGGLTAVNDIANKIKVGQIDIGLALGVESMTNNYKNVNPLGMISSEELQKNREAKKCLIPMG
1dluA           ----------------------------------------------ERAGVAAGEVNEVILGQVLPAGEG
1d1qB           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1d1pB           ----------------------------------------------------------------------
3d2eA           ----------------------------------------------------------------------
2d0oA           ----------------------------------------------------------------------
2d0pC           ----------------------------------------------------------------------
1d1pA           ----------------------------------------------------------------------
3cfiB           ----------------------------------------------------------------------
2d0oC           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTK
2byzA           GVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTK
2bz4D           GVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTK
2byyA           GVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTK
1dd8A           GVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTK
1e5mA           MASGLTAINLGAKGPNNCTVTACAAGSNAIGDAFRLVQNGYAKAMICGGTEAAITPLSYAGFASARALSF
2buhA           GVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTK
3e60A           LASGYVSIKYGLRGPNHSVVTACSTGAHAIGDAARLIALGDADVMLAGGTESINRISLAGFSACRALSTC
2c9hA           MAAGQVSIRYKLKGPNHAVSTATT-GAHAVGDSFRFIAHGDADVMVAGGTDSISPLSLAGFSRARALS--
1ek4A           GVSACLATPFKIHGVNYSISSASATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTK
1b3nA           MVAGHLTIMYGLRGPSISIATACTSGVHNIGHAARIIAYGDADVMVAGGAEKASTPLGVGGFGAARALST
2bywA           GVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTK
2almA           MASGNVAMRFGANGVCKSINTACSSSNDAIGDAFRSIKFGFQDVMLVGGTEASITPFAI-AGFQALTALS
1ee0A           DYQLVKLLGLSPSVKRYMLYQQGAAGGTVLRLAKDLAENNKGSRVLIVCSEIAILFHGPNENHLDSLVA-
2d51B           DFQCAKLLGLHANVNKYCIYMQGYAGGTVMRYAKDLAENNRGARVLVVCAELTIMGLRANETHLDNAIG-
1eb4A           VIDALIALVNAEVYPHIPLKGSVGASGDLAPLAHMSLVLL---------GEGKARYKGQWLSATEALAVA
1ee0B           DYQLVKLLGLSPSVKRYMLYQQGAAGGTVLRLAKDLAENNKGSRVLIVCSEIAILFHGPNENHLDSLVA-
1d6iA           DYQLTKLLGLRPYVKRYMMYQQGFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVG
1e1cB           QNAITSWRELTREDPYVNILRGSIATFSASVGGAESITTLPFTQALGLPEDDFPLRIARNTGIV------
2ccaA           GGMQR-FAPLNSWPDNASLDKARRLLWP-VKKKYGKKLSWADLIVFAGN--------------CALESMG
1d6hA           DYQLTKLLGLRPYVKRYMMYQQGFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVG
2d51A           DFQCAKLLGLHANVNKYCIYMQGYAGGTVMRYAKDLAENNRGARVLVVCAELTIMGLRAPNETH------
2c7yB           VTSENVAQRFGVSRQEQDQAAVDSKFKDEIIPVKTKLVDPKTGDEKPIT-----VSVDDGIRPTTTLASL
2ccdA           GGMQR-FAPLNSWPDNASLDKARR-LLWPVKKKYGKKLSWADLIVFAGN--------------CALESMG
1afwA           ITNENVAANFKISRKDQDEFAANSYQKAYKAKNEGLFEDEILPIKLPD-----GSICQSDEGPRPNVTAE
2d3mB           DFQCAKLLGLHANVNKYCIYMQGYAGGTVMRYAKDLAENNRGARVLVVCAELTIMMLRAPNETHLD----
1chwA           YQLTKLLGLRPYVKRYMMYQQGSFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTH------
1cgkA           YQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLD----
2ahbA           AAPMVAASLGAKGILGFDLSAGCAGFGYALGAAADMIRGGGAATMLVVGTEKLSPTIDMYDAGNCFIF--
1cmlA           YQLTKLLGLRPYVKRYMMYQQGAFAGGTVLRLAKDLAENNKGARVLVVCSETAVTFRGPSDTHLDSLVG-
2d3mA           DFQCAKLLGLHANVNKYCIYMQGYAGGTVMRYAKDLAENNRGARVLVVCAELTIMMLRAPNETHLDNAIG
1aw1B           MVVDLLNGLNAELEGVTGVDVAVAPPALFVDLAERTLTEAGSAIILGAQNTLNNSGAFTGDMSPAMLK--
1bq6A           DYQLTKLLGLRPYVKRYMMYQQGFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVG
3e1hA           --VAKELGLSDRLEKVLLHGIGCSGGLAALRTAANLCLGHTARGKPARILV----------LALEVSTTM
2c7yA           ---ENVAQRFGVSRQEQDQAAVDSHRKAAAATAAGKFKDEIIPVKTKLVDPKTGDEKPITVSVDDTLASL
2dv1A           GEGQQRFAPLNSWPENANLDKARRLLW-PIKQKYGRAISWADLLILTGNVAESMGFKTFGFAGGRADT--
1bi5A           DYQLTKLLGLRPYVKRYMMYQQGFAGGTVLRLAKDLAENNKGARVLVVCSETAVTFRGPSDTHLDSLVGQ
1eblA           SAACQIQSLGIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSDVLARTC-------------
2aj9A           AAPMVAASLGAKGILGFDLSAGCAGFGYALGAAADMIRGGGAATMLVVGTEKLSPTIDMYDAGNCFIF--
2eknA           ----------------------------------------------------------------------
1aw1A           MVVDLLNGLNAELEGVTGVDVAVAPPALFVDLAERTLTEAGSAIILGAQNTLNNSGAFTGDMSPAMLK--
2dv2A           GEGQQRFAPLNSWPENANLDKARRLLW-PIKQKYGRAISWADLLILTGNVAESMGFKTFGFAGGRADT--
1ekrA           ----------------------------------------------------------------------
2eknB           ----------------------------------------------------------------------
1eksA           ----------------------------------------------------------------------
2ebdB           STACLVQAQLKAKGVAFDISAACSGFIYALDIADSFIKSGKAKNVLVIGAEKLSEAVDWEDRSTCVL---
2ebdA           STACLVQAQLKAKGVAFDISAACSGFIYALDIADSFIKSGKAKNVLVIGAEKLSEAVDWEDRSTCVL---
3dtvA           ---------------------------------------------------------------IGMIVPP
3bbnE           ----------------------------------------------------------------------
1afwB           ITNENVAANFKISRKDQDEFAANSYQKAYKAKNEGLFEDE--ILPIKLPDGSICQSDEGPRPNVTAESLS
1dluA           QNPARMKAGVPQEATAWGMNQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPHCAHLRGGVKMGD
1d1qB           ----------------------------------------------------------------------
3do6A           ----GLGGSANGFPREDSFIITAASEVAILALSENKDLKERLGKIIVALDADRKIVRISDLGIQGAAVLL
1d1pB           ----------------------------------------------------------------------
3d2eA           ----------------------------------------------------------------------
2d0oA           ----------------------------------------------------------------------
2d0pC           ----------------------------------------------------------------------
1d1pA           ----------------------------------------------------------------------
3cfiB           ----------------------------------------------------------------------
2d0oC           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           YNDTPEKASRTYDAHRDXXXXXXXXXXXXXEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRC
2byzA           YNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRC
2bz4D           YNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADM---SGEGAVRC
2byyA           YNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRC
1dd8A           YNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRC
1e5mA           RNDDPLHASRPFDKDRDGFVMGEGSGILILEELESALARGAKIYGEMVGYAMTCDAYHITAPVPDGAIAW
2buhA           YNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRC
3e60A           RNDDPERASRPYDVDRDGFVMGEGAAIVVLEELEHAKKRGARIYAEIIGYGLSGDAYHIPSESGEGAQRS
2c9hA           TNSDPKLACRPFHPKRDGFVMGEGAAVLVLEEYEHAVQRRARIYAEVLGYGLSGDAGHITAPDGEGALRC
1ek4A           YNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRC
1b3nA           RNDNPQAASRPWDKERDGFVLGDGAGMLVLEEYEHAKKRGAKIYAELVGFGMSSDAYHMPPENGAGAALA
2bywA           YNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRC
2almA           TTEDPTRASIPFDKDRNGFVMGEGSGMLVLESLEHAEKRGATILAEVVGYGNTCDAYHMTHPEGQGAIKA
1ee0A           -QALFGDGAAALIVGSGPHLAVERPIFEIVSTDQTILPDTEKAMKLHLREGGLTFQLHRDLMVAKNIENA
2d51B           --------ISLFGDGAAALIIGSDPIIGVEKPMFEIVCTKQTVIPNTEDVIHLHLRETGMMFYLSKGSID
1eb4A           GLEPLTLAAKEGLALLNGTQASTAYALRGLFYAEDLYAAAIACGGLSVEAVLGSRSPFDAIHEARGQRGQ
1ee0B           -QALFGDGAAALIVGSGPHLAVERPIFEIVSTDQTILPDTEKAMKLHLREGGLTFQLHRDVPLMVAKNIE
1d6iA           QALFGDGAAALIVGSDPVPEIEKPIFEMVWTAQTIAPDSEGAIDGHLREAGLTFHLLKDVGIVSKNITKA
1e1cB           -LAEEVNIGRVNDPAGGSYYVESLTRSLADAAWKEFQEVEKLGGMSKAVMEHVTKVLDACNAERAKRLAN
2ccaA           FKTFGFGFGRVDQWEPDEVYWGKEATWLGDERYSGKRDLENPLAAVQMGLIYVNPEGPNGNPDPMAAAVD
1d6hA           QAL-FGDGAAALIVGSDPVPEIEKPIFEMVWTAQTIAPDSEGAIDGHLREAGLTFHLLKDVPGSKNITKA
2d51A           --LDNAIGISLFGDGAAALIIGSDPIIGVEKPMFEIVCTKQTVIPNTEDVIHLHGSPMTISNNVEACLID
2c7yB           GKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAIMGIGPAVAIPA
2ccdA           FKTFGFGFGRVDQWEPDEVYWGKEATWLGDERYSGKRDLENPLAAVQMGLIYVNPEGPNPDPMAAAVDIR
1afwA           SLSSIRPAFIGTTTAGNASQVSDGVAGVLLARRSVANQLNLPVLGRYIDFQTVGVPPEIMGVGPAYAIPK
2d3mB           ----NAIGISLFGDGAAALIIGSDPIIGVEKPMFEIVCTKQTVIPNTEDVIHLHLRETGMMFYLSKGSPD
1chwA           --LDSLVGQALFGDGAAALIVGSDPVPEIEKPIFEMVWTAQTIAPDSEGAIDGHLREAGLGIVSKNITKA
1cgkA           ----SLVGQALFGDGAAALIVGSDPVPEIEKPIFEMVWTAQTIAPDSEGAIDGHLREAGLTIVSKNITKA
2ahbA           ----ADGAAAVVVGETPFQGIGPTVAGSDGEQADAIRQDIDWITFAQNPSGPRPFVPAVFRWAAFKMGDV
1cmlA           --------QALFGDGAAALIVGSDPVPEIEKPIFEMVWTAQTIAPDSEGAIDGHLREDVPGIVSKNITKA
2d3mA           ISLFGDGAAALIIGSDP--------IIGVEKPMFEIVCTKQTVIPNTEDVIHLHLSPMTISNNVEACLID
1aw1B           ----EFGATHIIIGHSERREYHAESDEFVAKKFAFLKENGLTPVLC---IGESDAQNEAGMAVCARQLDA
1bq6A           QALFGD-GAAALIVGSDPVPEIEKPIFEMVWTAQTIAPDSEGAIDGHLREAGLTFHLLKPGIVSKNITKA
3e1hA           VRSELESIDALQETRIGIALFSDCASAVILSNGIGEAPGKPAIYDLLGWENRVIPDSEWKVVLSPRVPVL
2c7yA           GKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAIMGIGPAVAIPA
2dv1A           ----WEPEDVYWGSEKIWLELSGGPN----SRYSGDRQLENPLAAVQMGLIYVNPEGPDGDPVAAARDIR
1bi5A           ALFGDGAAALIVGSDPV--PEIEKPIFEMVWTAQTIAPDSEGAIDGHLREAGLTFHLLKPGIVSKNITKA
1eblA           -DPTDRGTIIIFGDGAGAAVLAASEEPGIISTHLHADGSYGELLTLPNADRVNPENSIHLKVAVTELAHI
2aj9A           ----ADGAAAVVVGETPFQGIGPTVAGSDGEQADAIRQDIDWITFAQNPSGPRPFVRLEGPWAAFKMGDV
2eknA           ----------------------------------------------------------VKMVEIGYKDVV
1aw1A           ----EFGATHIIIGHSERREYHAESDEFVAKKFAFLKENGLTPVL---CIGESDAQNEATMAVCARQLDA
2dv2A           ----WEPEDVYWGSEKIWLELSGGPN----SRYSGDRQLENPLAAVQMGLIYVNPEGPDGNPDAAARDIR
1ekrA           ----------------------------------------------------------AHMVDVSAKAET
2eknB           ----------------------------------------------------------VKMVEIGYKDVV
1eksA           -------------------------------------------------------------VDVSAKAET
2ebdB           FGDGAGAVVVTRSEDKS----------DILATRMYAEGSLEELLHADNCGYIRMKGRELFKVAVRSMEEV
2ebdA           FGDGAGAVVVTRSEDKS----------DILATRMYAEGSLEELLHADNCGYIRMKGRELFKVAVRSMEEV
3dtvA           AAGLVPADGARLYPDLPFIASGLGEGYDAVESVVDHARRLQKQGAAVVSLMGTSLSFYRGAAFNAALTVA
3bbnE           ---------------------------------TVPMTKYLTFPHRNEADYGAARVMLRPAAPGTGAGGA
1afwB           SIRPAFIKDRGTTTAGNASQVSDGVAGVLLARRSVANQLNLPVLGRYIDFQTVGVPPEIMGVGPAYAIPK
1dluA           FKMIDTMIKDGLTDAFYGYHMGTTAENVAKQWLSRDEQDAFAVASQNKAEAAQKDGKDEIVPFIVKGRKG
1d1qB           -------------------------------------------------------GNFCRSPMAEAIFKH
3do6A           KDAINPNLVQTTEGTPALIHCGPFANIAHGTNSIIATKAKLSEYTVTEAGFGADLGAEK-FIDFVSRVGG
1d1pB           -------------------------------------------------------------PMAEAIFKH
3d2eA           ---------------------------------------------------------ELVKPLLERVTEP
2d0oA           ------------------------------ATLDEAGALTITHSALAETTGIKGTLRNVFGIQ---EALA
2d0pC           ------------------------------ATLDEAGALTITHSALAETTGIKGTL-----RNVFGIQEA
1d1pA           -------------------------------------------------------------PMAEAIFKH
3cfiB           ---------------------------------------------------------NPQQQFPRGEVTK
2d0oC           ------------------------------ATLDEAGALTITHSALAETTGIKGT-----LRNVFGIQEA


                         .         *         .         .         .         .         +:350
query           MQMAMHGVDTPIDYLNSHGTSTPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLML
2byzA           MKMAMHGVDTPIDYLNSQGTSTPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLML
2bz4D           MKMAMHGVDTPIDYLNSQGTSTPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLML
2byyA           MKMAMHGVDTPIDYLNSEGTSTPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLML
1dd8A           MKMAMHGVDTPIDYLNSHGTSTPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLML
1e5mA           ALKDSGLKPEMVSYINAHGTSTPANDVTETRAIKQALGNHAYAVSSTKSMTGHLLGGSGGIEAVATVMAI
2buhA           MKMAMHGVDTPIDYLNSHGTSTPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLML
3e60A           MMAALKRAQVELDYINAHGTSTMADVI-ELAAVERVLGYYAPSMSSTKSSIGHLLGAAGAAEAIFCVLAI
2c9hA           MAAALKGVQPEISYINAHATSTPLGDAAENKAIKHLFKDYALAVSSTKGATGHLLGAAGAVEAAFTTLAC
1ek4A           MKMAMHGVDTPIDYLNSHGTSTPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLML
1b3nA           MALRDAGIEASIGYVNAHGTSTPAGDKAEAQAVKTIFGEAASLVSSTKSMTGHLLGAAGAVESIYSILAL
2bywA           MKMAMHGVDTPIDYLNSHGTSTPVGDVKELAAIREVFGDKSPAISATAAMTGHSLGAAGVQEAIYSLLML
2almA           IKLALEEAEISVAYVNAAGTSTPANEKGESGAIVAVLGKEVP-VSSTKSFTGHLLGAAGAVEAIVTIEAM
1ee0A           AEKALSPLGITSVFWMVHPGGRAILDQVERKLNLKEDKL--RASRHVLSEYGNLISACVLFIIDEVRKRS
2d51B           VFKSVGITPPESLFWIPHPGGRAILDQVEAKLKLRPEKF--RAARTVLWDYGNMVSASVGYILDEMRRKS
1eb4A           IDTAADLLGDSSEVSLSHKNADKVQDPYSLRCQPQVMGACLTQLR----QAAEVLGIEANAVSDNPLVFA
1ee0B           NAAEKALSPLGSVFWMVHPGGRAILDQVERKLNLKEDKL--RASRHVLSEYGNLISACVLFIIDEVRKRS
1d6iA           LVEAFEPLGISSIFWIAQPGGPAILDQVEQKLALKPEK---MNATREVLSEYGNMSSACVLFIDEMRKKS
1e1cB           RKQPITAVSKPFPAAPARKGLAWHRDSEVFEQLMDRSTSV--SERPKVFLACLGTRRDFGGREGFSSPVW
2ccaA           IRETFRRMANDVETAALIVGGHTFGKTHGAGPADLVGPEAPLEQMGLGWKSSYGTGTGKDAITSGIEVVW
1d6hA           LVEAFEPLGISSIFWIAHPGGPAILDQVEQKLALKPEKM--NATREVLSEYGAMSSACVLFILDEMRKKS
2d51A           VFKSVGPPEWNSLFWIPHPGGRAILDQVE--AKLKLRPEKFRAARTVLWDYGNMVSASVGYILDEMRRKS
2c7yB           AVKAAGLELDDIDLFEINEAFASQFVYCRNKLG---LDPEKINVNGGAMAIGHPLGATGARCVATLLHEM
2ccdA           ETFRRMAMNDVALIVGGHTFGKTHGAGPADLVGPEPEAAPLEQKSSYGTGTGKDAITTGIEVVWTNTPTK
1afwA           VLEATGLQVQDIDIFEINEAFAAQALYCIHKLGIDLNKVN---PRGGAIALGHPLGCTGARQVATILREL
2d3mB           VFKSVGPEDWNSLFWIPHPGGRAILDQVEAKLKLRPE--KFRAARTVLWDYGNMVSASVGYILDEMRRKS
1chwA           LVEAFEPLGISSIFWIAHPGGPAILDQVEQKL---ALKPEKMNATREVLSEYGNMSSACVLFILDEMRKK
1cgkA           LVEAFEPLDYNSIFWIAHPGGPAILDQVEQKLALKPEK---MNATREVLSEYGNMSSACVLFILDEMRKK
2ahbA           GRRAMDAAGVRIDVFVPHQANSRINELLVKNLQLRPDA----VVANDIEHTGNTSAASIPLAMAELLTTG
1cmlA           LVEAFEPLGISSIFWIAHPGGPAILD--QVEQKLALKPEKMNATREVLSEYGNMSSACVLFILDEMRKKS
2d3mA           VFKSVGITPPESLFWIPHPGGRAILDQVEAKLKLRPEKF--RAARTVLWDYGNMVSASVGYILDE---MR
1aw1B           VINTLEGAIIAYEPIWAIGTGKAATAEDAQRIHAQIRAHIAEKSSVKPENAAAYFAQPDIDGAL------
1bq6A           LVEAFEISDYNSIFWIAHPGGPAILDQVEQKLALKPEK---MNATREVLSEYGNMSSACVLFILDERKKS
3e1hA           AKASLQYQKPADFDWAMHPGGATILS-----GAESAMGEHMRASYDRYINHGNSSSATIFSVLNRLREKD
2c7yA           AVKAAGLELDDIDLFEINEAFASQFVYCRNKLG---LDPEKINVNGGAMAIGHPLGATGARCVATLLHEM
2dv1A           DTFARMAEETVALIAGGHTFGKTHGAGPASNVGAEPEAAGIEAQGLGWKSAYR-----------------
1bi5A           LVEAFEPLGISSIFWIAHPGGPAILDQVEQKLALKPEK---MNATREVLSEYGNMSSACVLFILDEMRKK
1eblA           VDETLAANNNDLDWLVPHQANLRIISATAKKLGS-------DNVVVTLDRHGNTSAASVPCALDE---AV
2aj9A           GRRAMDAAGVRIDVFVPHQANSRINELLVKNLQLRPDA----VVANDIEHTGNTSAASIPLAMAELLTTG
2eknA           FRKAVARIKKPETVKLIKEGKIEKGNVLATAQIAGILACHPIPITGVDITFDFGEDYIEVTCEV--RAYY
1aw1A           VINTLEGAIIAYEPIWAIGTGKAATAEDAQRIHAQIRAHIAEKSSVKPENAAAYFAQPDIDGAL------
2dv2A           DTFARMAEETVALIAGGHTFGKTHGAGPASNVGAEPEA--------------------------------
1ekrA           VREARAFVTRSETLAMIIDGRHHKGDVFATARIAGIQACHPLMLSKVEVNLQAEPEHNRVRIETLCRLTG
2eknB           FRKAVARIKKPETVKLIKEGKIEKGNVLATAQIAGILACHPIPITGVDITFDFGEDYIEVTCEVR--AYY
1eksA           VREARAFVTRSETLAMIIDGRHHKGDVFATARIAGIQACHPLMLSKVEVNLQAEPEHNRVRIETLCRLTG
2ebdB           CREVLGVKPEEVSLVIPHQANVRIIN-----ALAEKLNIPKEKVFVNIQKYGNTSAASIPIALHE---AI
2ebdA           CREVLGVKPEEVSLVIPHQANVRIIN-----ALAEKLNIPKEKVFVNIQKYGNTSAASI---PIALHEAI
3dtvA           MREATGLSTAVLNGLRALGVRRVALATAYIDDVNERLAAF-LAEESLVPTGCRSLDTATLVDLCVRAFEA
3bbnE           VRTVLEMAGVENALGKQLGSNNALNNARATIVAVQTMRQFSD-VARDRGIP-------------------
1afwB           VLEATGLQVQDIDIFEINEAFAAQALIHKLG-----IDLNKVNPRGGAIALGHPLGCTGARQVATILREL
1dluA           DITVDAYIRGATLDSMAKLRPAFDKEGTVTAGNASGLNDGAAGRIVSWATVGVDPKVMGTGPIPASRKAL
1d1qB           E-VEKANLENRNKIDSFGTSNYHVGESPDHRTVSICKQHGVKIIGMDESNINNLKKIQPEGSKAKVCLFG
3do6A           FYPNAAVLVATVRALKYHGGANLKNIHEENLEALKEGFKNRVHVENLRKFNLP-----------------
1d1pB           E-VEKANLENRNKIDSFGTSNYHVGESPDHRTVSICKQHGVKIIGMDESNINNLKKIQPEGSKAKVCLFG
3d2eA           VTKALAKLSAEVDFVEIIGGTTRIPTLKQSISEAFGKPLSTTLNQDEAIAKGAAFICAIHSPTLRVRPFK
2d0oA           LVARGAGIASDISLIRINEATPVIGDVA------------------------------------------
2d0pC           LALVARGAGAVISLIRINEATPVIGDVA-METITETIITESTMIGHNPKTPGGAGLGTGI----------
1d1pA           E-VEKANLENRFNKIDSFGTSNHVGESPDHRTVSICKQHGVKIIGMDESNINNLKKIQPEGSKAKVCLFG
3cfiB           VGYRIKDERLWWRYPDTPAGQEGVVTPLLSDVEELNVRDGKQWINEWSNELTLPAAISVE----------
2d0oC           LALVARGIASDISLIRINEATPVIGDV-------------------------------------------


                         .         .         .         .         *         .         .:420
query           EHGFIAPSINIEELDEQAAGLNIVXXXXXXXXXXVMSNSFGFGGTNATLVMRKL
2byzA           EHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRK-
2bz4D           EHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRK-
2byyA           EHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRK-
1dd8A           EHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRK-
1e5mA           AEDKVPPTINLENPDPECDLDYVPGQSRALIVDVALSNSFGFGGHNVTLAFKK-
2buhA           EHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRK-
3e60A           RDNIAPATLNLENPSIETKIDLVPHKPRERKIDTVLSNSFGFGGTNASLVMRR-
2c9hA           YYQKLPPTLNLDCSEPEFDLNYVPQEWKTEKRFIGLTNSFGFGGTNATLCIAGL
1ek4A           EHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRK-
1b3nA           RDQAVPPTINLDNPDEGCDLDFVPEARQVSGMEYTLCNSFGFGGTNGSLIFKKI
2bywA           EHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRK-
2almA           RHNFVPMTAGTSEVSDYIEANVVYAQGLEKEIPYAISNTFGFGGHNAVLAFKR-
1ee0A           MAEGKSTTGE--------------------GLDCGVLFGFGPGMTVETVVLR--
2d51B           AAKGLETYGEGLEW--------------------GVLLGFGPGITVETILLH--
1eb4A           AEGDVISGGNAHAEPVAMAADNLALAIAEIGSLSEPPFLVENGGVNSGFMI---
1ee0B           MAEGKSTTGEGLD--------------------CGVLFGFGPGMTVETVVLR--
1d6iA           TQNGLKTTGE--------------------GLEWGVLFGFGPGLTIETVVLR--
1e1cB           HIAGIDTPQVEGGTTA-EIVEAFKKSGAQVADLCSSAKVYAQQGLEVAKALK--
2ccaA           TNTPTKWDNSFLEILYGYEWEGAWQYTAKDGAGAGTIPDPFGGPGRSPTM----
1d6hA           TQNGLKTTGEGLE--------------------WGVLFGFGPGLTIETVVLR--
2d51A           AAKGLETYGEGLEW--------------------GVLLGFGPGITVETILLH--
2c7yB           KRRGKDCRFG-------------------------VVSMCIGTGMGAAAVFER-
2ccdA           WDNSFLEILYGYEWELTK------------SPAGAWQYTAKDGAGAGTIPDPF-
1afwA           KKDQIGVVSMCIGTG-MGAAAIFI------------------------------
2d3mB           AAKGLETYGEGLE--------------------WGVLLGFGPGITVETILLH--
1chwA           STQNGLKTTG-------------------EGLEWGVLFGFGPGLTIETVVLR--
1cgkA           STQNGLKTTG-------------------EGLEWGVLFGFGPGLTIETVVLR--
2ahbA           AAKPGD---------------------------LALLIGYGAGLSYAAQVVR--
1cmlA           TQNGLKTTGE--------------------GLEWGVLFGFGPGLTIETVVLRS-
2d3mA           RKSAAKGLETYGE-----------------GLEWGVLLGFGPGITVETILLH--
1aw1B           ------------------------------------------------------
1bq6A           TQNGLKTTGEGLE--------------------WGVLFGFGPGLTIETVVLR--
3e1hA           MDALAPGGKVKE---------------------YVVGCAFGPGINVEMCMLK--
2c7yA           KRRGKDCRFG-------------------------VVSMCIGTGMGAAAVFER-
2dv1A           ------------------------------------------------------
1bi5A           STQNGLKTTG-------------------EGLEWGVLFGFGPGLTIETVVLR--
1eblA           RDGRIKPGQLV------------------------LLEAFGGGFTWGSALVR--
2aj9A           AAK---------------------------PGDLALLIGYGAGLSYAAQVVR--
2eknA           KTGVEMEALTGVTVAL-----LAIWDMVKAVEKDEKGQYPYTRIENVHVVEKV-
1aw1A           ------------------------------------------------------
2dv2A           ------------------------------------------------------
1ekrA           KTGVEMEALTAASVAALTIYDMCKAVQKDMVIGPVRLLAKSSGD----------
2eknB           KTGVEMEALTGVTVAL-----LAIWDMVKAVEKDEKGQYPYTRIENVHVVEK--
1eksA           KTGVEMEALTAASVAALTIYAMCKAVQKDMVIGPVRLLAKSKSG----------
2ebdB           KEGKVKRGDLI------------------------LMTAMGGGLTWGAVLLR--
2ebdA           KEGKVKRGDLI------------------------LMTAMGGGLTWGAVLLR--
3dtvA           APD---------------------------------------------------
3bbnE           ------------------------------------------------------
1afwB           KKDQIGVV----------------------------SMCIGTGMGAAAIFIKE-
1dluA           ERAGW-------------------------------------------------
1d1qB           DWNTNDGTVQTIIEDPWYGDIQ--------------------------------
3do6A           ----VVVALNRFSTDTEKEIAYVVKECEKLGVRVAVSEVFKKGSEGG-------
1d1pB           DWNTNDGTVQTIIED---------------------------------------
3d2eA           FEDIHPYSVSYSWDKQV-------------------------------------
2d0oA           ------------------------------------------------------
2d0pC           ------------------------------------------------------
1d1pA           DWNTNDGTVQTIIED---------------------------------------
3cfiB           ------------------------------------------------------
2d0oC           ------------------------------------------------------