[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for sent8:ACF67784.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dmdC.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "3dmdB.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "2dwoA.bssp"
#ERROR : Can't open dsspfile "2ccjB.bssp"
#ERROR : Can't open dsspfile "3cmvH.bssp"
#ERROR : Can't open dsspfile "2ccgA.bssp"
#ERROR : Can't open dsspfile "2czvA.bssp"
#ERROR : Can't open dsspfile "2ccgB.bssp"
#ERROR : Can't open dsspfile "3cmvG.bssp"
#ERROR : Can't open dsspfile "2b8tA.bssp"
#ERROR : Can't open dsspfile "2dwpA.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "2dr3A.bssp"
#ERROR : Can't open dsspfile "3c95A.bssp"
#ERROR : Can't open dsspfile "1e9sF.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "2a2zD.bssp"
#ERROR : Can't open dsspfile "2bifA.bssp"
#ERROR : Can't open dsspfile "3eiuB.bssp"
#ERROR : Can't open dsspfile "1bifA.bssp"
#ERROR : Can't open dsspfile "1d1cA.bssp"
#ERROR : Can't open dsspfile "2b8wA.bssp"
#ERROR : Can't open dsspfile "3czpB.bssp"
#ERROR : Can't open dsspfile "3dm5A.bssp"
#ERROR : Can't open dsspfile "2a30D.bssp"
#ERROR : Can't open dsspfile "1e9sG.bssp"
#ERROR : Can't open dsspfile "1e9fA.bssp"
#ERROR : Can't open dsspfile "3eiuA.bssp"
#ERROR : Can't open dsspfile "2c03A.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "2cgtH.bssp"
#ERROR : Can't open dsspfile "3b2qA.bssp"
#ERROR : Can't open dsspfile "1e9cA.bssp"
#ERROR : Can't open dsspfile "2cjwB.bssp"
#ERROR : Can't open dsspfile "3cmvA.bssp"
#ERROR : Can't open dsspfile "3a1wA.bssp"
#ERROR : Can't open dsspfile "2a5gA.bssp"
#ERROR : Can't open dsspfile "3cmvC.bssp"
#ERROR : Can't open dsspfile "2akaB.bssp"
#ERROR : Can't open dsspfile "2c61B.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"
#ERROR : Can't open dsspfile "1e98A.bssp"
#ERROR : Can't open dsspfile "2axzC.bssp"
#ERROR : Can't open dsspfile "4dcgA.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "3b85A.bssp"
#ERROR : Can't open dsspfile "2a2zB.bssp"
#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "1aroP.bssp"
#ERROR : Can't open dsspfile "2c04A.bssp"
#ERROR : Can't open dsspfile "2axpA.bssp"
#ERROR : Can't open dsspfile "2bc9A.bssp"
#ERROR : Can't open dsspfile "2a30B.bssp"
#ERROR : Can't open dsspfile "3clvA.bssp"
#ERROR : Can't open dsspfile "2bjbA.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "2dr3E.bssp"
#ERROR : Can't open dsspfile "2c9yA.bssp"
#ERROR : Can't open dsspfile "3czpA.bssp"
#ERROR : Can't open dsspfile "1e9sD.bssp"
#ERROR : Can't open dsspfile "421pA.bssp"
#ERROR : Can't open dsspfile "1e9sJ.bssp"
#ERROR : Can't open dsspfile "1e2fA.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "2dr3B.bssp"
#ERROR : Can't open dsspfile "1e9dA.bssp"
#ERROR : Can't open dsspfile "1bg0A.bssp"
#ERROR : Can't open dsspfile "3cmxA.bssp"
#ERROR : Can't open dsspfile "2b8tB.bssp"
#ERROR : Can't open dsspfile "3dt2A.bssp"
#ERROR : Can't open dsspfile "1dhjA.bssp"
#ERROR : Can't open dsspfile "2bdtA.bssp"
#ERROR : Can't open dsspfile "1e0jA.bssp"
#ERROR : Can't open dsspfile "1ai4B.bssp"
#ERROR : Can't open dsspfile "2d4uA.bssp"
#ERROR : Can't open dsspfile "2bhvA.bssp"
#ERROR : Can't open dsspfile "3cddC.bssp"
#ERROR : Can't open dsspfile "2a2zA.bssp"
#ERROR : Can't open dsspfile "2a30A.bssp"
#ERROR : Can't open dsspfile "3bh0A.bssp"
#ERROR : Can't open dsspfile "2ctsA.bssp"
#ERROR : Can't open dsspfile "1e3mA.bssp"
#ERROR : Can't open dsspfile "3b2qB.bssp"
#ERROR : Can't open dsspfile "3adkA.bssp"
#ERROR : Can't open dsspfile "3bb1B.bssp"
#ERROR : Can't open dsspfile "1e4yA.bssp"
#ERROR : Can't open dsspfile "1e3aB.bssp"
#ERROR : Can't open dsspfile "3dt4A.bssp"
#ERROR : Can't open dsspfile "3cr7C.bssp"
#ERROR : Can't open dsspfile "2b8tC.bssp"
#ERROR : Can't open dsspfile "3da4A.bssp"
#ERROR : Can't open dsspfile "2b92B.bssp"
#ERROR : Can't open dsspfile "1e59A.bssp"
#ERROR : Can't open dsspfile "3bo6B.bssp"
#ERROR : Can't open dsspfile "1e9rE.bssp"
#ERROR : Can't open dsspfile "1cr1A.bssp"
#ERROR : Can't open dsspfile "3cddF.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "2c61A.bssp"
#ERROR : Can't open dsspfile "1e3mB.bssp"
#ERROR : Can't open dsspfile "3d3kA.bssp"
#ERROR : Can't open dsspfile "2bkhA.bssp"
#ERROR : Can't open dsspfile "3d7wA.bssp"
#ERROR : Can't open dsspfile "1cjaA.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1e0jB.bssp"
#ERROR : Can't open dsspfile "4atjA.bssp"
#ERROR : Can't open dsspfile "2d4hB.bssp"
#ERROR : Can't open dsspfile "3dfoD.bssp"
#ERROR : Can't open dsspfile "3dfpD.bssp"
#ERROR : Can't open dsspfile "3be4A.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "1cr4A.bssp"
#ERROR : Can't open dsspfile "2c7cH.bssp"
#ERROR : Can't open dsspfile "1dekB.bssp"
#ERROR : Can't open dsspfile "3dfpC.bssp"
#ERROR : Can't open dsspfile "3dfqA.bssp"
#ERROR : Can't open dsspfile "3dftC.bssp"
#ERROR : Can't open dsspfile "3dftD.bssp"
#ERROR : Can't open dsspfile "2a5jA.bssp"
#ERROR : Can't open dsspfile "2d4uB.bssp"
#ERROR : Can't open dsspfile "3dfnC.bssp"
#ERROR : Can't open dsspfile "1cr2A.bssp"
#ERROR : Can't open dsspfile "3dm9B.bssp"
#ERROR : Can't open dsspfile "2akaA.bssp"
#ERROR : Can't open dsspfile "1aldA.bssp"
#ERROR : Can't open dsspfile "1e2kA.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"
#ERROR : Can't open dsspfile "1bglA.bssp"
#ERROR : Can't open dsspfile "2d0kA.bssp"
#ERROR : Can't open dsspfile "1cfrA.bssp"
#ERROR : Can't open dsspfile "2c0bL.bssp"
#ERROR : Can't open dsspfile "2eg5G.bssp"
#ERROR : Can't open dsspfile "1d6jB.bssp"
#ERROR : Can't open dsspfile "3dfnD.bssp"
#ERROR : Can't open dsspfile "3dfnA.bssp"
#ERROR : Can't open dsspfile "3dfqD.bssp"
#ERROR : Can't open dsspfile "1e9sB.bssp"
#ERROR : Can't open dsspfile "2bkiA.bssp"
#ERROR : Can't open dsspfile "3bgwA.bssp"
#ERROR : Can't open dsspfile "2d4hA.bssp"
#ERROR : Can't open dsspfile "2bx2L.bssp"
#ERROR : Can't open dsspfile "3dtbB.bssp"
#ERROR : Can't open dsspfile "3cmvE.bssp"
#ERROR : Can't open dsspfile "3bgwD.bssp"
#ERROR : Can't open dsspfile "3dt4C.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "3czjA.bssp"
#ERROR : Can't open dsspfile "2c9oC.bssp"
#ERROR : Can't open dsspfile "1e2gA.bssp"
#ERROR : Can't open dsspfile "3d3qA.bssp"
#ERROR : Can't open dsspfile "3d3qB.bssp"
#ERROR : Can't open dsspfile "3cr7D.bssp"
#ERROR : Can't open dsspfile "2ck3C.bssp"
#ERROR : Can't open dsspfile "3dlbB.bssp"
#ERROR : Can't open dsspfile "1adoA.bssp"
#ERROR : Can't open dsspfile "3cioD.bssp"
#ERROR : Can't open dsspfile "3cr7A.bssp"
#ERROR : Can't open dsspfile "3c8uA.bssp"
#ERROR : Can't open dsspfile "6aldA.bssp"
#ERROR : Can't open dsspfile "2dr3C.bssp"
#ERROR : Can't open dsspfile "1e9sM.bssp"
#ERROR : Can't open dsspfile "3bb1A.bssp"
#ERROR : Can't open dsspfile "3cmtD.bssp"
#ERROR : Can't open dsspfile "2c4rL.bssp"
#ERROR : Can't open dsspfile "1dkiA.bssp"
#ERROR : Can't open dsspfile "3ch4B.bssp"
#ERROR : Can't open dsspfile "3dt7A.bssp"
#ERROR : Can't open dsspfile "2dr3F.bssp"
#ERROR : Can't open dsspfile "1ak2A.bssp"
#ERROR : Can't open dsspfile "3dfqC.bssp"
#ERROR : Can't open dsspfile "1eilA.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "2boeX.bssp"
#ERROR : Can't open dsspfile "3bczC.bssp"
#ERROR : Can't open dsspfile "3dfoC.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "3dffA.bssp"
#ERROR : Can't open dsspfile "1dg3A.bssp"
#ERROR : Can't open dsspfile "2ausC.bssp"
#ERROR : Can't open dsspfile "3cddD.bssp"
#ERROR : Can't open dsspfile "3cnlA.bssp"
#ERROR : Can't open dsspfile "2a1fF.bssp"
#ERROR : Can't open dsspfile "2dflA.bssp"
#ERROR : Can't open dsspfile "3cm0A.bssp"
#ERROR : Can't open dsspfile "1akeA.bssp"
#ERROR : Can't open dsspfile "3ec1A.bssp"
#ERROR : Can't open dsspfile "2ahwD.bssp"
#ERROR : Can't open dsspfile "2bhvD.bssp"
#ERROR : Can't open dsspfile "1e9sI.bssp"
#ERROR : Can't open dsspfile "1bmfC.bssp"
#ERROR : Can't open dsspfile "1e9rF.bssp"
#ERROR : Can't open dsspfile "1dhiA.bssp"
#ERROR : Can't open dsspfile "3bb1E.bssp"
#ERROR : Can't open dsspfile "3bjdB.bssp"
#ERROR : Can't open dsspfile "1e9rD.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1cjtC.bssp"
#ERROR : Can't open dsspfile "2dpyB.bssp"
#ERROR : Can't open dsspfile "2dr3D.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "2bofX.bssp"
#ERROR : Can't open dsspfile "2a1fD.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "2bwjA.bssp"
#ERROR : Can't open dsspfile "3dymA.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "3bv4A.bssp"
#ERROR : Can't open dsspfile "2ancF.bssp"
#ERROR : Can't open dsspfile "3di4A.bssp"
#ERROR : Can't open dsspfile "1e9sH.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "2bhjA.bssp"
#ERROR : Can't open dsspfile "1ek0A.bssp"
#ERROR : Can't open dsspfile "3cphA.bssp"
#ERROR : Can't open dsspfile "3dauA.bssp"
#ERROR : Can't open dsspfile "1cs4C.bssp"
#ERROR : Can't open dsspfile "1draA.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "2b8wB.bssp"
#ERROR : Can't open dsspfile "2ahvA.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "1e2hB.bssp"
#ERROR : Can't open dsspfile "3bpbA.bssp"
#ERROR : Can't open dsspfile "3a00A.bssp"
#ERROR : Can't open dsspfile "3bb1F.bssp"
#ERROR : Can't open dsspfile "2ccjA.bssp"
#ERROR : Can't open dsspfile "2czvB.bssp"
#ERROR : Can't open dsspfile "2cvfA.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "2dftA.bssp"
#ERROR : Can't open dsspfile "2aumA.bssp"
#ERROR : Can't open dsspfile "3dyoA.bssp"
#ERROR : Can't open dsspfile "1e4vA.bssp"
#ERROR : Can't open dsspfile "3cmwC.bssp"
#ERROR : Can't open dsspfile "3ecpA.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "2bv7A.bssp"
#ERROR : Can't open dsspfile "3bwdD.bssp"
#ERROR : Can't open dsspfile "3cbnA.bssp"
#ERROR : Can't open dsspfile "2aunA.bssp"
#ERROR : Can't open dsspfile "3brwA.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "1dw9A.bssp"
#ERROR : Can't open dsspfile "1av6A.bssp"
#ERROR : Can't open dsspfile "2drcA.bssp"
#ERROR : Can't open dsspfile "3cueF.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "1dyhA.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "1e2iB.bssp"
#ERROR : Can't open dsspfile "1e2iA.bssp"
#ERROR : Can't open dsspfile "3cnnA.bssp"
#ERROR : Can't open dsspfile "3bb1C.bssp"
#ERROR : Can't open dsspfile "3d1mB.bssp"
#ERROR : Can't open dsspfile "2aunB.bssp"
#ERROR : Can't open dsspfile "1culC.bssp"
#ERROR : Can't open dsspfile "1e2nB.bssp"
#ERROR : Can't open dsspfile "1e9sE.bssp"
#ERROR : Can't open dsspfile "3crmA.bssp"
#ERROR : Can't open dsspfile "3bs4A.bssp"
#ERROR : Can't open dsspfile "1dvrA.bssp"
#ERROR : Can't open dsspfile "2d7vA.bssp"
#ERROR : Can't open dsspfile "2d7vB.bssp"
#ERROR : Can't open dsspfile "2a5vA.bssp"
#ERROR : Can't open dsspfile "2dftC.bssp"
#ERROR : Can't open dsspfile "4dfrA.bssp"
#ERROR : Can't open dsspfile "3bjqB.bssp"
#ERROR : Can't open dsspfile "5dfrA.bssp"
#ERROR : Can't open dsspfile "3dvlD.bssp"
#ERROR : Can't open dsspfile "3b55A.bssp"
#ERROR : Can't open dsspfile "2a5vB.bssp"
#ERROR : Can't open dsspfile "1dp0A.bssp"
#ERROR : Can't open dsspfile "3a00B.bssp"
#ERROR : Can't open dsspfile "1accA.bssp"
#ERROR : Can't open dsspfile "1c9kC.bssp"
#ERROR : Can't open dsspfile "3cmuA.bssp"
#ERROR : Can't open dsspfile "1e9sL.bssp"
#ERROR : Can't open dsspfile "2bkeA.bssp"
#ERROR : Can't open dsspfile "1e9rG.bssp"
#ERROR : Can't open dsspfile "2dpyA.bssp"
#ERROR : Can't open dsspfile "3cr7B.bssp"
#ERROR : Can't open dsspfile "2e85B.bssp"
#ERROR : Can't open dsspfile "1eamA.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "3bb1G.bssp"
#ERROR : Can't open dsspfile "2aumB.bssp"
#ERROR : Can't open dsspfile "2cdnA.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "2a1fE.bssp"
#ERROR : Can't open dsspfile "2c5mD.bssp"
#ERROR : Can't open dsspfile "3d1mA.bssp"
#ERROR : Can't open dsspfile "1drbA.bssp"
#ERROR : Can't open dsspfile "2anbA.bssp"
#ERROR : Can't open dsspfile "1e2mB.bssp"
#ERROR : Can't open dsspfile "3cbqA.bssp"
#ERROR : Can't open dsspfile "3dm5B.bssp"
#ERROR : Can't open dsspfile "3c14C.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "2b8tD.bssp"
#ERROR : Can't open dsspfile "1e2nA.bssp"
#ERROR : Can't open dsspfile "2ancD.bssp"
#ERROR : Can't open dsspfile "3dkvA.bssp"
#ERROR : Can't open dsspfile "2a1fC.bssp"
#ERROR : Can't open dsspfile "2a78A.bssp"
#ERROR : Can't open dsspfile "3bb1H.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "2e85A.bssp"
#ERROR : Can't open dsspfile "1e2jA.bssp"
#ERROR : Can't open dsspfile "1e1qB.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "3c15C.bssp"
#ERROR : Can't open dsspfile "3bm2B.bssp"
#ERROR : Can't open dsspfile "1chdA.bssp"
#ERROR : Can't open dsspfile "3cmvB.bssp"
#ERROR : Can't open dsspfile "3ed8A.bssp"
#ERROR : Can't open dsspfile "3b85B.bssp"
#ERROR : Can't open dsspfile "1e9rB.bssp"
#ERROR : Can't open dsspfile "1cjuC.bssp"
#ERROR : Can't open dsspfile "2bhvC.bssp"
#ERROR : Can't open dsspfile "2an9A.bssp"
#ERROR : Can't open dsspfile "2b0lC.bssp"
#ERROR : Can't open dsspfile "2ancB.bssp"
#ERROR : Can't open dsspfile "1e2lA.bssp"
#ERROR : Can't open dsspfile "3b9qA.bssp"
#ERROR : Can't open dsspfile "1cjvC.bssp"
#ERROR : Can't open dsspfile "3e8aC.bssp"
#ERROR : Can't open dsspfile "3bb1D.bssp"
#ERROR : Can't open dsspfile "1agpA.bssp"
#ERROR : Can't open dsspfile "3c85A.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "1e9sA.bssp"
#ERROR : Can't open dsspfile "3dfdA.bssp"
#ERROR : Can't open dsspfile "2aexA.bssp"
#ERROR : Can't open dsspfile "3c7kA.bssp"
#ERROR : Can't open dsspfile "3ci2A.bssp"
#ERROR : Can't open dsspfile "2c9gA.bssp"
#ERROR : Can't open dsspfile "1e6vC.bssp"
#ERROR : Can't open dsspfile "1azsC.bssp"
#ERROR : Can't open dsspfile "3c7kC.bssp"
#ERROR : Can't open dsspfile "1e2kB.bssp"
#ERROR : Can't open dsspfile "1e2mA.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "3cqcA.bssp"
#ERROR : Can't open dsspfile "1e2lB.bssp"
#ERROR : Can't open dsspfile "2c95B.bssp"
#ERROR : Can't open dsspfile "1e9sK.bssp"
#ERROR : Can't open dsspfile "1d6aA.bssp"
#ERROR : Can't open dsspfile "1dwmA.bssp"
#ERROR : Can't open dsspfile "2a5fA.bssp"
#ERROR : Can't open dsspfile "2bwjD.bssp"
#ERROR : Can't open dsspfile "1d2zD.bssp"
#ERROR : Can't open dsspfile "3do6A.bssp"
#ERROR : Can't open dsspfile "1e2jB.bssp"
#ERROR : Can't open dsspfile "3dvlC.bssp"
#ERROR : Can't open dsspfile "2dx7A.bssp"
#ERROR : Can't open dsspfile "2b0lB.bssp"
#ERROR : Can't open dsspfile "2bwjB.bssp"
#ERROR : Can't open dsspfile "3cddE.bssp"
#ERROR : Can't open dsspfile "3cr8B.bssp"
#ERROR : Can't open dsspfile "2axnA.bssp"
#ERROR : Can't open dsspfile "3dmdA.bssp"
#ERROR : Can't open dsspfile "3dzvA.bssp"
#ERROR : Can't open dsspfile "1dapA.bssp"
#ERROR : Can't open dsspfile "1as2A.bssp"
#ERROR : Can't open dsspfile "3cwzA.bssp"
#ERROR : Can't open dsspfile "2atvA.bssp"

## Summary of PDB Search
:242
    2e-42  11%  3dmdC  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    2e-41  27%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-39  11%  3dmdB  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    5e-37  20%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    8e-37  14%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    2e-35   8%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    2e-35  11%  2ccjB  [x.x.x] THYMIDYLATE KINASE
    7e-35  11%  3cmvH  [x.x.x] PROTEIN RECA
    6e-34  11%  2ccgA  [x.x.x] THYMIDYLATE KINASE
    9e-34   6%  2czvA  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    1e-33  11%  2ccgB  [x.x.x] THYMIDYLATE KINASE
    1e-33  11%  3cmvG  [x.x.x] PROTEIN RECA
    1e-32   9%  2b8tA  [x.x.x] THYMIDINE KINASE
    1e-32   8%  2dwpA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    2e-32  24%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN
    6e-32  11%  2dr3A  [x.x.x] UPF0273 PROTEIN PH0284
    6e-32  12%  3c95A  [x.x.x] EXODEOXYRIBONUCLEASE I
    8e-32  13%  1e9sF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    9e-32  15%  1e69A  [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN
    1e-31   9%  2a2zD  [x.x.x] DEOXYCYTIDINE KINASE
    1e-31  10%  2bifA  [c.37.1 - c.60.1] PROTEIN
    2e-31   7%  3eiuB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    4e-31   8%  1bifA  [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/
    4e-31  10%  1d1cA  [c.37.1 - b.34.3] MYOSIN
    5e-31  11%  2b8wA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    5e-31  12%  3czpB  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    6e-31  12%  3dm5A  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    1e-30   9%  2a30D  [x.x.x] DEOXYCYTIDINE KINASE
    2e-30  14%  1e9sG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-30  14%  1e9fA  [c.37.1] THYMIDYLATE KINASE
    2e-30   8%  3eiuA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    3e-30  15%  2c03A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    8e-30  18%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-29   8%  2cgtH  [x.x.x] 60 KDA GROEL
    1e-29  10%  3b2qA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    1e-29  11%  1e9cA  [c.37.1] THYMIDYLATE KINASE
    2e-29  13%  2cjwB  [x.x.x] GTP-BINDING PROTEIN GEM
    2e-29  13%  3cmvA  [x.x.x] PROTEIN RECA
    8e-29  10%  3a1wA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    1e-28   8%  2a5gA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    2e-28  10%  3cmvC  [x.x.x] PROTEIN RECA
    3e-28  11%  2akaB  [x.x.x] DYNAMIN-1
    5e-28   8%  2c61B  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    9e-28  11%  2cckA  [x.x.x] THYMIDYLATE KINASE
    1e-27  11%  1e98A  [c.37.1] THYMIDYLATE KINASE
    1e-27   7%  2axzC  [x.x.x] PRGX
    2e-27   6%  4dcgA  [x.x.x] VP39
    2e-27  11%  1e9rA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-27  20%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    8e-27  10%  3b85A  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    1e-26   9%  2a2zB  [x.x.x] DEOXYCYTIDINE KINASE
    2e-26  10%  1e2dA  [c.37.1] THYMIDYLATE KINASE
    2e-26   6%  1aroP  [e.8.1] T7 RNA POLYMERASE
    2e-26  13%  2c04A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    2e-26   9%  2axpA  [x.x.x] HYPOTHETICAL PROTEIN BSU20280
    3e-26  10%  2bc9A  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-25   7%  2a30B  [x.x.x] DEOXYCYTIDINE KINASE
    3e-25  13%  3clvA  [x.x.x] RAB5 PROTEIN, PUTATIVE
    3e-25  13%  2bjbA  [x.x.x] 3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE
    4e-25  28%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    6e-25  12%  2dr3E  [x.x.x] UPF0273 PROTEIN PH0284
    7e-25  13%  2c9yA  [x.x.x] ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL
    1e-24  13%  3czpA  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    2e-24  13%  1e9sD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-24  10%  421pA  [x.x.x] H-RAS P21 PROTEIN
    3e-24  14%  1e9sJ  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-24  11%  1e2fA  [c.37.1] THYMIDYLATE KINASE
    3e-24  33%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-24  13%  2dr3B  [x.x.x] UPF0273 PROTEIN PH0284
    3e-24  11%  1e9dA  [c.37.1] THYMIDYLATE KINASE
    6e-24   9%  1bg0A  [a.83.1 - d.128.1 (1m15A)] ARGININE KINASE
    7e-24  11%  3cmxA  [x.x.x] PROTEIN RECA
    8e-24   7%  2b8tB  [x.x.x] THYMIDINE KINASE
    9e-24  10%  3dt2A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    1e-23  12%  1dhjA  [c.71.1] DIHYDROFOLATE REDUCTASE
    2e-23  12%  2bdtA  [x.x.x] BH3686
    2e-23  10%  1e0jA  [c.37.1] DNA HELICASE
    3e-23  10%  1ai4B  [d.153.1] PENICILLIN AMIDOHYDROLASE
    4e-23  11%  2d4uA  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    5e-23   6%  2bhvA  [x.x.x] COMB10
    5e-23  10%  3cddC  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    7e-23   8%  2a2zA  [x.x.x] DEOXYCYTIDINE KINASE
    8e-23  10%  2a30A  [x.x.x] DEOXYCYTIDINE KINASE
    1e-22   6%  3bh0A  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    1e-22   7%  2ctsA  [x.x.x] CITRATE SYNTHASE
    1e-22  12%  1e3mA  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    1e-22  10%  3b2qB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    1e-22   9%  3adkA  [x.x.x] ADENYLATE KINASE
    3e-22  10%  3bb1B  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    4e-22  12%  1e4yA  [c.37.1 - g.41.2] ADENYLATE KINASE
    5e-22  11%  1e3aB  [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT
    6e-22  11%  3dt4A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    6e-22  11%  3cr7C  [x.x.x] ADENYLYL-SULFATE KINASE
    7e-22   7%  2b8tC  [x.x.x] THYMIDINE KINASE
    7e-22   9%  3da4A  [x.x.x] COLICIN-M
    7e-22   9%  2b92B  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-21  11%  1e59A  [c.60.1] PHOSPHOGLYCERATE MUTASE
    1e-21   7%  3bo6B  [x.x.x] HYDROPHILIC PROTEIN, VIRA PROTEIN
    1e-21  14%  1e9rE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-21  15%  1cr1A  [c.37.1] DNA PRIMASE/HELICASE
    1e-21   8%  3cddF  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    1e-21  29%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-21  11%  2c61A  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    2e-21  11%  1e3mB  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    2e-21   8%  3d3kA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
    2e-21   7%  2bkhA  [x.x.x] UNCONVENTIONAL MYOSIN
    4e-21  12%  3d7wA  [x.x.x] BETA-GALACTOSIDE-SPECIFIC LECTIN 1
    4e-21  12%  1cjaA  [d.144.1] PROTEIN (ACTIN-FRAGMIN KINASE)
    4e-21  12%  1e6cA  [c.37.1] SHIKIMATE KINASE
    6e-21  10%  1e0jB  [c.37.1] DNA HELICASE
    6e-21  10%  4atjA  [a.93.1] PROTEIN (PEROXIDASE C1A)
    8e-21   8%  2d4hB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    8e-21  11%  3dfoD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    8e-21  11%  3dfpD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    8e-21   9%  3be4A  [x.x.x] ADENYLATE KINASE
    8e-21  20%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-21  13%  1cr4A  [c.37.1] DNA PRIMASE/HELICASE
    9e-21  12%  2c7cH  [x.x.x] 60 KDA CHAPERONIN
    9e-21   7%  1dekB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    9e-21  12%  3dfpC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-20  11%  3dfqA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-20  11%  3dftC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-20  11%  3dftD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-20  10%  2a5jA  [x.x.x] RAS-RELATED PROTEIN RAB-2B
    1e-20  12%  2d4uB  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    1e-20  11%  3dfnC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-20  14%  1cr2A  [c.37.1] DNA PRIMASE/HELICASE
    1e-20  12%  3dm9B  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    2e-20  11%  2akaA  [x.x.x] MYOSIN II HEAVY CHAIN
    2e-20  12%  1aldA  [c.1.10 (2aldA)] ALDOLASE A
    2e-20   9%  1e2kA  [c.37.1] THYMIDINE KINASE
    2e-20  12%  2cckB  [x.x.x] THYMIDYLATE KINASE
    2e-20  11%  1bglA  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    3e-20  11%  2d0kA  [x.x.x] DIHYDROFOLATE REDUCTASE
    3e-20  13%  1cfrA  [x.x.x] RESTRICTION ENDONUCLEASE
    3e-20   7%  2c0bL  [x.x.x] RIBONUCLEASE E
    3e-20   7%  2eg5G  [x.x.x] XANTHOSINE METHYLTRANSFERASE
    4e-20  13%  1d6jB  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    5e-20  11%  3dfnD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    5e-20  11%  3dfnA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    6e-20  11%  3dfqD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    7e-20  11%  1e9sB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    9e-20   8%  2bkiA  [x.x.x] UNCONVENTIONAL MYOSIN
    1e-19   5%  3bgwA  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    1e-19  10%  2d4hA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-19   9%  2bx2L  [x.x.x] RIBONUCLEASE E
    1e-19  11%  3dtbB  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    2e-19   9%  3cmvE  [x.x.x] PROTEIN RECA
    2e-19   6%  3bgwD  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    2e-19  13%  3dt4C  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    2e-19  20%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-19   5%  3czjA  [x.x.x] BETA-GALACTOSIDASE
    2e-19  10%  2c9oC  [x.x.x] RUVB-LIKE 1
    2e-19  11%  1e2gA  [c.37.1] THYMIDYLATE KINASE
    3e-19   9%  3d3qA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    3e-19   9%  3d3qB  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    3e-19  13%  3cr7D  [x.x.x] ADENYLYL-SULFATE KINASE
    4e-19   6%  2ck3C  [x.x.x] ATP SYNTHASE ALPHA CHAIN HEART ISOFORM
    5e-19   7%  3dlbB  [x.x.x] ARGONAUTE
    5e-19  12%  1adoA  [c.1.10] ALDOLASE
    6e-19   5%  3cioD  [x.x.x] TYROSINE-PROTEIN KINASE ETK
    6e-19  12%  3cr7A  [x.x.x] ADENYLYL-SULFATE KINASE
    6e-19  15%  3c8uA  [x.x.x] FRUCTOKINASE
    7e-19  11%  6aldA  [c.1.10] FRUCTOSE-1,6-BIS(PHOSPHATE) ALDOLASE
    7e-19  12%  2dr3C  [x.x.x] UPF0273 PROTEIN PH0284
    9e-19  12%  1e9sM  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-18  13%  3bb1A  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-18  13%  3cmtD  [x.x.x] PROTEIN RECA
    1e-18   7%  2c4rL  [x.x.x] RIBONUCLEASE E
    1e-18   8%  1dkiA  [d.3.1] PYROGENIC EXOTOXIN B ZYMOGEN
    1e-18   6%  3ch4B  [x.x.x] PHOSPHOMEVALONATE KINASE
    1e-18  11%  3dt7A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    2e-18  12%  2dr3F  [x.x.x] UPF0273 PROTEIN PH0284
    2e-18  13%  1ak2A  [x.x.x] ADENYLATE KINASE ISOENZYME-2
    2e-18  12%  3dfqC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-18  11%  1eilA  [d.32.1 - d.32.1] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE
    2e-18  20%  2d2eA  [x.x.x] SUFC PROTEIN
    2e-18  11%  2boeX  [x.x.x] ENDOGLUCANASE E-2
    2e-18   8%  3bczC  [x.x.x] PROTEIN MEMO1
    2e-18  12%  3dfoC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-18  38%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    3e-18  10%  3dffA  [x.x.x] TEICOPLANIN PSEUDOAGLYCONE DEACETYLASES ORF2
    3e-18   9%  1dg3A  [c.37.1 - a.114.1] PROTEIN (INTERFERON-INDUCED
    3e-18  10%  2ausC  [x.x.x] PSEUDOURIDINE SYNTHASE
    4e-18  11%  3cddD  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    5e-18  10%  3cnlA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    5e-18  17%  2a1fF  [x.x.x] URIDYLATE KINASE
    6e-18  10%  2dflA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    6e-18  13%  3cm0A  [x.x.x] ADENYLATE KINASE
    7e-18  12%  1akeA  [c.37.1 - g.41.2] ADENYLATE KINASE
    7e-18   7%  3ec1A  [x.x.x] YQEH GTPASE
    7e-18  11%  2ahwD  [x.x.x] PUTATIVE ENZYME YDIF
    7e-18   6%  2bhvD  [x.x.x] COMB10
    8e-18  13%  1e9sI  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    8e-18   7%  1bmfC  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    1e-17  12%  1e9rF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-17  11%  1dhiA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-17  11%  3bb1E  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-17  18%  3bjdB  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)
    2e-17  12%  1e9rD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-17  26%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-17   9%  1afrA  [a.25.1] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    4e-17  18%  1cjtC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    4e-17  12%  2dpyB  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    4e-17  13%  2dr3D  [x.x.x] UPF0273 PROTEIN PH0284
    5e-17  17%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    6e-17   9%  2bofX  [x.x.x] ENDOGLUCANASE E-2
    7e-17  16%  2a1fD  [x.x.x] URIDYLATE KINASE
    1e-16  11%  1d6jA  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    2e-16  12%  2bwjA  [x.x.x] ADENYLATE KINASE 5
    2e-16   6%  3dymA  [x.x.x] BETA-GALACTOSIDASE
    2e-16  30%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-16  12%  3bv4A  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-16  14%  2ancF  [x.x.x] GUANYLATE KINASE
    2e-16   6%  3di4A  [x.x.x] UNCHARACTERIZED PROTEIN DUF1989
    3e-16  13%  1e9sH  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-16  30%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    3e-16   9%  2bhjA  [x.x.x] NITRIC OXIDE SYNTHASE
    4e-16  18%  1ek0A  [c.37.1] PROTEIN (GTP-BINDING PROTEIN YPT51)
    4e-16  13%  3cphA  [x.x.x] RAS-RELATED PROTEIN SEC4
    4e-16  12%  3dauA  [c.71.1 (1ddrA)] DIHYDROFOLATE REDUCTASE
    5e-16  18%  1cs4C  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    5e-16  11%  1draA  [c.71.1] DIHYDROFOLATE REDUCTASE
    7e-16  17%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    7e-16   8%  2b8wB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    7e-16  12%  2ahvA  [x.x.x] PUTATIVE ENZYME YDIF
    9e-16  17%  1ckvA  [x.x.x] PROTEIN (PROTEIN B)
    9e-16  10%  1e2hB  [c.37.1] THYMIDINE KINASE
    1e-15   7%  3bpbA  [x.x.x] DIMETHYLARGININE DIMETHYLAMINOHYDROLASE
    1e-15  14%  3a00A  [x.x.x] GUANYLATE KINASE
    1e-15  11%  3bb1F  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-15  13%  2ccjA  [x.x.x] THYMIDYLATE KINASE
    2e-15   8%  2czvB  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    2e-15  12%  2cvfA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB
    2e-15   6%  1dekA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    2e-15  12%  1cr0A  [c.37.1] DNA PRIMASE/HELICASE
    3e-15  10%  2dftA  [x.x.x] SHIKIMATE KINASE
    3e-15  10%  2aumA  [x.x.x] HYPOTHETICAL PROTEIN
    3e-15   7%  3dyoA  [x.x.x] BETA-GALACTOSIDASE
    3e-15   9%  1e4vA  [c.37.1 - g.41.2] ADENYLATE KINASE
    4e-15  11%  3cmwC  [x.x.x] PROTEIN RECA
    4e-15  12%  3ecpA  [x.x.x] TN5 TRANSPOSASE
    4e-15  35%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    4e-15  11%  2bv7A  [x.x.x] GLYCOLIPID TRANSFER PROTEIN
    4e-15   8%  3bwdD  [x.x.x] RAC-LIKE GTP-BINDING PROTEIN ARAC6
    5e-15   9%  3cbnA  [x.x.x] CONSERVED PROTEIN MTH639
    6e-15   8%  2aunA  [x.x.x] HYPOTHETICAL PROTEIN
    6e-15  10%  3brwA  [x.x.x] RAP1 GTPASE-ACTIVATING PROTEIN 1
    6e-15  17%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    7e-15   8%  1dw9A  [a.35.1 - d.72.1] CYANATE LYASE
    8e-15   8%  1av6A  [c.66.1] PROTEIN (VP39 PROTEIN (E.C.2.7.7.19))
    1e-14  12%  2drcA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-14  11%  3cueF  [x.x.x] GTP-BINDING PROTEIN YPT1
    1e-14  26%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-14  12%  1dyhA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-14  10%  1bccF  [f.27.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    1e-14  14%  1e2iB  [c.37.1] THYMIDINE KINASE
    1e-14   8%  1e2iA  [c.37.1] THYMIDINE KINASE
    2e-14  12%  3cnnA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    2e-14   9%  3bb1C  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-14  12%  3d1mB  [x.x.x] SONIC HEDGEHOG PROTEIN
    2e-14   9%  2aunB  [x.x.x] HYPOTHETICAL PROTEIN
    2e-14  17%  1culC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    3e-14  11%  1e2nB  [c.37.1] THYMIDINE KINASE
    4e-14  11%  1e9sE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-14  10%  3crmA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    5e-14   8%  3bs4A  [x.x.x] UNCHARACTERIZED PROTEIN PH0321
    7e-14  10%  1dvrA  [c.37.1 - g.41.2] ADENYLATE KINASE
    7e-14  14%  2d7vA  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    7e-14  14%  2d7vB  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    8e-14   8%  2a5vA  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    8e-14  13%  2dftC  [x.x.x] SHIKIMATE KINASE
    8e-14  12%  4dfrA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-13  10%  3bjqB  [x.x.x] PHAGE-RELATED PROTEIN
    1e-13  11%  5dfrA  [x.x.x] DIHYDROFOLATE REDUCTASE
    1e-13  13%  3dvlD  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    2e-13   7%  3b55A  [x.x.x] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN
    2e-13   8%  2a5vB  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    2e-13  10%  1dp0A  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    2e-13  16%  3a00B  [x.x.x] GUANYLATE KINASE
    3e-13  12%  1accA  [x.x.x] ANTHRAX PROTECTIVE ANTIGEN
    3e-13  12%  1c9kC  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    3e-13  11%  3cmuA  [x.x.x] PROTEIN RECA
    3e-13  11%  1e9sL  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-13  11%  2bkeA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    3e-13  11%  1e9rG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-13  12%  2dpyA  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    5e-13  11%  3cr7B  [x.x.x] ADENYLYL-SULFATE KINASE
    5e-13  17%  2e85B  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    6e-13  11%  1eamA  [c.66.1] PROTEIN (VP39)
    8e-13  21%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-12  10%  3bb1G  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-12   8%  2aumB  [x.x.x] HYPOTHETICAL PROTEIN
    1e-12  13%  2cdnA  [x.x.x] ADENYLATE KINASE
    2e-12  21%  2d2fA  [x.x.x] SUFC PROTEIN
    2e-12  16%  2a1fE  [x.x.x] URIDYLATE KINASE
    2e-12  15%  2c5mD  [x.x.x] CTP SYNTHASE
    2e-12  14%  3d1mA  [x.x.x] SONIC HEDGEHOG PROTEIN
    2e-12   9%  1drbA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-12  11%  2anbA  [x.x.x] GUANYLATE KINASE
    3e-12  10%  1e2mB  [c.37.1] THYMIDINE KINASE
    4e-12  13%  3cbqA  [x.x.x] GTP-BINDING PROTEIN REM 2
    4e-12  11%  3dm5B  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    5e-12  16%  3c14C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    6e-12  17%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    7e-12   7%  2b8tD  [x.x.x] THYMIDINE KINASE
    8e-12   8%  1e2nA  [c.37.1] THYMIDINE KINASE
    1e-11  11%  2ancD  [x.x.x] GUANYLATE KINASE
    1e-11  19%  3dkvA  [x.x.x] ADENYLATE KINASE
    1e-11  16%  2a1fC  [x.x.x] URIDYLATE KINASE
    1e-11  13%  2a78A  [x.x.x] RAS-RELATED PROTEIN RAL-A
    2e-11   8%  3bb1H  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    3e-11  22%  1d8jA  [a.4.5] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    4e-11  12%  2e85A  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    4e-11  11%  1e2jA  [c.37.1] THYMIDINE KINASE
    5e-11   7%  1e1qB  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    5e-11  21%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    7e-11  16%  3c15C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    8e-11   5%  3bm2B  [x.x.x] PROTEIN YDJA
    8e-11  14%  1chdA  [x.x.x] CHEB METHYLESTERASE
    9e-11   9%  3cmvB  [x.x.x] PROTEIN RECA
    1e-10  16%  3ed8A  [x.x.x] YELLOW FLUORESCENCE PROTEIN
    1e-10  11%  3b85B  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    2e-10  17%  1e9rB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-10  14%  1cjuC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    4e-10   7%  2bhvC  [x.x.x] COMB10
    4e-10  11%  2an9A  [x.x.x] GUANYLATE KINASE
    5e-10  12%  2b0lC  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    7e-10  11%  2ancB  [x.x.x] GUANYLATE KINASE
    7e-10  15%  1e2lA  [c.37.1] THYMIDINE KINASE
    7e-10  10%  3b9qA  [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT
    1e-09  17%  1cjvC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    2e-09  13%  3e8aC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    2e-09  11%  3bb1D  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-09  10%  1agpA  [x.x.x] C-H-RAS P21 PROTEIN
    2e-09  15%  3c85A  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    2e-09  16%  1ckeA  [c.37.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    4e-09  11%  1e9sA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    8e-09   9%  3dfdA  [x.x.x] PROTEIN YQBN
    9e-09   9%  2aexA  [x.x.x] COPROPORPHYRINOGEN III OXIDASE, MITOCHONDRIAL
    9e-09  17%  3c7kA  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
    5e-08  10%  3ci2A  [x.x.x] CHYMOTRYPSIN INHIBITOR 2
    5e-08   8%  2c9gA  [x.x.x] PENTON PROTEIN
    6e-08   9%  1e6vC  [d.58.31] METHYL-COENZYME M REDUCTASE I GAMMA SUBUNIT
    6e-08  13%  1azsC  [c.37.1 - a.66.1] GS-ALPHA
    1e-07   9%  3c7kC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
    4e-07   8%  1e2kB  [c.37.1] THYMIDINE KINASE
    4e-07   6%  1e2mA  [c.37.1] THYMIDINE KINASE
    4e-07  12%  1e2hA  [c.37.1] THYMIDINE KINASE
    5e-07   8%  3cqcA  [x.x.x] NUCLEAR PORE COMPLEX PROTEIN NUP107
    5e-07  12%  1e2lB  [c.37.1] THYMIDINE KINASE
    5e-07  11%  2c95B  [x.x.x] ADENYLATE KINASE 1
    6e-07  14%  1e9sK  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-06   5%  1d6aA  [d.165.1] POKEWEED ANTIVIRAL PROTEIN
    2e-06  13%  1dwmA  [d.40.1] LINUM USITATISSINUM TRYPSIN INHIBITOR
    2e-06  10%  2a5fA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    1e-05  24%  2bwjD  [x.x.x] ADENYLATE KINASE 5
    1e-05  11%  1d2zD  [a.77.1] DEATH DOMAIN OF TUBE
    1e-05  18%  3do6A  [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
    2e-05  13%  1e2jB  [c.37.1] THYMIDINE KINASE
    3e-05  13%  3dvlC  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    8e-05   8%  2dx7A  [x.x.x] ASPARTATE RACEMASE
    1e-04  12%  2b0lB  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    1e-04  16%  2bwjB  [x.x.x] ADENYLATE KINASE 5
    2e-04   6%  3cddE  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    2e-04  15%  3cr8B  [x.x.x] SULFATE ADENYLYLTRANFERASE, ADENYLYLSULFATE
    3e-04   7%  2axnA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    5e-04  13%  3dmdA  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    6e-04  17%  3dzvA  [x.x.x] 4-METHYL-5-(BETA-HYDROXYETHYL)THIAZOLE KINASE
    7e-04  16%  1dapA  [c.2.1 - d.81.1] DIAMINOPIMELIC ACID DEHYDROGENASE
    7e-04  18%  1as2A  [x.x.x] GIA1
    8e-04  23%  3cwzA  [x.x.x] RAS-RELATED PROTEIN RAB-6A
    9e-04  15%  2atvA  [x.x.x] RAS-LIKE ESTROGEN-REGULATED GROWTH INHIBITOR
:242

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSIQLNGINCFYGAHQALFDITLDCPEGETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLTIAGNHFDFTK
3dmdC           --KEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVI---------
3b5jA           --ITFRNIRFRYDSPVILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGHDLA---
3dmdB           --KEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAG
2d3wB           --LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLL-
2c03B           --VILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQ---
2dwoA           --SRVQKIWVPVD-HRPSLPRSCGPNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFN------V
2ccjB           ----------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGG----
3cmvH           --DRSMDVETISTGSLSLDIALGAGPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHAL--
2ccgA           ----------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVP--
2czvA           ---------------GGVKFIEMDIRDKEAYELAKEWFDEVVVSIKFNEEVDKEKLREARKEYGKVAILL
2ccgB           ---------------------------SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREP------
3cmvG           ----VETISTGSLSLDIA-LGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHAL--
2b8tA           ---------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFK------P
2dwpA           --------------QSRVQKIWVPVDHRNSIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFN------V
3b60A           --LEFRNVTFTYPGRPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREYT
2dr3A           -----------TGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEH---
3c95A           WHPENRNAVIMVDLAGDISPLLELDSDTLRAVPVKLVHINKCPVLAQANTLRPEDADRLGINRQHCL-DN
1e9sF           -GGKLKRMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDM--
1e69A           ---------------KSFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENLPNGS
2a2zD           ---------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQS
2bifA           ------------------------CPT--LIVMVGLPARGKTYISKKLTRYLNFIGVPTRE--FNVGQYR
3eiuB           NPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAF--AVVFAAM
1bifA           ---------------------------PTLIVMVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQYR--
1d1cA           GRRRNEVAPHIFAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQAGVLEQQ---
2b8wA           --CLIENTNGRLMANPALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKG---
3czpB           KDAYKEQLAAEQARLAGLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAAPTEE--
3dm5A           -----------TKFLGTEAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTW---
2a30D           ---------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQS
1e9sG           -GGKLKRMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDM--
1e9fA           ---------------------------GALIVLEGVDGAGKSTQSRKLVEALCAAGHRAELLRF------
3eiuA           --YARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAA---
2c03A           --VILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQ---
2bbsA           --EGFGELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQ
2cgtH           --KSFGAPTITKDGVSVAREIELDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGAVTAAVE
3b2qA           --YARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGS--ESAFAVVFAAM
1e9cA           ---------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRF------
2cjwB           --------------------------TYYRVVLIGEQGVGKSTLANIFAGVEDTYERTLMVDGE------
3cmvA           ----VETISTGSLSLDIA-LGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDP
3a1wA           -----------------------------KVALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVF
2a5gA           ---------------------------EMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYK
3cmvC           GEDRSMDVETISTGSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHAL--
2akaB           --------PLVNRLQDAFSAIGQNDLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL
2c61B           ---ARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAA---
2cckA           ----------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTG
1e98A           ---------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLR-------
2axzC           --------------------------------------------------------------PDLFDKNF
4dcgA           --------------------------GILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHD
1e9rA           -GGKLKRMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDM--
2awnD           -SVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM----
3b85A           ----------IRPKTLGQKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIILTRPA----
2a2zB           ---------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQS
1e2dA           ---------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERS--
1aroP           ----------------------------------------------------------------------
2c04A           --VILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQR--
2axpA           ------------------------------IILEGPDCCFKSTVAAKLSKELKYPIIKGSS--FELAKSG
2bc9A           --CLIENTNGRLMAPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIWM
2a30B           ---------------------------IKKISIEGNIAAGKSTFVNILKWEVVPEPVARWCNVQSTNVLQ
3clvA           ----------------------MEKKSSYKTVLLGESSVGKSSIVLRLTKDTFHENTNTTIGASFCTYVV
2bjbA           ----------GVGSELTVSGRIEPGPGAR--VDCGLAG----TVLRFVPPLAALGSVPVTFDGD--QARG
2d62A           --VKLINIWKRFGDVTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLRIAGLEEPTRGQIYIEDNLVADPEK
2dr3E           -----------TGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVA------L
2c9yA           ---------------------------GIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAM----
3czpA           --------------LAGLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVP--IAAPTEE
1e9sD           -GGKLKRMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDM--
421pA           ---------------------------EYKLVVVGARGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVV
1e9sJ           -GGKLKRMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDM--
1e2fA           ---------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTE
2awnC           -----------LQNVTVSKDINLDIHEGEFVVFVGPSGC-------------------------------
2dr3B           -----------TGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQ
1e9dA           ---------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRF------
1bg0A           -----------MGATLLDVIQSGVENLDSGVGIYAPDAESYRTFGPLFDPIIDDYHGGFKLTDKH-----
3cmxA           ------------------ALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKT--CAFIDAEHAL
2b8tB           ---------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKILPSV
3dt2A           ---------GWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDA
1dhjA           ----------------------------------------------------------------------
2bdtA           ----------------------------KLYIITGPAGVGKSTTCKRLAAQLDNSAYIEGDIINGGYRPP
1e0jA           -EHLSSSVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLA-------
1ai4B           --------------------LTINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTNPKVYNPQSGYI
2d4uA           --------------------------------PLGSGGLFFNALKNCKENFTVLQTI--RQQQSTLNGSW
2bhvA           ----------------------------------------------------------------------
3cddC           -----------------------------VLKAGGKIYQGWTKIGITRSLEA-SGAFDLETYKFQYKAFI
2a2zA           ---------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVAR------
2a30A           ---------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQS
3bh0A           IESADGNITGVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEMGKKE
2ctsA           -----------TNLKDILADLKEQARIKTFRQQHGNTAVGQITVDMMYGGMRGMKGLVYETSV----LDP
1e3mA           -------------------------------------LVNLAERAYTLNYTCPTFIDKPGIRITEGR---
3b2qB           ----RLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAF--AVVFAAM
3adkA           --------------------MEEKLKKSKIIFVVGGPGSGKGTQCEKIVQKYGYTHLST---GDLLRAEV
3bb1B           --SGINTFAPATQLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSGPRPVMVSR
1e4yA           ------------------------------IILLGALVAGKGTQAQFIMEKYGIPQISTGDML------R
1e3aB           -----------WTQQAAKQALTINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGKW--DWKGLLP
3dt4A           -----------LAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDA
3cr7C           ---------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDN---
2b8tC           ---------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVK--YLVFKPKIDS
3da4A           --VLHPGISVYDAYHF---AKPAPSQYDYRSMNMKQMSGNVTTPIVALAHYLWGNGAERSVNIAGLKISP
2b92B           --CLIENTNGRLMANPALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTV---QSHTKG
1e59A           ---------------------------GESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDF
3bo6B           --HSLHNQMRQMPMSHFREALDAPDYSGMRQSGFFAMSQGFQLESHG-----GDVFMHAHRENPQCKGDF
1e9rE           -GGKLKRMTREKAKQVTVAGVPMPDAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLS
1cr1A           --SSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAM------
3cddF           ITGYVDDWVPSYDESTITISRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTDVGEPFQ
2awnB           -SVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTP
2c61A           --YARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAF------AVV
1e3mB           ----------------------------------------------------------------------
3d3kA           ----------------LSVAEKHGLTLERRLEMTGVCASQMALTLLGGPQRPTVALLCGPHVKGAQGIS-
2bkhA           -----------FAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEAN
3d7wA           ----------FSNNIPLLRQSTVPVSEGQRFVLVELTNAGGDTITAAIDVTNLYVVAYEAGNQSYFLSDA
1cjaA           ----------------------------------------TTSAPEVLTKSTMQQLGSLMALDVIVNNSD
1e6cA           ----------------------------EPIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQHTS---
1e0jB           --SSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAML-----
4atjA           ----------------------------------------------VRDTIVNELRSDPRIAASILRLH-
2d4hB           MTCLIENTNGRLMANPEALKISAITQPMVVVAIVGLYRTGKSYLMNWMWCVPHPKKPGHILVLLDTEGLG
3dfoD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
3be4A           -------------------------SKKHNLILIGAPGSGKGTQCEFIKKEYGL--AHLSTGDMLREAIK
2bbsB           ----TEVVMENVTAFWVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGK--IKHSGRISFC
1cr4A           --SSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKV--------GL
2c7cH           -------------------------------------------ITEGLKAVAAGMNPMDLKRG--IDKAV
1dekB           ------------------------------IFLSGVKRSGKDTTADFIMSNYSAVKYQLAGP--------
3dfpC           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
2a5jA           ------------------------------YIIIGDTGVGKSCLLLQFTDKRFQPIGVEFG---ARMVNI
2d4uB           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
1cr2A           --SSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAML-----
3dm9B           --VKEAVSEILETSRRIDLIEEIRKAEKPYVIFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAG
2akaA           -----------FAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQANGSGVLEQQ
1aldA           ----------------------------------------------------------------------
1e2kA           -------------------------PTLLRVYIDGPHGMGKTTTTQLLVADDIVYVPEPMTYWRVLGA--
2cckB           ------------------------------ITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTG
1bglA           ---------SDMYTPYVFPSENGLRCGTRELNYGPHQWRGDFQFNISRYSQQQLMETSLNIDGFHMDDSW
2d0kA           ----------------------------------------------------------------------
1cfrA           ------------------------------MDIISKSGEGNKYTINSAIAFVAYASNTTEFSKVLSGLRD
2c0bL           ---------------------------GGISRRIELKEALASLELPLIVRTAGVGKSAEALQWDLSFRLK
2eg5G           -AYNQLVLAKVKCVRELLRANLPNINKCIKVADLGCAS-GPNTLLTVRDIVQSIDKVGQLERPTIQIFLN
1d6jB           -----------ASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRF
3dfnD           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
1e9sB           -GGKLKRMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVD-------
2bkiA           -----------FAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEAN
3bgwA           -----------PSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEMGK--
2d4hA           --CLIENTNGRLMANPALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQKGIWMWCV
2bx2L           ----------------------------------------------------------------------
3dtbB           IASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDA
3cmvE           DRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDP
3bgwD           IESADGNITGVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEMGKKE
3dt4C           -----------LAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDA
2bbtB           --ELFEKAKQNNNNTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFC--
3czjA           ----------------------------------------------------------------------
2c9oC           ---------------VIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVY---
1e2gA           ---------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTE
3d3qA           --------------------------KPFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVYQGDIGT
3d3qB           ---------------------------PFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVYQGDIGT
3cr7D           ---------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRF
2ck3C           --IPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLY----
3dlbB           ----------------------VWVEGLAVYRREHARGPGWRVLGGAVLDLWVSDSGAFLLEVDPAYRIL
1adoA           ----------------------------------------------------------------------
3cioD           -------------------FAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGY
3cr7A           ---------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIR-
3c8uA           -----------ALCQGVLERLDPRQPGRQLVALSGAPGSGKSTLSNPLAAALSAQGLPAEVVPDGFHLDN
6aldA           ----------------------------------------------------------------------
2dr3C           -----------TGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEE----
1e9sM           -GGKLKRMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDM--
3bb1A           --SGINTFAPATKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVS
3cmtD           -------------------------PMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEH----
2c4rL           --------------RAGGISRRIELKEALASLELPEGMGLIVRTAGVGKSAEALQWDLSFRLKH------
1dkiA           --LDSKGIHYNQGNPYTPVIEKVKPGEQSFVGQHAATGSVATATAQIMKYHNYPNKGLKDYTYT------
3ch4B           -------------------MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLR--LSGPLKE
3dt7A           -----------LAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDA
2dr3F           -----------TGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQ
1ak2A           -------------------------PKGVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGD--MLRAMVA
3dfqC           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2d2eA           --LEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLDGENILE
2boeX           ----------------------------------------------------------------------
3bczC           ----------------------SHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCG--
3dfoC           ----------------------------------------------------------------------
1b0uA           --LHVIDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNINLVR
3dffA           ---------------------------------------------RLLAISPHLDDAVLSFGAG---LAQ
1dg3A           --CLIENTNGRLMANPALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKHTKGI------WMWCVPH
2ausC           ----------------------------------------------------------------------
3cddD           -------------------EIVLKAGGKIYQGWTKIGI---------TRSLEASGAFDLETYKFNDAQYK
3cnlA           ---------THKGEPRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAKGIQWFSLENGVKILDT
2a1fF           ----------------------------------------------------------------------
2dflA           -----------TGSQALDGLLAGGIETRTMTEFFGEFGSGKTQLCHQLSVNVQLPPEKGGLSGKAVYIDT
3cm0A           ---------------------------GQAVIFLGPPGAGKGTQASRLAQELGFKKLSTGDILR------
1akeA           ------------------------------IILLGAPGAGKGTQAQFIMEKYGIPQ-------ISTGDML
3ec1A           ---------AKGIGMAKVMEAINRYREGGDVYVVGCTNVGKSTFINRIIEEATGKGNVITTSYFPG----
2ahwD           ----INGRVPVLSAQEAVNYI----PDEATLCVLGAILEATTLITALADKYKQTQTPRNLSIISPTGLGD
2bhvD           ----------------------------------------------------------------------
1e9sI           -GGKLKRMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLS
1bmfC           --IPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKK------K
1e9rF           -GGKLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDM--
1dhiA           ----------------------------------------------------------------------
3bb1E           --SGINTFAPATQLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISP--FQSEGPRPVM
3bjdB           ----------------------------------------------------------------------
1e9rD           -GGKLKRMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVL-------LRELAYTGLLRGDRMVIVD
2awoA           -SVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKS---------TLLRMIAGLETITSGDLFI
1afrA           --------------REVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDPASDLNT
1cjtC           ---------------------------THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNL---
2dpyB           --LQRTPIEHVLDTGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIGER---GR
2dr3D           -----------TGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQ
2d3wA           --LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLLA
2bofX           -----------------------------------------------------PNMSSAEWVRNN-----
2a1fD           ----------------------------------------------------------------------
1d6jA           -----------ASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAY--RLDGDNI
2bwjA           --------------------FMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASE
3dymA           ----------------------------------------------------------------------
2awoC           -----------LQNVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTP
3bv4A           ----------------------------------------------------------------------
2ancF           --------------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQVLATGVD
3di4A           -----------EVLVPPREGRCFEVKAGQFFRISSVEGPQ-----VGDLNLHNLHDLTERFFSGKTRALH
1e9sH           -GGKLKRMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG----
3d31A           --IEIESLSRKWK-NFSLDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGKDV----
2bhjA           --------------------------------------------------IKNWGSGEILHDTLH---HK
1ek0A           ------------------------------LVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGA--AFLTQ
3cphA           ------------------------------ILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTV
3dauA           ----------------------------------------------------------------------
1cs4C           ---------------------------THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKEA
1draA           ----------------------------------------------------------------------
2d3wD           --LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEV---TGGTVEFKGKD
2b8wB           --CLIENTNGRLMANPALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIWM
2ahvA           ----INGRVPVLSAQEAVNYI----PDEATLCVLGAILEATTLITALADKYKQTQTPRNLSIISPTGLGD
1ckvA           ----IMGLKGKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPTRAGYWWIKAN
1e2hB           -------------------------PTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIV-YVPEPMTYWRV
3bpbA           -----------GLTSSHLGKPDYAKALEQHNAYIRALQTCDVDITLLPPDERFPDSVFVEDPVCTSRCAI
3a00A           ----------------------------RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTRAGE
3bb1F           --SGINTFAPATQLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVS
2ccjA           ----------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMT---REPGGV
2czvB           ------GVKFIEMDIRDKEAYELAKEWFEVVVSIKFNEEVDKEKLREARKEYGKVAILLSNPKPSLV---
2cvfA           -----------TGTKSLDSLLGGGFAPGVLTQVYGPYASGKTTLALQTGLLSGKKVAYVDTEGGFS----
1dekA           ------------------------------IFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPI----KDA
1cr0A           --SSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVE
2dftA           ------------------------------AVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRS
2aumA           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1e4vA           ------------------------------IILLGAPVAGKGTQAQFIMEKYGIPQ-------ISTGDML
3cmwC           --------------SLSLDIALGAGPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKT--CAFIDAEHAL
3ecpA           --------------------------------------------------LHRAADWAKSVFSSAALGDP
3dhwC           --IKLSNITKVFHTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLS
2bv7A           ----------------------------------------------------------------------
3bwdD           ---------------------------FIKCVTVGDGAVGKTCLLISYTSNTFPFSANVVLGLWDTAGED
3cbnA           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
3brwA           -KLECNPTARIYLGKEHFNYYSLDTALGHLVFSLKYDVIGDQEHLRLLLRTKCRTYHDVIPISCLTEFPN
2d3wC           --LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLLA
1dw9A           -SQINRNIRLDLADA----ILLSKAKKDLSFAEIDGTGLAEAFVTAALLGQQALPADAARLVG--AKLDL
1av6A           -EPESANEVAKKLPYQGLFFLSLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHD
2drcA           ----------------------------------------------------------------------
3cueF           -----------------------EYDYLFKLLLIGNSGVGKSCLLLRFSDDYISTIGV----DFKIKTVE
3bk7A           ---------VKDYGSFKLEVEPGEIRKGEVIGIVGPNGIGKTTFVK-------------------MLAGV
1dyhA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1e2iB           -------------------------PTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEP-------
1e2iA           -------------------------PTLLRVYIDGPHGMGKTDDIVYVPEPMTYWRVLGAS-ETIANIYT
3cnnA           ---------THKGEPRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAGIQWFSLENGVKILDTP
3bb1C           --SGINTFAPATQLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSIS--PFQSEGPRPVM
3d1mB           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
1culC           ---------------------------THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDI------K
1e2nB           -------------------------PTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEP--MTYWR
1e9sE           -GGKLKRMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVD-------
3crmA           ---------------------------PPAIFLMGPTAAGKTDLAMALADALPCELISVDSALIYRGMDI
3bs4A           -------------------------KHSLILIHEEDASSRGKDILFYILSRKLKSDNL--VGMFSISYPL
1dvrA           ---------------------------SIRMVLIGPPGAGKGTQAPNLQ-------ERFHAAHLATGDML
2d7vA           --AALSSCHLVFLSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPTL-------
2d7vB           --AALSSCHLVFLSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPTL-------
2a5vA           --------HVIDSAVLGSIEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYV-----------
2dftC           ------------------------------AVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRS
4dfrA           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
3dvlD           ---EHQAIAKMRTMIEGFDDISGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGV---FVTFEE
3b55A           ----------------------------------------------------------------------
2a5vB           --------HVIDSAVLGSIEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYV-----------
1dp0A           ---------SDMYTPYVFPSENGLRCGTRELNYGPHQWRGDFQFQQQLMETSHRHLLHAEEGGIGGDDSW
3a00B           ----------------------------RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVS---STTRTP
1accA           -----------ETTARIIFNGKDLNLVERRIAAVNPSTTKPDMTLEALKIAFGEPNGNLQYQGKDIT---
1c9kC           ------------------------------ILVTGGARSGKSRHAEALIGDAPQVLYIATSQILHHKDGR
3cmuA           --------------SLSLDIALGAGPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEH----
1e9sL           --GKLKRMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVD-------
2bkeA           --KKERNVKKISTGSQALDGLLAGGIETRTTEFFGEFGSGKTQLCH------QLSVNVQLPPEKGGLSGK
1e9rG           -GGKLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDM--
2dpyA           --LQRTPIEHVLDTGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIGERGR---
3cr7B           ---------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRF
2e85B           ----------------------------------------------------------------------
1eamA           ---------------------------ILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRH-H
2bbtA           --EGFGELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSE---GKIKHSGRISF
3bb1G           --SGINTFAPATKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVS
2aumB           ----------------------------------------------------------------------
2cdnA           ---------------------------HMRVLLLGPPGAGKGTQAVKL----AEKLGIPQISTGELFRR-
2d2fA           --LEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEI---LLDGEN
2a1fE           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
2anbA           --------------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRP
1e2mB           -------------------------PTLLRVYIDGPHGMGKTTTTQLLVALGSRDDI--VYVPEPMTYWR
3cbqA           ------------------------------VMLVGESGVGKSTLAGTFGGLQGDSAHEPENPED--TYER
3dm5B           --IIKIVYEELTKFLGTEAKPIEIKEKPTILLMVGIQGSGKTTTVA-------KLARYFQKRGYKVGVVC
3c14C           ---------------------------THRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQD--IKNNL
2awoD           -SVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTP
2b8tD           ---------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKSNIQS
1e2nA           -------------------------PTLLRVYIDGPHGMGKTTTTQLL-VALGSRDDIVYV---PEPMTY
2ancD           --------------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRP
3dkvA           ------------------------------IVLMGLPGAGKGTQAERIV--EKYGIPHISTGDMFRA---
2a1fC           ----------------------------------------------------------------------
2a78A           ------------------------------VIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKV-
3bb1H           --SGINTFAPATQLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRP----
1d8jA           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
1e2jA           -------------------------PTLLRVYIDGPHGMGKTTTTQLLR-DDIVYVPEPMTYWRVLGASE
1e1qB           -----------MQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLY----
2awnA           -SVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKR-----
3c15C           -------------------------RATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQD--IKNNL
3bm2B           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
3cmvB           GEDRSMDVETISTLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQR--------EGKTCAFI
3ed8A           --IELKGTD-FKEDGNILGHKLEYNFNSHNVYITATRGTQKNGIKANFTVRHNVEDGSVQLAD--HYQQN
3b85B           -------------------HYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIILTRPAVEAG
1e9rB           -GGKLKRMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLS
1cjuC           ---------------------------THRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIK-----
2bhvC           ----------------------------------------------------------------------
2an9A           --------------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRP
2b0lC           ----------------------------------------------------------------------
2ancB           --------------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRP
1e2lA           -------------------------PTLLRVYIDGPHGMGKTTTTQLLDIVYVPEPMTYWRVLGASET--
3b9qA           --KDALKESVLEMLAKSKTELQLGFRKPAVIMIVGVNGGGK------TTSLGKLAHRLKNEGTKVLMAAG
1cjvC           ---------------------------THRLLLLGAGESGKSTIVKQMRILHVEKATKVQ----DIKNNL
3e8aC           ---------------------------THRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLKE
3bb1D           --SGINTFAPATQTKELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVS
1agpA           ------------------------------LVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVV
3c85A           --------------------------------------------------LINPGHAQVLILGG--RIGT
1ckeA           ---------------------------APVITIDGPSGAGKGTLCKAMAEWHLLDSGVLALAALH-HHVD
1e9sA           -GGKLKRMTREKAKQVTVAGVPMPRDAEPRHLLVGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDM--
3dfdA           -TIDAEEVEVPISKRFVDKPFIFKAITTDRIDELEKENTTKELDSQRFYARIAVETTVYPTFK-------
2aexA           ----------------------------------------------------------------------
3c7kA           ------------------------------LLLLGAGESGKSTIVKQMKIIFSGEDVKQYKPVV--YSNT
3ci2A           ----------------------------------------------------------------------
2c9gA           --MVSRSLTKDKQVELKYEWVEFTLPEGNYSETMTIDLMNNAIVEHYLKGVLESDIGVKFDTRNFRLGFD
1e6vC           ----------------------------------------------------------------------
1azsC           -------------------------RATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKN----
3c7kC           ------------------------------LLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYK-----
1e2kB           -------------------------PTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPYWRVLGA
1e2mA           -------------------------PTLLRVYIDGPHGMGKTTTTQLL-------RDDIVYVPEPMTYWR
1e2hA           -------------------------PTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPE--PMTYWRVLGAS
3cqcA           --KQGNAIMRKFKKHEAAKEVFVKIPQDSIAEIYLPAEDDNAIREHLCIRAYLEAHETFNEWFKHMNSVP
1e2lB           -------------------------PTLLRVYIDGPHGMGKTTTTQLL--------------VALGSRDD
2c95B           ----------------------EKLKKTNIIFVVGGPGSGKGTQCEKI----VQKYGYTHLSTGDLLRSE
1e9sK           -----------KAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDM--
1d6aA           ------------SNIGKISGVMSFTEKTEAEFLLVAIQMVSEAARFKYIENQ-VKTNFNRA--FNPNPKV
1dwmA           ----------------------------------------------------------------------
2a5fA           ------------------------------ILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYK
2bwjD           -----------------------DLRKCKIIFIIGGPGSGKGTQCEKL--------------VEKYGFTH
1d2zD           --PAEIKKGFKYTAQDQIDEAANRLPPDQSKSQMSGKLNERPTVGVLLQLLELFSAADFVALDF--LNES
3do6A           --LYPYGHYIAKIDHRFLKSLENHEDGKLILVTATPAGEGKTTTSIGLSSLNRIGKKSIVTLR-------
1e2jB           -------------------------PTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMT-----
3dvlC           -------------------------PIGRSTLVSGTSGTGKTLF-----SIQFLYNGIIEFDEPGVFVTF
2dx7A           ----------------------------------------------------------------------
2b0lB           ----------------------------------------------------------------------
2bwjB           ----------------------EDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLST----GELLREE
3cddE           ---------------------------QGWTKIGITRSLEASGAFDLE----TYKFLGNDAQYKAFIEPI
3cr8B           ----------------------------------------------------------------------
2axnA           --SRVQKIWVPVD-HRPSLPRSCGPNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRRE
3dmdA           --KEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGK-----------------------------
3dzvA           ----------------------------------------------------------------------
1dapA           ----------NFIDEATFDSEHTGMPHGGHVITTGDTGGFNHTVEYILKLDRNPD---------------
1as2A           ------------------------------LLLLGAVESGKSTIVKQMKIIHEAGYSEEECKQYKAVVY-
3cwzA           ------------------------------LVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTM
2atvA           ------------------------------LAIFGRAGVGKSALVVRFLTKRFIWEYDPTLESTYRHQAT


                         .         .         *         .         .         .         .:140
query           TPSDKAIRELRQNVGMVFQQYNLWPHLTVVQNLIEAPCRVLGLTKDQXXXXXXXXXXXXXXXPYSDRYPL
3dmdC           --------------AASDTFRAGAIEQLEEHAKRIGV-KVIKHSYGADPAAVAYDAIQHAKARGIDVVLI
3b5jA           LADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGA
3dmdB           AI----EQLEEHAKRIGVKVIKHSYGADPAAVAYDAI--QHAKAR------------------GIDVVLI
2d3wB           --ALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLLNAVRSYRGQETLDRFDFQDLMEEKIALLKLTRSVNV
2c03B           ---RPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEAR------------------DLILV
2dwoA           GEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGG-----------------QIAVF
2ccjB           ----VPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYI-------DSSLA
3cmvH           ------DPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDDSVAALTPKAEIEGEIGDSHMGLA
2ccgA           ------TGEEIRKIVLEGNDMDIRTEAMLFAASRREH-------LVLKVIPALKEGKVVLCDRYIDSSLA
2czvA           SNPKPSVQKFKSYLIYVESNDLRVIRYSIEKGVDAIISPWVNRKDPGIDHVLAKLMVKKNVALFSLRPLL
2ccgB           ----GGVPTGEEIRKIVLEGNDMDIRTEAMLF-----AASRREHLVLKVIPALKEGKVVLCDRYIDSSLA
3cmvG           ------DPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDDSVAALTPKAEIEGEIGDSHMGLA
2b8tA           KIDTRSIRNIQSRTGTSLPSVEVESAPEILNYIMSNSVQFFDDRICEVANILAENGFVVIISGLDKNFKG
2dwpA           GEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGG-----------------QIAVF
3b60A           LASLRNQV--ALVSQNVHLFNDTVANNIAYARTEEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENGV
2dr3A           ---PVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGKE----------------------YEKYIVHD
3c95A           LKILRENPQVREKDAQLYNGFFSDADRAAMKIVLETEPRNL---PALDITFVDKRIEKLLFNYRARNFPG
1e9sF           ------LSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQR--------------------YALSVVPR
1e69A           PVRLKDIRDRFAGTGLGVDFYSIVGIDRIVNAYQRVNESFNRFISLLFFGGEGRLEISIRKPGRRDQKLS
2a2zD           TNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNEK-PVLFFERSVYSDRYIFASNLYESECMNETEWT
2bifA           RDMVKTYKSFEF---FLPDNEEGLKIRKQCALAALNDVRKFLSEEGG------------------HVAVF
3eiuB           GITNEEA---QYFMSDFEKTGALERAVVFLNLADDPADITNYAEALRQMGAAGYPGYMYTDLATLYERAG
1bifA           ---RDMVKTYKSFEFFLPDNEEGLKIRKQCALAALNDVRKFLSEEGG------------------HVAVF
1d1cA           ILQANPILEAFGNAKTTRNNNSSRFGKFIEIQF-NNAGFISGASIQSYLLEKSRVVFQSETERNYHIFY-
2b8wA           IWMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSVS
3czpB           ---ERAQPYLWRFWRHIPARRQFTIFDRSWYGRVLVERIEGFCAPADWLRAYGEINDFEEQLSEYGKFWL
3dm5A           ---RPGAYHQLRQLLDRYHIEVFGNPQEKDAIKLAKEGVDYFKSKGV------------------DIIIV
2a30D           TNVLQMMYEKPERWSFTFQTYACLSRIRAQLA-SLNGKPVLFFERSVYSDRYIFASNLYESECMNETEWT
1e9sG           ------LSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDW--------------------QRYALSVVPR
1e9fA           ---PERSTEIGKLLSSYLQKKSDVEDHSVHLLFSA-NRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGA
3eiuA           --MGITNEEAQYFMSDFEKTGALERAVVFLNLADDPAVILTDITNYAEALRQMGPGYMYTDLATLYERAG
2c03A           ---RPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEAR------------------DLILV
2bbsA           NSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISK----------------------FAEKDNIVLI
2cgtH           ELKALSVPCSDSKAIAQVGTISANSDETVGKL-IAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRG
3b2qA           GI----TNEEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAYEHGMHVLVILTDI
1e9cA           ---PERSTEIGKLLSSYLQKKSDVEDHSVHLL-FSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAYTGA
2cjwB           -SATIILLDMWENHDHMQVGDAYLIVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRREV
3cmvA           IY--------ARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVD-------------------
3a1wA           T----YKGYTINLIDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKV
2a5gA           NVKFNVWDVGGLDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQD
3cmvC           ------DPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVD--VIVVDSVAALTPKAEIEGLAAR
2akaB           VNSTTEYAEFLHCKGKKFTDFEEVRLEIEAETGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGD
2c61B           --MGITNEEAQYFMSDFEKTGALERAVVFLNLADDPAVERDITNYAEALRQMGYPGYMYTDLATLYERAG
2cckA           EEI---RKIVLEDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLC------------------DRYID
1e98A           ---FPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGA
2axzC           QRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPT-FNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPY
4dcgA           PILNGLRDVTLVTRFVDEEYLRSISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPAQWIKDF
1e9rA           ------LSKFGRDKDIILNPYDQRTKGWSFFNEI-RNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRE
2awnD           --NDTPPAERGVGMVEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIV
3b85A           VEAGEKLGFLPGDPYLRPLHDALRDVEPEVIPKLEAGIVEVAPLAYRGRTLNDAFVILDEAQNTTPAQKF
2a2zB           TNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGEKPVLFFERSVYSDRYIFASNLYESECMNETEWT
1e2dA           ------TEIGKLLSSYLQKKSDVEDHSVHLLFSAN-RWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAK
1aroP           -----------------------------------------------------------------EMGEA
2c04A           ------PAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLE----------------ARDLILV
2axpA           NEKLFEHFNKLADEDNVIIDRFVYSNLVYAKKFKDYSRFIEDKIKAKAKVVYLHADPSVIKKRLRVRGDE
2bc9A           W------CVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVL---------------LSSTFVYN
2a30B           MMYEK-----PERWSFTFQTYACLSRIRAQLASLNDAEKPVLFFERSVYSDRYIFASNLYESEMNETEWT
3clvA           NLNDENLCNIKFDIWDTAGQERYASIVPLYYRGATCAIVVFDISNSNTLDRAKTWVNQLKISSNYIIILV
2bjbA           RPIAPLLDALRE-LGVAVDGTGLPFRVRGNGSLAGGTVAIDASASSQFVSGLL--------------LSA
2d62A           GVFVPPKE-----RDVAVFQSYALYPHTVYDNI--AFPLKLRKVPKQEIDKRVREVAELGLTELLNRKPR
2dr3E           EEHPVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGK----------------------EYEKYIVHD
2c9yA           ---VASGSELGKKLKATMDAGKLVSDEMVVELIETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDS
3czpA           ERAQPYLWRFWRHIPARRQFTIFDRSWYGRVLVERIEGCAPADWLRAYGEINDFEEQLSEYGIIVVKFWL
1e9sD           ------LSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRY--------------------ALSVVPR
421pA           IDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVG
1e9sJ           ------LSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRY--------------------ALSVVPR
1e2fA           IGKLL----------SSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGA
2awnC           GKSTLLRMIAGLGVGMVFQSYALYPHLSVAEN-MSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPK
2dr3B           V------RQNMAQFGWDVKPYEEKGMFAMVDAFTAGIG-------------------------EKYIVHD
1e9dA           ---PERSTEIGKLLSSYLQKKSDVEDHSVHLL-FSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAYTGA
1bg0A           -----PPKQWGDINTLVGLDPAGQFIISTRVRCLQGYPFNPCLTAEQYKEMEEKVSSTLSSMEDELYPLT
3cmxA           DPIYA------RKLGVDIDNLLCSQPDTGEQALESVAALTPKAEARMMSQAMRKLAGNLKQSNTLLIFIN
2b8tB           EV---------ESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKG
3dt2A           QGN-------LRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAVTIT
1dhjA           -----------------------------------------------------------------NTLDK
2bdtA           WESDELLALTWKNITDLTVNFLLAQNDVVLDYIAFPDEAE-ALAQTVQAKVDDVEIRFIILWTNREELLR
1e0jA           -MLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKF----DQWFDELFGNDTFHLYDSFAEAETDRL
1ai4B           ANWNNSPQKDYPASDLFAFLWGGADRVTEIDRLLEQKPRLTADQAWDVIRQTSRQDLNLRLFLPTQAATS
2d4uA           ALLQTRNTLNRAGIRYMMDQNNIGSGSTVLMESASISLKQAEKNWADYEALPRDPRQSTAAAAEIKRNYD
2bhvA           ------------KLLRTITADKMIPAFLITPISSQIAGKVIAQVESDIFAHMGKAVLIPKGSKVIGYYSN
3cddC           KQGQACTVDIGGERVITGYVDDWVPSYDESTITISVSGRDKTADLVDIVCKPFGIKVIVNTDVGEPFQRI
2a2zA           -WCNVQSTNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKEKPVLFFERSVYSDRY---IFASNLY
2a30A           TNVLQMMYEKPERWSFTFQTYACLSRIRAQLALKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWT
3bh0A           NIKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNSNIN------------IFDKAGQSVNYIW
2ctsA           DEGIRFRGYSIPECQKMLPKAKGGEEPLPEGLFVTGQIPTEEQVSWLSKEWAKRAALPSHVVTMLDNFPT
1e3mA           ----HPVVEQVLNEPFIANPLNLSPQRRLIITGPNGGKST-YRQTALIALAYIGSYVPAQKVEIGPIDRI
3b2qB           GI----TNEEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVAEALRQMGRGYPGYMYTDLATLYERAG
3adkA           SSGSARGK--MLSEIMEKGQLVPLETVLDMLR-DAMVAKVDTSKGFLIDGYPREVKQGEEFERKIGQPTL
3bb1B           SRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDV---LLYVDRLDAYRVDNLDKLVAKAITDSF
1e4yA           AAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRN----------------------GFLLD
1e3aB           FEMNPKVYNPQKDYPASDLFAFLWGGADRVTEIDQKPRLTADQAWDVIRQTSRQDLNLRLFLPTLQAATS
3dt4A           QGNLRAI-----NPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPGVTIT
3cr7C           IRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVTGLPFVEGLYKK
2b8tC           RTGTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKG
3da4A           MKINQIKDIIKSGVVGTFPVSTKFTHATGDYNVNGSWTYNGVVRSYDDKYDFNASTHRGIIGESLTRLGA
2b92B           IWMWCVPHPKKPGHILVLLDKGDNQNDSWIFALAVLLSSTFYNSIGTINQQAMDQLYYVTELTHRIRSKS
1e59A           AYSVLKRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPE
3bo6B           AGDKFHISVQREQVPQAFQALSGLLFSVDSPIDKWKVTDMERVDQQSRVAVGAQFTLYVKPDQENSQYSA
1e9rE           KFGRDKD--------IILNPYDQRTKGWSFFNEIRNDYDW--------------------QRYALSVVPR
1cr1A           --LEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDE-------------LFGNDTFHLYDS
3cddF           RIQIEQGETPHELLARLAKQRGVLLTSDTFGNLVITRASKTKAGVSLILGDNVKAARGRFSWRQRFSKFT
2awnB           P------AERGVGMVFQSYALYPHLSVAENMSFGLKLAGA---KKEVINQRVNQVAEVLQLAHLLDRKPK
2c61A           FAAMGITNEEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAYEHGMHVLVILTDI
1e3mB           ----HPVVEQVLNEPFIANPLNLSPQRRLIITGPNGGKSTYRQTALIALAYIGSYVPAQKVEIGPIDRIF
3d3kA           -----CGRHLANHDVQVILFLPNFVKMLESITNELSLFSKTQGQQVSSLKDLPTSPVDLVINCLDCPENV
2bkhA           ----------PLLEAFGNAKTVRNNNSSRFGKHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYR
3d7wA           PAGAETQD-----FSGTTSSSQPFNGSYPDLERYAGHRDQIPLGIDQL-----------------IQSVT
1cjaA           RL-PIAWTNEGNLDNIMLSERGATVVPIDSKIIPLDASHPHGERVRELLRTLIAHPGHESSQFHSIRDII
1e6cA           GMTVADVVAAEGWPGFRRRESEALQAVATPNRVVATGGGMVLLEQNRQFMRAHGTVVYLFAPAASLQAHQ
1e0jB           ---EESVEETAEDLIGLHNRVRLRQSDSLKREI----IENGKFDQWFDELFGNDTFHLYDSFAEAETDRL
4atjA           --FEDCFVNGCDASILLDNTTSFRTEKDAFGNANSAGFPVIDRMKAAVESACPRTVSCADLLTIAAQQSV
2d4hB           QNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTLTHRIRSKSSDSADFVSFFPDFVWTLRDFSLDL
3dfoD           ------------------------------------------------------------------SHPA
3dfpD           ------------------------------------------------------------------SHPA
3be4A           NGIGLEAK---SIIESGNFVGDEIVLGLVKEKF-DLGVCVNGFVLDGFPRTIPQAEGLAKILSEIGDSLT
2bbsB           SQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNI------------------VLGGI
1cr4A           AMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTF-----------HLYDSFA
2c7cH           TAAVEELKALSVPCIAQVGTISANSDETVGKLIAEAMDKV-GKEGVITVEDGTGLQDELDVVEGMQFDRG
1dekB           ---------IKDALAYAWGVFAANTDYPLTRKEFEGIDYD---------RETNLNLTKLEVITIMEQAFC
3dfpC           -----------------------------------------------------------------HSHPA
3dfqA           ------------------------------------------------------------------SHPA
3dftC           ------------------------------------------------------------------SHPA
3dftD           ------------------------------------------------------------------SHPA
2a5jA           DGKQIKLQIWDTAGQESFRSITRSYYRGAAGA-LLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGN
2d4uB           ----------RAGIRYMMDQNNIGSGSTVAELMESASLKQAEKNWADYEALPRDPRQSTAAAAEIKRNYD
3dfnC           -----------------------------------------------------------------HSHPA
1cr2A           ---EESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELF------------GNDTFHLYDSF
3dm9B           AIEQLEEHAKRIGVKVIKHSYGADPAAVA----YDAIQHAK----------------------ARGIDVV
2akaA           IL-----QANPILEAFGNAKTTRNNNSSRFGKFIEIQFNSAGFISGASIQSYLLEKSRVVFQSNYHIFYQ
1aldA           -----------------------------------------------------------------YQYPA
1e2kA           ------SETIANIYTTQHRLDQGEISAGDAAV-VMTSAQITMGMPYAVT---------------DAVLAP
2cckB           EEIRKIVLEGDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRAL
1bglA           SPSVFQLSAGRYHYQLVWCQ---------------------------------------------APLDI
2d0kA           ----------------------ISLIAALAVDRIGNENALPWNLPA------------DLAWFKRNTLNK
1cfrA           FINDEAIRLGGKISDGSFNKCNWYEWLIGIRAVVKMPNDVMSIYKSCLSEFIYDLRSK-----LSLNNVN
2c0bL           HWEAIKKAAESRPAPFLIHQESNVIVRAFRDY-LRQDIGEILIDNPKVLELARQHIAALGRPDFSSKYTG
2eg5G           DLFPNDFNSVFKLLPSFYRKLEKENGRKIGSCLIGAMPGSFYSRLFPEESMHFLHSCYCLQWTEIGTNKG
1d6jB           -GLNKDLGFSEADRNENIRRIAEVAKLFAD--SNSIAITSFISPYRKDRDTARQLHEVATPGEETGLPFV
3dfnD           -----------------------------------------------------------------HSHPA
3dfnA           ------------------------------------------------------------------SHPA
3dfqD           ------------------------------------------------------------------SHPA
1e9sB           -PNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEI-RNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRE
2bkiA           P----------LLEAFGNAKTVRNNNSSRFGKFVEIHFSVVGGFVSHYLLEKSRICVQGKEERNYHIFYR
3bgwA           ------KENIKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNSNIN----------IFDKAGQ
2d4hA           PH-----PKKPGHILVLLDTEGLGDVENQNDSWIFALAVLLSYNSIGTINQQAMDQLYYVTELTHRIRSK
2bx2L           ------KKAAESRPAPFLIHQESNVIVRAFRDYLRQDIGEILIDNPKVLELARQHIAALGRPDFSKLYTG
3dtbB           -------QGNLRAINPENGFFGVAPGTSVKTNPNKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPGVTIT
3cmvE           IY--------ARKLGVDIDNLLCSQPDTGEQALEIC--DALARSGAVDVIVVDSVAALTPKAEIEGLAAR
3bgwD           NI--------KRLIVTAGSINAQKIKAARRDFASEDWGK----LSMAIGEISNSNINIFDKAGQSVNYIW
3dt4C           QGNLRAIN-------PENGFFGVAPGTSVKTNPNAIKTIQKNFTNVAETSDGGVYWEGIDEPLAPGVTIT
2bbtB           -SQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEK------------------DNIVLGI
3czjA           ---------------------------------------------------------------APLDNDI
2c9oC           ---STEIKKTEVLMENFRRAIGLRIKETKKKEIIVTLHDLDVAGEINKVVNKYIDQGIAELVPGVLFVDE
1e2gA           IGKLLS---------SYLQKKSDVEDHSVHLL-FSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGA
3d3qA           AKVTTEEEGIPHYIDILPPDASFYEFKKRAEKYIKDITRR-GKVPIIAGGTGLYIQSLLYNYAFEISEDK
3d3qB           AKV----TTEEEGIPHYIDILPPDASFSAYEF-KKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYNYAF
3cr7D           GLNKDLGFSEADRIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVAEETGLPFVEVYVDLYKK
2ck3C           --CIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATA-------------------------SDAAPLQ
3dlbB           CEMS--LEAWLAQGHPLPKRVRNAYDRRTWELLRLGEEDPKELPLPGG--------------LSLLDYHA
1adoA           ------------------------------------------------------------------SHPA
3cioD           SHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDHYDLV
3cr7A           -FGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFTGLPFVEVYVDVPVEVAEQRD--PKGLYKK
3c8uA           ---------------RLLEPRGLLPRKGAPETFDFEG-FQRLCHALK--------HQERVIYPLFDRARD
6aldA           ------------------------------------------------------------------SHPA
2dr3C           --HPVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGE-----------------------YEKYIVHD
1e9sM           ------LSKFGRDKDIILNPYDQRTKGWSFFNEI-RNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRE
3bb1A           RSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSF--
3cmtD           ----ALDPIYARKLGVDIDNLLCSQPDTGEQALEICPKAEMGLAARMMSQAMRKLAGNLKQSNTLLIFIN
2c4rL           --WEAIKKAAESRPAPFLIHQESNVIVRAFRDYLRQDIGEILIDNPKVLELARQHIAALGRPDFSSKYTG
1dkiA           ---LSSNNPYFNHPKNLFAAISTRQYNWNNILPTYSGRESN---VQKMAISELMADVGISVDMDYGPSSG
3ch4B           QYAQEHGL----NFQYKEAFRKDMIRWGEEKRQADTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGW
3dt7A           QGNLRAINPENGFFGVAPGTSVKTNP-----NAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPGVTIT
2dr3F           VRQN------MAQFGWDVKPYEEKGMFAMVDAFTAGIGKSKE--------------------YEKYIVHD
1ak2A           -SGSELGKKLKATMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDS
3dfqC           ------------------------------------------------------------------SHPA
1eilA           -----------------------------------------------------------------TKSVG
2d2eA           LSPDER----ARKGLFLAFQYPVVPGVTIANFLRLALQAKLGREVGVAEFWTKVKKALELLDWDESYLSR
2boeX           ----------------------------------------------------------------AHHNPG
3bczC           -SCAAHAYKQVDPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGFERSLQTD
3dfoC           ------------------------------------------------------------------SHPA
1b0uA           DKDGQLKVLLRTRLTMVFQHFNLWSHMTVLENVEAPIQVLGLSKHDARERALKYLAKVGIDERAQGKYPV
3dffA           AAQDGA------NVLVYTVFAGAAQPSPAAQRHTIWGLAPDDDAVLYRRKEDIAALDHLRVAHRHGRFLD
1dg3A           PKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHKSDSA
2ausC           -----------------------------------------------------------------DKPPG
3cddD           AQGQACTVDIGGERVITGYVDDWVPSYDESTITISVSGRDKGQFNNQTLTQIADIVCKPFGIKVEPFQRI
3cnlA           PGILY-----KNIFSEDLAAKLLLVGSLPVERIED-QRIFERAFEIFARSIGIESSFSEFFEDFARKRGL
2a1fF           ----------------------------------------------------------------------
2dflA           EGTF-----RWERIENMAKALGLDIDNVMNNIYYIRAINTDHQIAIV------------------DDLQE
3cm0A           -DHVARGTPLGERVRPIMERGDLVPDDLILELIREELAERVIFDGFPRTLAQAEALDRLL-----SETGT
1akeA           RAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDY
3ec1A           --TTLDMIEIPLESGATLYDTPGIINHHQMAHFVDARDLKIITPKREIHPRVYQLNEGQTLFFGGLARLD
2ahwD           RADRGISPLAKWALCGHWGQSPRISDLAEQNKIINYPQGVLTQTLRAAAAHQPGIISDIGIGTFVDPRQQ
2bhvD           ------------KLLRTITADKMIPAFLITPISSQIAGKVIAQVESDIFAHMGKAVLIPKGSKVIGYYSN
1e9sI           KF--------GRDKDIILNPYDQRTKGWSFFNEIRNDYD--------------------WQRYALSVVPR
1bmfC           LYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATA-------------------------SDAAPLQ
1e9rF           ------LSKFGRDKDIILNPYDQRTKGWSFFNEI-RNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRE
1dhiA           ----------------------ISLIAALAVDRIGMENAMPWNLPA------------SLAWFKRNTLDK
3bb1E           VSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSF
3bjdB           ------------------QAYAAYQQLLYV----------LSLSDDVATAQTRRWLARAIYRVEERFPAA
1e9rD           PNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQ---------------------RYALSVVPR
2awoA           GEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPK
1afrA           LDGVRDETGASPTSWAIWTRAWTAEENRHGDLL-NKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTENSP-
1cjtC           KEAIETIVAAMSNLVPPVELANPENQFRVDYI--------------------------------------
2dpyB           EVKDFIENILGPDGRARSVVIAAPADVSPLLR-MQGAAYATRIAEDFRDRGQHVLLIMDSLTRYAMAQRE
2dr3D           ------VRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGKS--------------------KEYEKYIVHD
2d3wA           LSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKLTRSVNV
2bofX           -PNDPRTPVIRDRIASV-------PQGTWFAHHNPGQITGQVDALMSAAQAAGKIPILVVSNAPGRDCGA
2a1fD           ----------------------------------------------------------------------
1d6jA           RFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDR--------------DTARQLHE
2bwjA           S-------ERSKLIRDIMERGDLVPSGIVLELLKEMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQL
3dymA           -----------------------------------------------------------------APLDN
2awoC           PAERGVGMVALYPHLSVAENMSFGLKLAGAKK-EVINQRVNQVAEVL------------QLAHLLDRKPK
3bv4A           -------------------------------------------------------------------HPA
2ancF           VFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEKRMAQAVAEMSHYAEYDYLIVNDDF
3di4A           GTHVTTGERLWSNLPYLRPATIIYGIDQYGGSVHDVIGTRCDPYTGNLLAGGHYHHCCHSNLTRALADHT
1e9sH           ----DMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDW--------------------QRYALSVVPR
3d31A           ----TDLSPEKHDIAFVYQNYSLFPHMNVKKN----LEFGMRMKKIKDPKRVLDTARDLKIEHLLDRNPL
2bhjA           ATSCLGSIMNPKSLTRGPRDKPTPLEELLPHAINQYYGSFKEAKIEEHLARLEAVTKEIETTGTYQLTLD
1ek0A           RVTINEHTVKFEIWDTAGQERAPYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQASKDIIIALVGNKI
3cphA           DINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVG
3dauA           ----------------------ISLIAALAVDR------VIGMENAMPWNLPADLAWFKR-----NTLNK
1cs4C           ---IETIVAAMSNLVPPVELANPENQFRVDYI--------------------------------------
1draA           ----------------------ISLIAALAVDRIGMENAMPWNLPA------------ELAWFKRNTLDK
2d3wD           LLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALTRSVNV
2b8wB           WCVPHPKKPGHILVLLDTEGLGDVEK---------GDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQ
2ahvA           RADRGISPLVKWALCGHWGQSPRISD-LAEQNKIIYPQGVLTQTLRAAAAHQPGIISDIGIGTFVDPRQQ
1ckvA           GKIEVDCDEISELLGRQFNVYDFLVDVSS-----------------------------------------
1e2hB           LGASETIANIYTTQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAIGGEAGSPPPALTLIFDRHPIAALL
3bpbA           ITRPGAESRRGETEIIEETVQRFYPGKVERIEAPGT--------VEAGDIMMVGDHFYIGESARTNAEGA
3a00A           VNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASV--------------------KQVSKSGKT
3bb1F           RSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLL--DKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSF
2ccjA           PTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDR------------YIDSSLA
2czvB           ---RDTVQKFKSYLIYVESNDLRVIRYSIEKGVDAIISPWVNKDPGIDHVLAKLMVKKNVALGFSLRPLL
2cvfA           ----PERLVQMAETRGLNPEEALSRFILFTPSDFKEQRRVIGSLKKTVDSNFALVVVDSITAHYRAEQVL
1dekA           LAYAWGVFAANTDYPLTRKEFETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAFNK
1cr0A           ETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDT-------------------FHLYDSFA
2dftA           IADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGN
2aumA           -------------------DQTWQPIDGRVALIAPA-----SAIATEVLEATLRQLEVHGVDYHVEARYR
3dyoA           -----------------------------------------------------------------LDNDI
1e4vA           RAAVKSGSELGKQAKDIMDAGKLVTDELVIAL-VKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVD
3cmwC           ------DPIYARKLGVDIDNLLCSQPDTGEQA-LEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDS
3ecpA           R--------RTARLVNVAAQLAKYSGKSITISSEGSKAAQEGAYRFIRNPN--------------VSAEA
3dhwC           ---ESELTKARRQIGMIFQHFNLLSSRTVFGN-VALPLELDNTPKDEVKRRVTELLSLVGLGDKHDSYPS
2bv7A           ---------------------------------------------------------------KAYEMAL
3bwdD           YN--------RLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQF
3cbnA           ------VTAGHRTTFEVTVD----PEIGETADCIIGVSSSDSISTARESLVRVILRTENGYDEIRGYGHP
2aunA           -------------------DQTWQPIDGRVALIAPA-----SAIATEVLEATLRQLEVHGVDYHVEARYR
3brwA           VVQMAKLV----CEDVNVDRFYPVLYPKASRLIVTFDEH----------------------VISNNFKFG
2d3wC           LSPEDRAGEGIFMAFQYPVEIPGVSNQALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNV
1dw9A           DEDSILLRGCIDDRIPTDPTYRFYELQVYGTTLKA-LVHEKFGDGIISAINFKLDVKKVADPEGGERAVI
1av6A           PILNGLR--------DVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILN
2drcA           ----------------------ISLIAALAVDRIGMENAMPFNLPA------------DLAWFKRNTLDK
3cueF           LDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGN
3bk7A           EEPTEGKVEWDLTVAYKPQYIKAEYEGTVYELLSKIDSS-----KLNSNFYKTELLKPLGIIDLYDRNVE
1dyhA           ---------------MIS------LIAALAVDR------VIGMENAMPWNLPADLAWFKR-----NTLDK
1bccF           --SRWLEGIRKWYYNAAFNKYGLMRDDTIYENDDVKEAI-RRLPENLYDDRMFRIKRALDLNMRQQILP-
1e2iB           -------MTYWRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPY-------AVTDAVLA
1e2iA           TQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAP-HIGGEAGPPPALTLIFDRHPIAALLCYPAA
3cnnA           GILYKNIFSEDLAAKLLLVGSLPVER-------IEDQRIFERAFEIFARSIGIESSFSEFFEDFARKRGL
3bb1C           VSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSF
3d1mB           -----------------------------------------------------------------LGASG
2aunB           --------------------------------------------------------------RHVEARYR
1culC           NNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSV--------------------------------
1e2nB           VLGASETIANIYTTQHRLDQGEISAGDAAAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIFDRHPIAA
1e9sE           -PNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSV----VPRGKTDEAEEWASYGRLL
3crmA           ------GTAKPSRELLARYPHRLIDIRDPAESYSAAEFRADALA----AMAKATARGRIPLLVGGTMLYY
3bs4A           QL----IIRILSRFGVDVIKYLENHRLAIVDTFGSFHGIMPGVWYLEGMLSSETLPIKYAKAVEDHKKVW
1dvrA           RSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILVGFPRTIPQAEKLDQMLPLEK
2d7vA           --QQLEKHHLAHENCFIAN--SVETEVVT-----------------------------------------
2d7vB           --QQLEKHHLAHENCFIAN--SVETEVVT-----------------------------------------
2a5vA           ---RDVVERVAPSVLLGRRDGLSRVDEFEQRHVHETVAILMARSSAI-----------------------
2dftC           IADIFATDG-EQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGG
4dfrA           ----------------------ISLIAALAVDR------VIGMENAMPWNLPADLAWFKR-----NTLDK
3bjqB           ----------------------------------------------------------------------
5dfrA           -----------------------------------------------------------------NTLDK
3dvlD           TPQDI--IKNARSFGWDLAKLVDEGKLFILDASPD---------------------------PEGQEVVG
3b55A           -----------------------------------------------------------------PLKTT
2a5vB           ---RDVVERVAPSVLLGRRDGLSRVDEFEQRHVHETVAILMARSSAI-----------------------
1dp0A           SPSVFQLSAGRYHYQLVWCQ-----------------------------------------------NDI
3a00B           RAGEVNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQ----------------VSKSGKT
1accA           -------------------EFDFNFDQQTSQNIKNQ----LAELNATNIYTVLDKIKLNAKMNILIRDKR
1c9kC           ----------PAHWRTARHLDTLITADLAPDDAILLECITTMVTNLLFALGD----------PEQWDYAA
3cmuA           ----ALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVD-----VIVVDSVAALTPKAEIEGE
1e9sL           -PNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYD-WQRYALSVVPRGKTDEAEEWASYGRLLLRE
2bkeA           AVYIDTEGTFRWERIENAKALGLDIDNVNNIYYIRAINTDHQIAIVD-------------------DLQE
1e9rG           ------LSKFGRDKDIILNPYDQRTKGWSFFNEI----RNDYDWQRYALSVVPRGKTDEAEEWASYGRLL
2dpyA           EVKDFIENILGPDGRARSVVIAAPADVSPLLR-MQGAAYATRIAEDFRDRGQHVLLIMDSLTRYAMAQRE
3cr7B           GLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVETGLPFVEVYVDVPV
2e85B           ----------------------------------------------------------------------
1eamA           DPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLS------------NYALQNVM
2bbtA           CSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNI-----------------VLGGI
3bb1G           RSRAGFTL--NIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSF
2aumB           -------------------DQTWQPIDGRVALIAPAS-AIATEVLEATLRQLEVHGVDYHLGRHVEARYR
2cdnA           --NIEEGTKLGVEAKRYLDAGDLVPSDLTVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDID
2d2fA           ILELSPDERARKGLFLAFQYPVEVPGVTIANFLRAKLGREVGVAEFWTKVKKALELLDWDESYLSRYLNE
2a1fE           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
3d1mA           -----------------------------------------------------------------LGASG
1drbA           ----------------------ISLIAALAVDRIGMENAMPWNLPA------------CLAWFKRNTLDK
2anbA           GEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDV----------FLDIDWQ
1e2mB           VLGASETIANIYTTQHRLDQGEISAGDAAAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIFDRHPIAA
3cbqA           RIMVDKEEVTLVVYDIWEQGDAGGWLRDHCLQTGDAFLIVFSVTDRRSFSKVPETLLRLRAGRPHHDLPV
3dm5B           SDTWRPGAYHQLRQLLDRYHIEVFGNPQEKDAIKLAKEGVDYFKSKG------------------VDIII
3c14C           KEAIETIVAAMSNLVPPVELANPENQ--------------------------------------------
2awoD           PAERGVGMVEPSVFLLDEPLDAAQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGK
2b8tD           RTGTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKG
1e2nA           WRVLGASETIANIYTTQHRLDQGEISAGDAAVVMT-SAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLI
2ancD           GEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDV----------FLDIDWQ
3dkvA           --AMKEETPLGLEAKSYIDKGELVPDEVTIGIVRER----------------------------------
2a1fC           ----------------------------------------------------------------------
2a78A           ---VLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPF
3bb1H           --VMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDV-------------LLYVDRLDAY
1d8jA           -----------------------------------------------------------------LDETQ
2e85A           ---------------------------SAVTDVLLCV-GNSMMGDDGAGPLLAEKCAA-----APKGNWV
1e2jA           TIANIYTTQHRLDQGEISAGDAAVVMTSANIT-MGMPYAVTDAVLAP-HIGGEAGSPPPALTLIFDRHPI
1e1qB           --CIYVAIGQKRSTVAQLVKRLTDADAMKYTIVYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRR
2awnA           ------MNDTPPAERGVGMVFQSYALEVINQRVNQVAE-------------------------VLAIGRT
3c15C           KEAIETIVAAMSNLVPPVELANPENQ--------------------------------------------
3bm2B           -----------------ALELLIN-RRSASRLAGEQLQNILRAGRAPDWHFFVIEGEGRERFSAVLEQGA
1chdA           ----------------------------------------------------------------------
3cmvB           DAEHALDPIYARKLGVDIDNLLCSQPDTGEQAL----EICDALARSGAVDVIVVDSVAALTPKAEIGLAA
3ed8A           TP----IGDGP----VLLPDNHYLSYQTVLSKD-------------------------------------
3b85B           -----------EKLGFLPDPYLRPLHDALRDVEP--EVIPKLEAGIVEVAPLAYRGRTLNDAFVILDEAQ
1e9rB           KRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVP-------------------------------
1cjuC           ---NNLKEAIETIVAAMSNLVPPVELANP-----------------------------------------
2bhvC           ------------KLLRTITADKMIPAFLITPISSQIAGKVIAQVESDIFAHMGKAVLIPKGSKVIGYYSN
2an9A           GEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDV----------FLDIDWQ
2b0lC           ----------------------------------------------------------------------
2ancB           GEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDV----------FLDIDWQ
1e2lA           -IANIFTTQHRLDQGEISAGDAAVVMTS-AQITMGMPYAVTDAVLAP-HIGGEAGSPPPALTLIFDRHPI
3b9qA           DTFRAAASDQLEIWAERTGCEIVVAEKAKAATVLSKAVKRGKEEGYD--------VVLCDTSGRLHTNYS
1cjvC           KEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVP-------------------------------
3e8aC           A--------IETIVAAMSNLVPPVELANPENQ--------------------------------------
3bb1D           RSRAGFTLNIIDTPGLIEGGYINDMADNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPSKRSE
1agpA           IDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVG
3c85A           GA----YDELRARYGKISLGIEIREEAARNVISGDATDPDFWERILDTGHVKLVLLAPHHQGNQTALEQL
1ckeA           VASEDALVPLASHLDVRFVSTNGNLEVILEGEDVSGE-----IRTQEVANAASQVAAFPRVREALLRRQR
1e9sA           ------LSKFGRDKDIILNPYDQRTKGWSFFN-EIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRE
3dfdA           ------AKELREAYKTEDPVEVAKRVLSVGGEYANW----------------------------------
2aexA           ----------------------------------------------------------------------
3c7kA           IQSLAAIVRAMDTLGVEYGDKERKTDSKMVCD--------------------------------------
3ci2A           ----------------------------------------------------------------------
2c9gA           PVTGLVMPGVYTNEAFHPDIILLPGCGVDFTH--------------------------------------
1e6vC           -------------------------------------------------------------------ENR
1azsC           ----NLKEAIETIVAAMSNLVPPVELANPENQF-------------------------------------
3c7kC           ---------------PVVYSNTIQSLAAIVRAMDTLGVEYGDKERKTDSKMVCDVVSRMEDTEPFSAELL
1e2kB           SETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPVLAPHIGGEAHAPPPALTLIFDRHPIAALLCY
1e2mA           VLGASETIANIY--TTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAV------------LAPHIGG
1e2hA           ETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPAVLAPHIGGEAGSPPPALTLIFDRHPIAALAAR
3cqcA           QKPALIPQPTFTEKVAHEHKEKKYEMDFGIWKGHLDALT---------------------------ADVK
1e2lB           IVYVPEPMTYWRVLGASETIANIFTTQHRLDQGEISAGDAAVVMQITMGMPYAVTDAVLAPHIGGEAGSP
2c95B           VSSGSARGKKLS---EIMEKGQLVPLETVLDMLRDAMVAKVTSKGFLIDGYPREVQQGEEFERRIGQPTL
1e9sK           ------LSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYAL--------------------SVVPR
1d6aA           LNLQETWG--KISTAIHDAKNGVLPKPLELVD--------------------------------------
1dwmA           ----------------------------------------------------------------------
2a5fA           NVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQD
2bwjD           LSTGELLREERSKLIRDIMERDLVPSGIVLELLKEAMV--------------------------------
1d2zD           TPAR-PVDGPGALISLELLE--------------------------------------------------
3do6A           ----------------------------------------------------------------------
1e2jB           ---YWRVLGASETIANIYQHRLDQGEISAGDAA-------------------------------------
3dvlC           EETPQDIIKNARSFGWDLAKLVDEGKLFILDASPD---------------------------PEGQEVVG
2dx7A           ---WTAKRLEECGADFIIMPANFVEDIRKAIKIPIISMIEETAKKVKELGFKKAGLLATTGTIVSGVYEK
2b0lB           ----------------------------------------------------------------------
2bwjB           LASESERSKLIR---DIMERGDLVPSGIVLELL-------------------------------------
3cddE           KQGQACTVDIGGERVITGYVDDWVPSYDESTITISVSGRDK-----------------------------
3cr8B           -----------------------------------------------------------------KHEAL
2axnA           AVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAK-----------------------EGGQIAVF
3dmdA           ----------------------------------------------------------------------
3dzvA           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
1as2A           ----------------------------------------------------------------------
3cwzA           YLEDRTVRLQLWDTAGLERFRSLIPS--------------------------------------------
2atvA           IDDEVVSMEILDTAGQEDTIQREGHM--------------------------------------------


                         +         .         .         .         .         *         .:210
query           HLSGGQQQRVAIARALMMEPQVLLFDEPTAALDPEITAQIVSIIHELAETNITQVIVTHEVEVARKTASR
3dmdC           DTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNAVKIDGIILTKLDADARGGAAL
3b5jA           GLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK-GRTVIIIAHRLSTVKN-ADR
3dmdB           DTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFEAVKIDGIILTKLDADARGGAAL
2d3wB           GFSGGEKKRNDILQMAVLEPELCILDESDSL-DIDALKVVADGVNSLRDGKRSFIIVTHYRILDYIKPDY
2c03B           DTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDKVGVTGLVLTKLDGDARGGAAL
2dwoA           DATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCY
2ccjB           YQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNNRLDQEDLKFHEKVIEGYQEIIQR
3cmvH           ARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKQAE
2ccgA           YQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQEDLKFHEKVIEGYQE
2czvA           YSNPYERANLAWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISLGVVI---GMEIPQAKASISMY---PEI
2ccgB           YQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSLDLKFHEKVIEGYQEIIHNESQR
3cmvG           ARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKN-KIA
2b8tA           EPFGPIAKLFTYADKITKLTAICNECGAEATHSLR------KIDGKHADYNDDIVKIGCQEFYSA--VCR
2dwpA           DATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCY
3b60A           LLSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQK-NRTSLVIAHRLSTIE-QADE
2dr3A           LTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMAILQLKRVLAGTGCTSIFVSQVSGFGPHGVDG
3c95A           TLDYAEQQRWLEHRRQVFTPEFL--QGYADELQMLDDKEKVALLKALWQYADE-----------------
1e9sF           GKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATLRGFLEGTLAESLFAGSNEASKALTSA
1e69A           LLSGGEKALVGLALLFALMEIFYVLDEVDSPLDDYNAERFKRLLKENSK-HTQFIVITHNKIVMEA-ADL
2a2zD           IYQDWHDWMNNQFGQSLELDGIIYLQATPETCLNEEQGIPLEYLEKLYKHESWLLHRTLKTNFDYLQEVP
2bifA           DATNTTRERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATEDFMRRIECY
3eiuB           IVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELH-----RKGIYPPINVLPSLSRLMNS
1bifA           DATNTTRERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATEDFMRRIECY
1d1cA           QLLAGATAEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFKITRQAMDIV--GFSQEEQMSIFKIIAG
2b8wA           FFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSKDETFNLPRLCIRKFFPKKKCFVFDRPVHR
3czpB           AIDKQTQERF-KEREKTPYKRYKITEEDWRNRDKW--DQYVDAVGDVDRTST--EIAPWTLVEADKRFAR
3dm5A           DTAGRHKEDKALIEEMKQISNVIHPHEVILVIDGTIGQQAYNQALAFEATPIGSIIVTKLDGSAKGGGAL
2a30D           IYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHEEQGIPLEYLEKLYKHESWLLHRTLKTNFDYLQEVP
1e9sG           GKTDEAEEWASYGRLLLRETAKKLALIGTPSMREWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSA
1e9fA           KENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRYENGALRCFHQLMKLNWKMVDASKSIEAVH-EDIR
3eiuA           IVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELHRK-----GIYPPINVLPSLSRLMNS
2c03A           DTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEVGVTGLVLTKLDGDARGGAAL
2bbsA           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLM-ANKTRILVTSKMEHLKKADK
2cgtH           YLSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKLLIIAEDVEGEALATLVVNTMRG
3b2qA           TNYAEALRQMGAAR---NEVPGRRGYPGYMYTDLATLYERAGIVKGAKGSVTQIPILSMPGDDIT-HPIP
1e9cA           KENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFG----HERYENGAFQERALRCFHQLMKDTTLN
2cjwB           SVSEGRAAVVFDCKFIETSAAVQHNVKEL-------------------FEGIVRQVRLRRDSKEKN-ERR
3cmvA           ----------SVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGLKQSNTLLIFINQGGNALKFYASV
3a1wA           ILAMTAIDEAKKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEYAQ---------------------
2a5gA           LPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSN-----------------------
3cmvC           MMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEVGSETRVKVVKNKIAAPFKQAE
2akaB           QPPDIEFQIRDMLMQFVTKENCLILAVSPANSDL-ANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDA
2c61B           IVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELHR----KGIYPPINVLPSLSR-LMNS
2cckA           SSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAERIIKNSRLDQEDLKFHEKVIEGYQEIIRF
1e98A           KENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGA----FQERALRCFHQLMKDTTLN
2axzC           EEVSSIIKPYPIVDSFGKDYDLTIQTVLKNALTISINRNLKEAQYYINQIKNISINGYYDLEINYLKTDK
4dcgA           YIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEK-KMYYLNKIVRNKVVVNFDYPNQE
1e9rA           TAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASALTSARFVLSDKLPEHVTMPDG
2awnD           VLDAGRVAQVGKPLELYHYPADRFVAPKMNFLPVKVTATAIDQVQVELMPNRQQVWLPVESRDVQVGANM
3b85A           LTRLGFGSKVVTGDGLRLVR-HILRGVDDVHFSELTSSDVVRLVGHIVD---------------------
2a2zB           IYQDWHDWMNNQFGQSLELDGIIYLQATPETGRNEEQGIPLEYLEKLYKHESWLLHRTLKTNFDYLQEVP
1e2dA           ENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQER-----ALRCFHQLMKDTTLN
1aroP           RFRKMFERQLLITTLLPKMIARINDWFEEVKAKRGKRPTAFQFLQEIKPEAVAYITIKTTLACLTSADNT
2c04A           DTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFEKVGVTGLVLTKLGDARGGAALS
2axpA           YIEGKDIDSILELYREVSNAGLHTYSWDTGQWSSDEIAKDI-----------------------------
2bc9A           SIGTINQQAMDQLYYVTELTHRIRSKSDFVSFFPDFVWTLRDFSLDQPLTPDEYLTYSLKLKKGTSQKDE
2a30B           IYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGHYKHESWLLHRTLKTNFDYLQEVP
3clvA           ANKIDKNFQVDILEVQKYAQDNNLLFIQTSAKTGTNIKNIFYMLAEEIY---------------------
2bjbA           ASFTDGLTVQHTGSSLPSAPHIAMTAAMLRQAGVDIDDSTPNRWQVRPPVAARRWDIEPDLTNAVAFLSA
2d62A           ELSGGQRQRVALGRAIIRRPKV-FLDEPLSNLDAKLRVKRAELKKLQRQLGVTTIYVTHDQVEA---TGD
2dr3E           LTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARLQLKRVLAGTGCTSIFVVSVGPGVEHGVDG
2c9yA           VIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGE--PLIRRSDDNEKALKIRLQAYHT
3czpA           AIDKQTQERF-KEREKTPYKRYKITEEDWRNRDKW--DQYVDAVGDVDRT-STEIAPWTLVEANDKRFAR
1e9sD           GKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIADLRGFLEGTLAESLFAGSNEASKALTSA
421pA           NKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH-------------------
1e9sJ           GKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGGTLAESLFAGSNEASKALTSA
1e2fA           KENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFG---HERYENGAFQERALRCFHQLMKDTTLNW
2awnC           ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRHKRLGRTMIYVTHDQVEAMTLADK
2dr3B           LTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARLQLKRVLAGTGCTSIFVSQVSVGERGFGGP
1e9dA           KENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYEN----GAFQERALRCFHQLMKDTTLN
1bg0A           GMSKATQQQLIDDHFLFKEGDRFLQTANACRYWPTGRGIFHNWVNEEDHLRIISMQKGGDLKTVYKRLVT
3cmxA           QIRNPETTTGGNALKFYASV-RLDIRRIGAVKEGENVVGSETRVKVV-----KNKIAAPFKQAEFQILYG
2b8tB           EPFGPIAKLFTYADKITKLTAICNECGAEATHSLR-------KIDGKHADYNDDIVKIGCQEFYS-AVCR
3dt2A           SWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGRRPAGVPLVYEALSWQHGVFVGAT
1dhjA           PVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDPEIMVIGGGRVYEQFLPKAQK
2bdtA           RDALRKKGERCLELVEEFES--KGIDERYFYNTSHLQPTNLNDIVKNLKTNPR-----------------
1e0jA           LAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGAKSTGVVLVVICHLKNPDKGKAHE
1ai4B           GLTQSDPRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSMLKRTVVAAVPMPFDKWYSASGYET
2d4uA           IYHNALAELIQLLGAGKINE---FFDQPTQGYQDGFEKQYVAYMEQNDRLHDIAVSDNN-----------
2bhvA           NNKMGEYRDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRYGSAFGDYLLMQLMRQSGMGINQVVNQ
3cddC           QIEQGETPHELLARLAK-QRGVLLTSDTFGNLVITRASKTKAGVSLILGDNV--KAARGRFS-WRQRFSK
2a2zA           ESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRILRGRNEEQGIPLEYLEKLHYKHE
2a30A           IYQDWHDWMNNQFGQSLELDGIIYLQATPETCLNEEQGIPLEYLEKLYKHESWLLHRTLKTNFDYLQEVP
3bh0A           SKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISLKKMARELDVVVIALSQLSRQVEQRQDK
2ctsA           NLHPMSQLSAAITALNSESNFARAYAEGIHRTKYWELICMDLIAKLPCVAAKIYRNLYREGSSIGAIDSK
1e3mA           FTRVGFVETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWACAENLKIKALTLFATHYFELTQLPEKE
3b2qB           IVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELHRK-----GIYPPINVLPSLSRLMNS
3adkA           LLYVDAGPETMTKRLLKRGETSGRVDDNEETIKKTYYKATEPVIAFYEKRIVRKVNAEGSVDDVFSQVCT
3bb1B           GKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLASDIPVVLIENSGRCNSDEKVLPN
1e4yA           GFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSG--RVYHVKFNPPKVEGKDDVTGEE
1e3aB           GLTQSDPRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSMLKRTVVAAVPMPFDKWYSASGYET
3dt4A           SWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGRRPAGVPLVYEALSWQHGVFVGAT
3cr7C           AREGVIKEFTGISAP-YEAPANPEVHVKNYELPVQ--DAVKQIIDYLDTKGY------------------
2b8tC           EPFGPIAKLFTYADKITKLTAICNECGAEATHS-------LRKIDGKHADYNDDIVKIGCQEFYSAVCRH
3da4A           MFSGKEYQILLPGEIHIKES--------------------------------------------------
2b92B           SFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRKFFPKKKCFVFDRPVH
1e59A           LTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVIIAAHGNS-LRALVKY
3bo6B           SSLHNTRQFIECLESRLSESGLMPGQYPESDVHPENWKYVSYRNELRSGRDGG--EMQSQALREEPFYRL
1e9rE           GKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGGTLAESLFAGSNEASKALTSA
1cr1A           FAEAETDRLLAKLARSGLGCDVIILDHISIRKM--IDNLMTKLKGFAKSTGVVLVVICHGSGALRQLSDT
3cddF           IKAAGIKADVTDSEIGRYRPLIIVNEEVTTAEGAAKRGQWERQRSIGKSNAEYTVTRIPQTGKLWNINTL
2awnB           ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLKRLGRTMIYVTHDQVEAMTLADK
2c61A           TNYAEALRQMGAARNEVPGRRGYPGYMYTDLATLYERAGIVKGAKGSVTQIPILSMPGDDITHPIPD-LS
1e3mB           TRVGTFVETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWACNLANKIKALTLFATHYFELTQLPEKE
3d3kA           FLRDQPWYKAAVAWANQNRAPVLSIDPPV-HIDAKWSLALGLPLPLGEHAGRIYLCDIGIPQQVFQEVGI
2bkhA           LCAGASEDIRERLHLSPDNFRYLNRGCTRYFANKDKQILQNRKSPEYLKAGSLKDPLLDDHGDFIRMCTA
3d7wA           ALRFPGGQTKTQAR--SILILIQMISEAARFNPIL--WRARQYINSGASFLPDVYMLEL-ETSWGQQSTQ
1cjaA           TLYTGYD--VGTEGSISMQEGFLATVRECASFDLDAFERELQKCHNLSISPQAIPFILRMLRI-------
1e6cA           RPTLTGRPIAEEMEAVLREREALYQDVAHYVVDAT--QPPAAIVCELMQ---------------------
1e0jB           LAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGAKSTGVVLVVICHLKNPDKGKAHE
4atjA           TLAGGPSWRVPLGRRDSLQAFNANLPAPFFTLPQLKDSFRNVGLNRSSDLVALSGGHTFGKNQCRFIMDR
2d4hB           EADGQPLTPDEYLTYSFPKKKCFVFDRPVHRRKLAQLEKLQDEELDPEQQVADFCSYIFSNSKTKTLSGG
3dfoD           LTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGV
3dfpD           LTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGV
3be4A           SVISGRCTHPASGRIYHVKYNPPKQPGIDDVTGEPLVWRDDDNAEAVKRLDVFHKQTAPLVKFYEDLGIL
2bbsB           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKME-HLKKADK
1cr4A           EAETDRLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGFAK--STGVVLVVICHLKGALRQLSDT
2c7cH           YLSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEVAKAGKPLLIIAEDVEGEALATLVVNTMRG
1dekB           YLNGKSPIKGVFVFDDEG-KESVNFVAFNKITDVINNIEDQWSVRRLQALGTDLIVNNFDRMYWVKLFAL
3dfpC           LTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGV
3dfqA           LTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGV
3dftC           LTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGV
3dftD           LTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGV
2a5jA           KSDLESRRDVKREEGEAFAREHGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGL--------------
2d4uB           IYHNALAELIQLLGAGKINE---FFDQPTQGYQDGFEKAYMEQNDRLHDIAVSD----------------
3dfnC           LTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGV
1cr2A           EAETDRLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTK--LKGFAKSTGVVLVVICHKSGALRQLSDT
3dm9B           LIDTAGRSETNRNLDEKKIARVTKPNLVIFVGDALAGNAIVEQARQFNAVKIDGIILTKLDADARGGAAL
2akaA           LLAGATAEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFKITR---QAMDIVGFSQEEQMSIFKIIAG
1aldA           LTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGV
1e2kA           HIGGEAGPPPALTLIFDRHPIAALLCYPAAGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRAKR
2cckB           NEFAINGLYPDLTIYLNVSAEVGRERIIKNRLDQEDLKFHEKVIEGYEIIRFKSVNADQPLENVVEDTYQ
1bglA           GVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAQHQGKTLFISRKTYRIDGSGQM
2d0kA           PVIYGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAAADVPEIFVIGGGRVYEQFLPKAQK
1cfrA           LITSNPDFSIIDIRGRREELKSMLKDISFSNISLSTISEIDNLYKNFDYAELEHIKSFLSVKTTFRPDRR
2c0bL           EIPLFSHYQIESQIESAFQREVRLPSGGSIVIDSTEALTAIDITNLEAADEIARQLRLRDLGIVIDFIDM
2eg5G           SIYSSKASRLPVQKAYLDQFTKDFTTFLRIHSEELFSHGRMLLTCICKGVELDARNAIDLLEMAINDLVV
1d6jB           EVYVDVPVEVAEQRAPYEAPANPEVHVKNYELPVQDAVKQ--IIDYLDTKGY------------------
3dfnD           LTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGV
3dfnA           LTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGV
3dfqD           LTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGV
1e9sB           TAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKATSARFVLSDKLPEHVTMPDG
2bkiA           LCAGASEDIRERLHLSSPDNFRYLNRGCTRYFANKETDKQILQNRKSPEYLKAGSLKDPLLDDHGDFIRM
3bgwA           SVNYIWSKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQARELDVVVIALSQLSRQVEQRQDK
2d4hA           SSPDESADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLLPRLCIRKFFPKKKCFVFDR-PVH
2bx2L           EIPLFSHYQIESQIESAFQREVRLPSGGSIVIDSTEALTAIDINSARGDIEET--AFNTNLEAADEIARQ
3dtbB           SWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGRRPAGVPLVYEALSWQHG-VFVGA
3cmvE           MMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVEGENVVGSETRVKVVKNKIAAPFK
3bgwD           SKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISLKKMARELDVVVIALSQLSRQVEQRQDK
3dt4C           SWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGIIFGGRRPAGVPLVYEALSWQHGVRSEAT
2bbtB           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKME-HLKKADK
3czjA           GVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHWQHQGKTLFISRKTYRIDGSGQM
2c9oC           VHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLLLDRVMIIRTMLYTPQEMKQI
1e2gA           KENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGERYE--------NGAFQERALRCFHQLMKDTTLN
3d3qA           KQVKLKEYLASFDKESAKDIHPNNRKRVLRAIEYYLTKKLLSVQQFTENYDTLLIGIESRETLYLRINKR
3d3qB           KQVKLKLKELEHLNNNKLHEYLASFDESAKDIHPNNRKRVLRAIEYYLKTDTLLIGIESRETLYLRINKR
3cr7D           AREGVIKEFTGISAP-YEAPANPEVHVKNYELPVQ--DAVKQIIDYLDTKGYL-----------------
2ck3C           YLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVA-YRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM
3dlbB           SKGRLQGREGGRVAWVADPK---DPRKPIPHLTGLLVPVGSLALSLPEERRRRTREIASWIGRRLGLGTP
1adoA           LTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGV
3cioD           IVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILVIKRASTAY-----
3cr7A           AREGVIKEFTGISAPYEAANPEVHVKNYELPVQDAVKQ----IIDYLDTKGYL-----------------
3c8uA           IAIAGAAEVGPECRVAIIEGNYLLFDAPGWRDLTAIWDVSIVPADLEARLVQRWLDHGLNHDAAVARAQG
6aldA           LTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGV
2dr3C           LTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKARSIILQLKRVLAGTGCTSIFVSQVSG-VEHGVDG
1e9sM           TAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPD
3bb1A           GKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLK--SDIPVVLIENSGRCNKNDSDE
3cmtD           QIRMKNPETTTGGNALKFYASVRLDIRRIGAVKEGEN----VVGSETRVKVVKNKIAAPFKQAEFQILYG
2c4rL           EIPLFSHYQIESQIESAFQREVRLVIDSTEALTAIDINSARGDIEETAFNTNLEAADEIARQLRLRDLGG
1dkiA           SAGSSRVQRALKENFGYNQSVHQINRGDFSKQDWEA------QIDKELSQNQPVYYQGV-----GKVGGH
3ch4B           VFTGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRS------------------------
3dt7A           SWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIRPAGVPLVYEALSWQHGVFVGAT
2dr3F           LTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMIILQLKRVLAGTGCTSIFVSQVSGFGPGVEHG
1ak2A           VIEFSIPDSLLIRRITGRLIHPQSGRSYHEEFNPPKEPMKDDITGEPRRSDDNKKALKIRLEAYHTQTTP
3dfqC           LTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGV
1eilA           LMAAGSAGDAALYRADQRAWRIAVQPGELDDLAYAGLEVDDALERMADKLRQAGVAFTRGDEALM--QQR
2d2eA           YLNEGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNARGPNFGALVITHYQRILNYIQPDK
2boeX           QITGQVDALMSAAQAAGKIPILVVSNAPGRDCGGGAPSWIDEFAAGLKNRPAYIIVEPDLISLMSSCMQH
3bczC           EDEHSIEHLPYTAKAESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNRFRYSYYDESQGEIYRS
3dfoC           LTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGV
1b0uA           HLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSH
3dffA           SIRKLPDGRWLTAHVEGRQKLAVNDHSPDSDHDL-VGEVADDIRSIIDEFDPTLVVTCAAIG---EHPDH
1dg3A           DFVSFFPDFVWTLRDFSLDLQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCF--VFDRP
2ausC           PTSHEVVAWIKRILNLEKAGHGGTLDPKVSGVLPVALERATRVVQALLPAGKEYVALMHLHGDVP-EDKI
3cddD           QIEQGETPHELLAR-LAKQRGVLLTSDTFGNLVITRASKTKAGVSLILGDNV--KAARGRFSWRQRF-SK
3cnlA           LKKGGVPDIERALMLFFTEAGRVSFERPE-----------------------------------------
2a1fF           --SQPIYKRILLKLSG-----EALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGAKLA
2dflA           LVSKDPSIKLIVVDSVTSHFRAEYPGRENLAVRQQKLNKHLHQLTRLAVYDIAVIITNQVMHTLYHVPGI
3cm0A           RLLGVVLVEVPILRRAELEGRSDDNEETVRRRLEVYREKTEPLVGYYARGVLKRVDGLGTPDEVYARIRA
1akeA           VLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTQMTAPLIGYYSKEAEAGNTK
3ec1A           YIKGGRRSFVCYMANELTVHR-TKLEKADSLYANQLGELLSPPSKRY---AAEFPPLVPRSLSVKERKTD
2ahwD           GGKLNEVTKEDLIKLVEFDNKEYLYYKAIAPDIAFIRATTCDSEGYATFEDEVMYLDALVIAQAVHNNGG
2bhvD           NNKMGEYLDIVWSRIITPHGINIMLTNGYNGLVGELIERNFQRYGVPFGDYLLMQLMRQSGMGINQVVNQ
1e9sI           GKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLLEGTLAESLFAGSNEASKALTSA
1bmfC           YLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVA-YRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM
1e9rF           TAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPD
1dhiA           PVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACDVPEIMVIGGGRVYEQFLPKAQK
3bb1E           GKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKKASDIPVVLIENSGRCN-KNDSD
3bjdB           DLSRALEQEIAAQSRERHPSQYVFGSASRAQLQVFLRHQWFRTFRLYRDAADL-LVNLTDVDEAA-ALAR
1e9rD           GKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGGTLAESLFAGSNEASKALTSA
2awoA           ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIISRLHKRLGRTMIYVTHDQVEAMTLADK
1afrA           YLGFIYTSFQERATFISHGNTARQAKEHGDIKLAQICGTIA------ADEKRHETAYTKIVEKLFEIDPD
1cjtC           ----------------------------------------------------------------------
2dpyB           IAIGEPPATKGYPPSVFAKLPALVER---AGNGIHGGGSITAFYTVLTEGDDQQDPIADSA---------
2dr3D           LTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIIKRVLAGTGCTSIFVSQVSVGERGFGGP
2d3wA           GFSGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLDGKRSFIIVTHYQRILDYIKPDY
2bofX           PSHSAYRSWIDEFAAGLKNRPAYIIVEPDLISLMSSCMQHVQQEVLETMAGSSQARIYFDAGHSAWHSPA
2a1fD           --------QPIYKRILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGAKLA
1d6jA           VATPGEETGLPFVEVYVDVPVEAPYEAPANPEVHVKNDAVKQIIDYLDTKGY---LPAKK----------
2bwjA           VICMDCSADTMTNRLLQMSRSSLPVDDTTKTIAKRLEAYYRASIPVIAYYETKTQLHKIEGTPEDVFLQL
3dymA           DIGVSEATRIDPNAWVERAAGHYQAEAALLQCTADTLADAVLITTAHWQHQGKTLFISRKTYRIDGSGQM
2awoC           ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQRIEISRLHKRLGRTMIYVTHDQVEAMTLADK
3bv4A           LTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGV
2ancF           DTALTDLKTIIRAERLRMSRQKQRHDALISKLL-------------------------------------
3di4A           GLPLHEAELVHDVLNVFCTGFQYFKASPVRPGDYLEFFAEIDLLGNLSACPGGDCSSEASC-----HPLL
1e9sH           GKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLLEGTLAESLFAGSNEASKALTSA
3d31A           TLSGGEQQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVHKKNKLTVLHITHDQTEARIMADR
2bhjA           ELIFATKMAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHIYATNNGNIRSAITVFPQRSDGKH
1ek0A           DLQEGGERKVARGEKLAEEKGLLFFE--TSAKTGENVNDVFLGIGEKI----------------------
3cphA           NKSDMETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKIDSNKLVGV----------
3dauA           PVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDAIAACGDVPEIMVIGGGRVYEQFLPKAQK
1cs4C           ----------------------------------------------------------------------
1draA           PVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACDVPEIMVIGGGRVYEQFLPKAQK
2d3wD           GFSGGEKKRNDILQMAVLEPELCILDESDGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDY
2b8wB           LYYVTELTHRIRSKSSVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTSLKLKKGTSQKDETFNLPRLCI
2ahvA           GGKLNEVTKEDLIKLVEFDNKEYLYYKAIAPDIAFIRATTCDSEGYATFEDEVMYLDALVIAQAVHNNGG
1ckvA           ----------------------------------------------------------------------
1e2hB           CYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLARLDLAMLAAIRRVYGLL--ANT
3bpbA           RQMIAILEKHGLSGSVVRLEKVLGLKTGLAYLEHNNLLAAGEFVSKPEFQDFNIIEIPEEE----SYAAN
3a00A           CILDIDMQGVKSVKAIPELNARFLFIAPPSVTGAHDKVIVNDDLDKAYK-ELKDFIFAE-----------
3bb1F           GKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKKD-IPVVLIENSGRCNKNDSDEK
2ccjA           YQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSNRLQEDLKFHEKVIEGYQEIIHR
2czvB           YSNPYERANLAWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISLGVVI---GMEIPQAKASIMYPEI----
2cvfA           LWIARKHNIPVIVINQVHFDSRTEMTKPVAEQTLGYRCKDILRLDKLPKPGLRVAVLERHRFRPEGLMAY
1dekA           ITDVINNIEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFALDYLDKFNSGYDYYIVPDTRQDHEMDA---
1cr0A           EAETDRLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTK--LKGFAKSTGVVLVVICHDLRALRQLSDT
2dftA           DRAEKYRALMAKRAPLYRRVATMRVDTNRRNPG-AVVRHILSRL--------------------------
2aumA           YLAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFADI------SVLL
3dyoA           GVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAQHQGKTLFISRKTYRIDGSGQM
1e4vA           YVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRTAPLIGYYSKEAEAGNTK
3cmwC           HMGLAARMMSQAMRKLAGNLK---QSNTLLIFINQIRMKIGVMFGNP---ETTTGGNALKFYASVRLDIR
3ecpA           IRKAGAMQTVKLAQEFPE----LLAIEDTTSLSYRHQVAEE-LGKLGSIQDKSRGWWVHSVLLLEATTFR
3dhwC           NLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDNRRLGLTILLITHEMDVVKRICDC
2bv7A           KKYHGWIVQKIFQAALYAAPYKSDFLKALSKGQNVTEEECLEKVRLFLVNYTATIDVIYEMYTRMN----
3bwdD           FIDHAVPITTVQGEELKKLIGAPAYIECSSKSQENVKGVFDAAIRVVLQ---------------------
3cbnA           ELTLDHPTDIVCRKSDYICSRTLIRADKAAFDLDE-------NLVRDLR-KGRELKVEIIVEYEG-----
2aunA           YLAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFSDISVLLSAFHRH
3brwA           VIYQKLGATSEEELFSTN-EESPAFVEFLEFLGQKVKLQDFKGFRGHGQTGTESVYCNFRNKEIYTEGDA
2d3wC           GFSGGEKKRNDILQMAVLEPELCILDESDDIDALKVVADGVNSLRD-GKRSFIIVTHYQR-ILDYIKPDY
1dw9A           TLDGK-----------------------------------------------------------------
1av6A           PVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYY
2drcA           PVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGRVYEQFLPKAQK
3cueF           KCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMS-----------------
3bk7A           DLSGGELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLMKNEKTALVVEHDVLMIDYVSDR
1dyhA           PVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDPEIMVIGGGRVYEQFLPKAQK
1bccF           --KEQWTKYEEDVPYLEPYLKEVI----------------------------------------------
1e2iB           PHIGGEAHAPPPALTLIFDRHPILLCYPAARYLMQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKR
1e2iA           RYLMGSMTPQAVLAFVALIPPTLPGTNILGALPEDRHIDDLAMLAAIRRVYGLLANTVRYLQCGGSWRED
3cnnA           LKKGGVPDIERALMLFFTEAGRVSFERPE-----------------------------------------
3bb1C           GKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKSD-IPVVLIENSGRCNKND-SDE
3d1mB           RYEGKITRNSERFKELTYNPDIIFKDEENTGADRLMTQRCKDKLNAVMNQWPGVKLRVTEGWDEDGHHSE
2aunB           YLAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFSDISVLLSAFHRH
1culC           ----------------------------------------------------------------------
1e2nB           LLCYARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKLDLAMLAAIRRVYGLL--ANT
1e9sE           LRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVT
3crmA           KALLEGLPYTVAQLAIAPEQRQVLHARIAQRFRQMLEQGFIAEVEALHARSDLAGLPSIRAVGYRQVWDY
3bs4A           MDLNLFEGRELYGFAISMSGYLEVFTPEETLRYLETSAEVRYGHPAYKKYPRGTNFWLWEGVKDKRVLLS
1dvrA           AIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVEALVQISDDNADALKKRLAAYHAQTEP
2d7vA           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
2dftC           DRAEKYRALMAKRAPLYRRVATMRVDTNRRNPG-AVVRHILSRL--------------------------
4dfrA           PVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDPEIMVIGGGRVYEQFLPKAQK
3bjqB           ------QARVVD---------PILSTHARGYRQSTLIGKKLFPVAPVAQYGGKILTFGKRLYNTKRNTKR
5dfrA           PVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVEAIAACGDVPEIMVIGGGRVYEQFLPKAQK
3dvlD           GFDLSALIERINYAIQKYRARRVSIDSVTSVFSSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARY
3b55A           NPTASLNDLKPLKNV--GSASIVGLGEATHGAHEV-FTKHRIVKYLVSEKGFTNLVLEEGWDRALELDRY
2a5vB           ----------------------------------------------------------------------
1dp0A           GVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAQHQGKTLFISRKTYRIDGSGQM
3a00B           CILDIDMQGVKSVKAIPELNARFLFIAPPSGAHDKVIVN---DDLDKAYKELKDFIFAE-----------
1accA           FHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKE------VINDR
1c9kC           MERAIDDEIQILIAACQRCPAKVVLVTNEVGMGIVPENRLARHFRDIAG---------RVNQRLAAAADE
3cmuA           IGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFIQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIG
1e9sL           TAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEAKALTSARFVLSDKLPEHVTMPDG
2bkeA           LVSKDPSIKLIVVDSVTSHFRAEYPGRENLAVRQQKLNKHLHQLTRLEVYDIAVIITNQVVPGI---RIQ
1e9rG           LRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHPD
2dpyA           IAIGEPPATKGYPPSVFAKLPALVER---AGNGIHGGGSITAFYTVLTEGDDQQDPIADSA---------
3cr7B           EVQRDPKGLYKKAREGVIKEFTGISAPYEAPANPEVHVKNYELPVQDAVKQIIDYLDTKGYLPAK-----
2e85B           -IDGGSAPENDIVAIRELRPRLLIVDATDMGLNPGEIRII-----DPDDIAEMFMMTTHNMPLNY--LID
1eamA           ISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSMRLLSIYTGENMRLTRVTKSDAVNYAKK
2bbtA           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKME-HLKKADK
3bb1G           GKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEAL---LQVVRSGASLSDIPVVLIENSGR-CNKNDSD
2aumB           YLAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFADISVLLSAFHRH
2cdnA           AVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQ-LKTVDAVGTMDEVFARALR
2d2fA           GFSGGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVAGVNAMRGPNFGALVITHYQRILNYIQPDK
2a1fE           --------QPIYKRILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGAKLA
2c5mD           ------KSCGLHVTSIKIDP-YINIDAGLTKDNNLTTGKIINKERKGDYLGKTVQVVPHITDAIQEWVMR
3d1mA           RYEGKITRNSERFKELTYNPDIIFKDEENTGADRLMTQRCKDKLNALAIPGVKLRVTEGWDEDGHHSEES
1drbA           PVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEMVIGGGRVYEQFLPKAQK
2anbA           GAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSDYLIVNDDFDTALTDLKT
1e2mB           LLCYPAALMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKLDLAMLAAIRRVYGLLANTVR
3cbqA           ILVGARSREVSLEEGRHLAGTLSCKHIETSAALHHNTRELFEGAVRQIRLR-------------------
3dm5B           VDTAGRHKEDKALIEMKQISNVIHPHEVILVIDGTIGQQAYNQALAFKEATPIGSIVTKLDGSAKGGGAL
3c14C           ----------------------------------------------------------------------
2awoD           PLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPN------RQQVWLPVESRDVQVGANM
2b8tD           EPFGPIAKLFTYADKITKLTAICNECGAEATHSLR-------KIDGKHADYNDDIVKIGCQEFYSAVCRH
1e2nA           FDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVL-------------------------
2ancD           GAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVYAEYDYLIVNDDFDTALTDLKT
3dkvA           ----------------------------------------------------------------------
2a1fC           --SQPIYKRILLKL-----SGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGAKLA
2a78A           LLVGNKSDLEDVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKME----------------
3bb1H           RVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDESKRSEALLQVVRSGASLKKDSD-IPV
1d8jA           HLDIGLKQKQWLMEALVNNPKIEVIDGKYAFKPKY-----------------------------------
2e85A           VIDGGSAPENDIVAIRELRPRLLIVDATDMGLNPGEIR-----IIDPDDIAEMFMMTTHNMPIDQLKEDI
1e2jA           AALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDERLDLAMLAAIRRVYGLLANT
1e1qB           PPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAGDVSAYIPTNVITDGQIFLETELFYK
2awnA           LVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVE--------------AMTLADK
3c15C           ----------------------------------------------------------------------
3bm2B           IAAGSDDKAIDKARNAPFRAPLIITVVAKVPRWEQESAG-CAVAQAAVAQGFGGIWRSGALTESPV-VRE
1chdA           ---------------LLSSEKLIAIGASTGGTEA-----IRHVLQPLPLSSPAVIITQMPPGFTRSFAER
3cmvB           RMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGA-VKEGENVVGSETRVKVVKNKQAE
3ed8A           ----------------------------------------------------------------------
3b85B           NTTPAQKFL----TRLGFGSKVVTGDSGLRLVRHILRGVDDHFSELTSSDVVRHQLVGHIVDAY------
1e9rB           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
2bhvC           NNKMGEYLDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRY--------------------------
2an9A           GAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEEYDYLIVNDDFDTALTDLKT
2b0lC           --------------HHMSKAVVQMAISSLSYSELEAIEHIFEELDGNEGLLVASKIADRVIVNALRKLES
2ancB           GAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMEMSHYAEYDYLIVNDDFDTALTDLKT
1e2lA           -AALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERRVYGLLANT
3b9qA           LMEELIACKKAVGKIVSGA-----PNEILLVLDGNTGLNMLPQARENEVVGITGLILTKLDGSARGGCVV
1cjvC           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
3bb1D           ALLQVVRSGASLKKDAASDIPVVLIENSGRCNDEKVLPNGIAWIPHLVQ-TITEVALNKSESIFVD-KNL
1agpA           NKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH-------------------
3c85A           QRRNYKGQIAAIAEYPD-QLEGLLESGVDAAFNIYSEAGSGFARHVCKQ---------------------
1ckeA           AFRELPGL---IADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQVKGFSVNFLLAEIKLVPAADAL
1e9sA           TAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKATSARFVLSDKLPEHVTMPDG
3dfdA           ----------------------------------------------------------------------
2aexA           ------------------EDELAHRCSSFMAPPVTDLGELRRRPGDQAQVCQALAQVDGGANFSVDRWER
3c7kA           ----------------------------------------------------------------------
3ci2A           -------------------------------LVGKSVEEAKKVILQDKPEAQIIVLPVGTIVTMEYRIDR
2c9gA           ----------------------------------------------------------------------
1e6vC           RKYMNPNYELKKLREIPDEDIVRLMGHREPGEEYPSVHPPLEEMEE-PECPIRELVEPTEGAKAGDRIRY
1azsC           ----------------------------------------------------------------------
3c7kC           SAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAGDYQPTEQILRTRVKTTGIVETHFTFKNLH
1e2kB           PAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRERLDLAML--------------
1e2mA           EAGSPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHID----
1e2hA           YLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGER-LDLAMLAAIRRVYGLLANT
3cqcA           EKMYNVLLFVDGGWMVDVREDAKEDHERTHQMVLLRKLCLPMLCFL----LHTILHSTGQYQECLQ-LAD
1e2lB           PALTLIFDRHPIAALLCYPAARYLMGS----MTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKR
2c95B           LLYVDAGPETMTQRLLKRGETSGRVDDNEETIKETYYKATEPVIFYEKRGIVRKVNAEGSVDSVFSQVCT
1e9sK           GKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLLEGTLAESLFAGSNEASKALTSA
1d6aA           ----------------------------------------------------------------------
1dwmA           --------------------------------------MAAATVERENRNVHAIVLKEGSAMTKDFRCDR
2a5fA           LPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGD---GLYEGLTWLTSN--------------------
2bwjD           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
3dvlC           GFDLSALIERINYAIQKYRARRVSIDSVTSVFSSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIAYG
2dx7A           EFSKYGVEIMTPTEDEQKDVMRGIYEGVKAGNLKLGRELLLKTALEERGAECIIAGCTEVSVVLKQDDLK
2b0lB           ----------------MSKAVVQMAISSLSYSELE-AIEHIFEELDGNEGLLVASKIADRVGITRSVIVN
2bwjB           ----------------------------------------------------------------------
3cddE           ----------------------------------------------------------------------
3cr8B           SLP-----SLDLDWQQQCELEMLM-TGAYSPLTGFMTARVESAQQLDDGSFWPSPISRDRALADRRPGER
2axnA           DATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCY
3dmdA           ----------------------------------------------------------------------
3dzvA           -----------SANALLYIDAKPIADDPREFPQFQQTSALVLNLGHLSQEREQSLLAA------------
1dapA           ----------------------------------------------------------------------
1as2A           ----------------------------------------------------------------------
3cwzA           ----------------------------------------------------------------------
2atvA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VIYMENGHIVEHGDAGCFAHPQTEAFKNYLSH
3dmdC           SISYVIDAPILFVGVGGYDDLRPFEKEWFLE-
3b5jA           IIVMEKGKIVEQG-------------------
3dmdB           SISYVIDAPILFVGVGGYDDLRPFEKEWFLE-
2d3wB           VHVLYQGRIVKSGD------------------
2c03B           SARHVTGKPIYFAGVSKPEGLEPFYPERLAGR
2dwoA           EASYQPLDPDKCDRDLSLIK------------
2ccjB           FKSVNADQPLENV----VEDTY-QTIIKYL--
3cmvH           FQILYGEGINFYGELVDLGVKEKLIEKAGA--
2ccgA           IIHNESQRFKSVNADQDTYQTIIKYLE-----
2czvA           IL------------------------------
2ccgB           FKSVNADQPLENV----VEDTY-QTIIKYL--
3cmvG           APFKQAEFQILYG-------------------
2b8tA           HHHKVPNRPYLNSNEEFIKFFK----------
2dwpA           EASY--QPLDPDKDRDLSLIKVIDVGRRFLVN
3b60A           IVVVEDGIIVERGTSELLAQH--GVYAQLHKM
2dr3A           IIRLDLDEIDGELKRSIVWKMRGTSHSMRR--
3c95A           --------------------------------
1e9sF           RFVLSDKLPEHVTMPDGDFSIRSWLEDPNGGN
1e69A           GVTMVNGSAIVPVE------------------
2a2zD           ILTLDVNEDFK---------------------
2bifA           ENSYESLDEEQDRDLSYIKIMDVGQS------
3eiuB           GIGAGKTREDHKAVSDMYAGYAEGRDLRGL--
1bifA           ENSYESLDEEQDRDLSIKIMDVGQSYVVNRVA
1d1cA           ILHLGNIKFEKAGEGAVLKDKTALNAASTVFG
2b8wA           RKLAQLEKLQDEELDPEFVQQVADFCSYIFSN
3czpB           VKVLR--TIND---------------------
3dm5A           SAVAATGAPIKFIGTGDIEPFDPPRF------
2a30D           ILTLDVNEYES---------------------
1e9sG           RFVLSDKLPEHVTMPDGDFS------------
1e9fA           VLSEDAIATATEK-------------------
3eiuA           GIGAGKTREDHKAVSDQMYAGY----------
2c03A           SARVTGKPIYFAGVSEKPEGLEPFYPERLAG-
2bbsA           ILILHEGSSYFYGTFSELQNLRPDFSSKLMSF
2cgtH           IVKVAAVKAPGFGDRRKAMLQDIATLTGG---
3b2qA           DLSGYITEGQIVVARELHRKGIYPPINVLPSL
1e9cA           WKMVDASKSIEAV-------------------
2cjwB           LAYQKRK-------------------------
3cmvA           RLDIRRIGAVKEGENVVGSETRVKVVKNKI--
3a1wA           --------------------------------
2a5gA           --------------------------------
3cmvC           FQILYGEGINFYGEVDLGVKEKLI--------
2akaB           RDVLENKLLPLRR-------------------
2c61B           GIGAGKTREDHKAVS-----------------
2cckA           KSVNADQPLEN-----VVEDTY-QTIIKYL--
1e98A           WKMVDASKRIEAV-------------------
2axzC           NIDSYLNAVNIINIKIIGKEDIHRSLVEEL--
4dcgA           YDYFHMYFMLRTVYCNTFPTTKAKVLF-----
1e9rA           DFSIRSWLEDPNGGNLFI--------------
2awnD           SLGIRPEHLLPSDIDVILEGEVQVV-------
3b85A           --------------------------------
2a2zB           ILTLDVNEDFK---------------------
1e2dA           WKMVDASKSIEAV-------------------
1aroP           TVQAVASAIGRAIEDEAIRDLEAKHFKKFMQV
2c04A           ARHVTGKPIYFAGVSEKPEGLEPFYPERLAG-
2axpA           --------------------------------
2bc9A           TFNLPRLCIRKFFPKKKFVFDR----------
2a30B           ILTLDVNEYES---------------------
3clvA           --------------------------------
2bjbA           AV-VSGGTVRITG-------------------
2d62A           RIAVNKGELQQVGTDEVYYKPVNT--------
2dr3E           IIRLDLDEIDGELKRSLI--------------
2c9yA           QTTPLIEYYRKRGI------------------
3czpA           VKVLR--TIND---------------------
1e9sD           RFVLSDKLPEHVTMPDGDFSIRSWLEDPNGGN
421pA           --------------------------------
1e9sJ           RFVLSDKLPEHVT-------------------
1e2fA           KMVDASKSIEAVHE------------------
2awnC           IVVLDAGRVAQVGKPLLYHYPADR--------
2dr3B           GEHGVDGIIRLDLDEIDELKRSLIVWKMRGT-
1e9dA           WKMVDASKSIEAV-------------------
1bg0A           AVDNIESKLPFS--------------------
3cmxA           EGINFYGELVDLGVK-----------------
2b8tB           HHHKVPNRPYLNSN------------------
3dt2A           AAAEHKGKVIMHDPAMRPFFGYN---------
1dhjA           LYLTHIDAEVEGDTFPDYEPDDWESVSSEF--
2bdtA           --------------------------------
1e0jA           EGRPVSITDLRGS-------------------
1ai4B           TQDGPTGSLNISVGKILYEAVQGDKSPIPQAV
2d4uA           --------------------------------
2bhvA           IVVIREGSRVFIS-------------------
3cddC           FTIKADSAGLPTV-------------------
2a2zA           SWLLHRTLKTN---------------------
2a30A           ILTLDVNEYES---------------------
3bh0A           RPMLSDLRESGQLEQDAEFLYRDDYYDKESES
2ctsA           LDWSHNFTNMLGYTDAQFTELMRLYLTIHSDH
1e3mA           GVANVHLDALEHGDIAFHSVQDGAASKSYGLA
3b2qB           GIGAGKTREDHK--------------------
3adkA           HL------------------------------
3bb1B           GIAWIPHLVQT---------------------
1e4yA           LTTRKDDQEETVRKRLVEYHQMTAPLIGYY--
1e3aB           TQDGPTGSLNISV-------------------
3dt4A           AAAEHKGKVIMHDPAMRPFFGYNFG-------
3cr7C           --------------------------------
2b8tC           HHKVPNRPYLN---------------------
3da4A           --------------------------------
2b92B           RRKLAQLEKLQDEELDPEFVQQVADFCSYI--
1e59A           LDNMSEEEILELNITGVPLVYEFDENFKPLKR
3bo6B           MA------------------------------
1e9rE           RFVLSDKLPEHVTMPGDFSIR-----------
1cr1A           IIALERNQLVLVRILKCRFTGDTGIA------
3cddF           VPVIDEIGLDEELIA-----------------
2awnB           IVVLDAGRVAQVGKPLEYHYPADRFVAGFIGS
2c61A           GYITEGQIVVARELH-----------------
1e3mB           GVANVHLDALEHG-------------------
3d3kA           NYHSPFG-------------------------
2bkhA           MKKIGLDDEEKLD-------------------
3d7wA           VQHSTDGVFNNPI-------------------
1cjaA           --------------------------------
1e6cA           --------------------------------
1e0jB           EGRPVSITDLRGS-------------------
4atjA           LYNFSNTGLPDPTLNTTYLQTLRGLCPLNGNL
2d4hB           IQVNGPRLESLVL-------------------
3dfoD           ILFHETLYQKADDG------------------
3dfpD           ILFHETLYQKADDG------------------
3be4A           KRVNAKLPPKE---------------------
2bbsB           ILILHEGSSYFYGTFSQFSAERRNSI------
1cr4A           IIALERNQLVLVRI------------------
2c7cH           IVKVAAVKAPGFGD------------------
1dekB           DYLDKFNSGYDYYIVPDTRQDHEMDA------
3dfpC           ILFHETLYQKA---------------------
3dfqA           ILFHETLYQKADDG------------------
3dftC           ILFHETLYQKADDG------------------
3dftD           ILFHETLYQKADDG------------------
2a5jA           --------------------------------
2d4uB           --------------------------------
3dfnC           ILFHETLYQKADDG------------------
1cr2A           IIALERNNLVLTGDTGIAGNKETGWLEPS---
3dm9B           SISYVIDAPIL---------------------
2akaA           ILHLGNIKFEKGAG------------------
1aldA           ILFHETLYQKADDG------------------
1e2kA           QRPGERLDLAMLAAIRRVYGLLANTVRYL---
2cckB           TIIK----------------------------
1bglA           AITVDVEVASDTP-------------------
2d0kA           LYLTHIDAEVEGD-------------------
1cfrA           LQLAHEGSLMKALYTHLQTRTWT---------
2c0bL           TPVRHQRAVENRLRE-AVRQDRARIQISHISR
2eg5G           EGHLEEEKLDSFNLPVYIPS------------
1d6jB           --------------------------------
3dfnD           ILFHETLYQKAD--------------------
3dfnA           ILFHETLYQKADDG------------------
3dfqD           ILFHETLYQKADDG------------------
1e9sB           DFSIRSWLEDPNGGNLFI--------------
2bkiA           CTAMKKIGLDDEEKLDL--FRVVAGV------
3bgwA           RPMLSDLRESGQLEQDAEFLYRDDYYDKESES
2d4hA           RRKLAQLEKLQDE-------------------
2bx2L           LRLRDLGGLIVIDFIDMTPVRHQRAVENRL--
3dtbB           AMRSEAKVIMHDPFAMRPGYNFGKYLAHWLS-
3cmvE           QAEFQILYGEGINFYGLVDLGVKEKLIEKAGA
3bgwD           RPMLSDLRESGQLEQDAEFLYRDDYYDKESES
3dt4C           AAAEHKGKVIMHDPAMRPFFGYN--FGKYLAH
2bbtB           ILILHEGSSYFYGTFSELQNLRPDFSSKLMD-
3czjA           AITVDVEVASDTPHPARLNCQLAQVAERV---
2c9oC           IKIRAQTEGINISE------------------
1e2gA           WKMVDASKSIEAV-------------------
3d3qA           VDILGHGLFNEVQH------------------
3d3qB           VDILGHGLFNEVQHVEQGFEASQSQAIGY---
3cr7D           --------------------------------
2ck3C           NDAFGGGSLTALPV------------------
3dlbB           EAVRAQAYRLSIPKLMGRRAVSKPADALRVGF
1adoA           ILFHETLYQKAD--------------------
3cioD           --------------------------------
3cr7A           --------------------------------
3c8uA           NDLANARAIEAARL------------------
6aldA           ILFHETLYQKADDG------------------
2dr3C           IIRLDLDEIDGELKSLIVWKMRGTSHSMRR--
1e9sM           GDFSIRSWLEDPNGGNLFITWR----------
3bb1A           -KVLPNGIAWIPH-------------------
3cmtD           EGINFYGELVDLG-------------------
2c4rL           LIVIDFIDMTPVRHQRAVEN------------
1dkiA           AFVI-DGADGRNF-------------------
3ch4B           --------------------------------
3dt7A           AAAEHKGKVIMHDPAMRPFFGYNFG-------
2dr3F           IIRLDLDEIDGEL-------------------
1ak2A           LVEYYSKRGIASQTDVVFASILAA-FSKATS-
3dfqC           ILFHETLYQKA---------------------
1eilA           KVMGLLCLQDPFGPLEIYYGPAEIFHEPFLPS
2d2eA           VHVMMDGRVVATGG------------------
2boeX           VQQEVLETMAYAGKALKAGSSQARIYFDA---
3bczC           IEHLDKGSIIEQLDPVSFSN------------
3dfoC           ILFHETLYQKAD--------------------
1b0uA           VIFLHQGKIEEEGDEQVFGNPQSPRLQQFLK-
3dffA           EATRDAALFATHEKNVPRLWEDLPYAVFKSGA
1dg3A           VHELDPEFVQQVADFCSYIFSNSKTKTLSGGI
2ausC           RAVMKEFEGEIIQRTRKVYYIEILEIDGRD--
3cddD           FTIKDSAGLPTVGGIKADVTDSEIGRYRP---
3cnlA           --------------------------------
2a1fF           KAGMNRVVGDHMGMATVMNGLAMRDSLFRADV
2dflA           RIQLKKSRGNRRIARVVDALPEGEVV------
3cm0A           ALGI----------------------------
1akeA           YAKVDGTKPVAEVRA-----------------
3ec1A           IVFSGLGWVTCND-------------------
2ahwD           IVMMQVQKMVKKATLHPKSVRIPGYLVDIVVV
2bhvD           IVVIREGSRVFIS-------------------
1e9sI           RFVLSDKLPEHVTMPDGDFSIRSWLEDPN---
1bmfC           NDAFGGGSLTALPVIETQAGDVSAYIPTN---
1e9rF           GDFSIRSWLEDPNGGNLF--------------
1dhiA           LYLTHIDAEVEGD-------------------
3bb1E           EKVLPNGIAWIPH-------------------
3bjdB           YLYGELGEEDEKGSHPRLLAKLLEAI------
1e9rD           RFVLSDKLPEHVTMDGDFSIRS----------
2awoA           IVVLDAGRVAQVGKLELYHYPADRFVAGFIGS
1afrA           GTVLAFADMMRKK-------------------
1cjtC           --------------------------------
2dpyB           --------------------------------
2dr3D           GVEGVDGIIRLDLDIDGELKRSLIVWKMRGT-
2d3wA           VHVLYQGRIVKSGD------------------
2bofX           QMASW---------------------------
2a1fD           KAGMNRVVGDHMGMLAVMNGLAMRDSLFRADV
1d6jA           --------------------------------
2bwjA           CTAIDSIFL-----------------------
3dymA           AITVDVEVASD---------------------
2awoC           IVVLDAGRVAQVGKLELYHYPADR--------
3bv4A           ILFHETLYQKA-----DDGRPFPQVIKS----
2ancF           --------------------------------
3di4A           VEIFAPAEGLGDW-------------------
1e9sH           RFVLSDKLPEHVTMPDGDFSIRSWLEDPN---
3d31A           IAVVMDGKLIQV--------------------
2bhjA           DFRLWNSQLIRYA-------------------
1ek0A           --------------------------------
3cphA           --------------------------------
3dauA           LYLTHIDAEVEGD-------------------
1cs4C           --------------------------------
1draA           LYLTHIDAEVEGD-------------------
2d3wD           VHVLYQGRIVKSGD------------------
2b8wB           RKFFPKKKCFVFD-------------------
2ahvA           IVMMQVQKMVKKAT------------------
1ckvA           --------------------------------
1e2hB           VRYLQCGGSWRED-------------------
3bpbA           CIWVNERVIMPAGY------------------
3a00A           --------------------------------
3bb1F           VL-PNGIAWIPHLVQTITEVALNK--------
2ccjA           FKSVNADQPLENV----VEDTY-QTIIKYL--
2czvB           --------------------------------
2cvfA           FRITERG-------------------------
1dekA           --ARAMGATVIHVVR-----------------
1cr0A           IIALERNQLVLVR-------------------
2dftA           --------------------------------
2aumA           SAFHRHGLPAIHGPATGLGLQE----------
3dyoA           AITVDVEVASDT--------------------
1e4vA           YAKVDGTKPVAEVRA-----------------
3cmwC           RIGAVKEGENVVGSETRVKV------------
3ecpA           TVGLLHQEWWMRP-------------------
3dhwC           VAVISNGELIEQDT------------------
2bv7A           --------------------------------
3bwdD           --------------------------------
3cbnA           --------------------------------
2aunA           GLPAIHGPVATGL-------------------
3brwA           QQLQRKRHIGNDIVAVVFQDENTPFVPDMIAS
2d3wC           VHVLYQGRIVKSGD------------------
1dw9A           --------------------------------
1av6A           LNKIVRNKVVVNFD------------------
2drcA           LYLTHIDAEVEGD-------------------
3cueF           --------------------------------
3bk7A           LIVFE-GEPGRHGRA-----------------
1dyhA           LYLTHIDAEVEGD-------------------
1bccF           --------------------------------
1e2iB           ERLDL---------------------------
1e2iA           WGQLSGTGPRPH--------------------
3cnnA           --------------------------------
3bb1C           KVLPNGIAWIPHLVQTITEVALNK--------
3d1mB           ESLHYEGRAVDITT------------------
2aunB           GLPAIHGPVA----TGLGLEQQ----------
1culC           --------------------------------
1e2nB           VRYLQCGGSWR---------------------
1e9sE           MPDGDFSIRSWLEDPNGGNLFIT---------
3crmA           LDGKLSYAEMT---------------------
3bs4A           VYRRADYVLKTRSS------------------
1dvrA           IVYKKTGIWAG---------------------
2d7vA           --------------------------------
2d7vB           --------------------------------
2a5vA           --------------------------------
2dftC           --------------------------------
4dfrA           LYLTHIDAEVEGD-------------------
3bjqB           IDFGYEGDPYSIVSALEAKVPRELRDASQVPG
5dfrA           LYLTHIDAEVEGDTH-FPDYEPDDWESVFSEF
3dvlD           GVFVSDNVVILRNV------------------
3b55A           VLTGKGNPSQHLTPVFTKELDLLDWIRQYNAN
2a5vB           --------------------------------
1dp0A           AITVDVEVASDT--------------------
3a00B           --------------------------------
1accA           YDMLNISSLRQDGKTFIDFKKYNDKLPLYIS-
1c9kC           VWLVVSGIGVK---------------------
3cmuA           AVKEGENVVGSETRVKVVKNKIAAPFK-----
1e9sL           DFSIRSWLEDPNGGNLFITWREDMGPAL----
2bkeA           LKKSRGNRRIARVVDAPH-LPEGEVV------
1e9rG           GDFSIRSWLEDPNGGNLFITWR----------
2dpyA           --------------------------------
3cr7B           --------------------------------
2e85B           QLKEDIGEVIFLG-------------------
1eamA           MYYLNKIVRNKVVVNFDYPNQEYDYFHMY---
2bbtA           ILILHEGSSYFYGTFDQFSAERRNSIL-----
3bb1G           EKVLPNGIAWIPHLVQTITEVALNKSESIF--
2aumB           GLPAIHGPVAT---------------------
2cdnA           AL------------------------------
2d2fA           VHVMMDGRVVATGG------------------
2a1fE           KAGMNRVVGDHMGMLATMNGLAMRDSLFRADV
2c5mD           QALEPQVCVIELGGTVGESMPFIEAFRQFQFK
3d1mA           L--HYEGRAVDITT------------------
1drbA           LYLTHIDAEVEGDTHF-PDYEPDDWESVF---
2anbA           IIRAERLRMSRQKQ------------------
1e2mB           YL------------------------------
3cbqA           --------------------------------
3dm5B           SAVAATGAPIKFIGTGKIDDIEPFDPPRFVS-
3c14C           --------------------------------
2awoD           SLGIRPEHLLPSDIDVILEGEVQVVE------
2b8tD           HHKVPNRPYLNSN-------------------
1e2nA           --------------------------------
2ancD           IIRAERLRMSRQKQ------------------
3dkvA           --------------------------------
2a1fC           KAGMNRVVGDHMGMLAVMNGLAMRDSLFRADV
2a78A           --------------------------------
3bb1H           VLIENSGRCNKNDSDEKVLPNGIAWIPHLVQT
1d8jA           --------------------------------
2e85A           GEVIFLGIQPDIVGFYPMTQPIKDAVETVY--
1e2jA           VRYLQCGGSWREDW------------------
1e1qB           GIR-----------------------------
2awnA           IVVLDAGRVAQVGKLELYHYPADR--------
3c15C           --------------------------------
3bm2B           AFGCREQDKIVGF-------------------
1chdA           LNKLCQISVKEAEDGERVLP------------
3cmvB           FQILYGEGINFYGELVKEKLIEKAGA------
3ed8A           --------------------------------
3b85B           --------------------------------
1e9rB           --------------------------------
1cjuC           --------------------------------
2bhvC           --------------------------------
2an9A           IIRAERLRMSRQKQ------------------
2b0lC           AGVIESRSLGMKG-------------------
2ancB           IIRAERLRMSRQKQ------------------
1e2lA           VRYLQCGGSWRED-------------------
3b9qA           SVVEELGIPVKFIGVGAVEDLQPFDPEAFVN-
1cjvC           --------------------------------
3e8aC           --------------------------------
3bb1D           I-------------------------------
1agpA           --------------------------------
3c85A           --------------------------------
1ckeA           VLDSTTLSIEQ---------------------
1e9sA           DFSIRSWLEDPNG-------------------
3dfdA           --------------------------------
2aexA           KEGGGGISCVLQ--------------------
3c7kA           --------------------------------
3ci2A           VRLFVDKLDNIAQ-------------------
2c9gA           --------------------------------
1e6vC           IQFTDSVYFAPIHPYIRARMYMWR--------
1azsC           --------------------------------
3c7kC           FRLFDVGGQRSE--------------------
1e2kB           --------------------------------
1e2mA           --------------------------------
1e2hA           VRYLQCGGSWRED-------------------
3cqcA           MVSSERHKLYL---------------------
1e2lB           L-------------------------------
2c95B           HL------------------------------
1e9sK           RFVLSDKLPEHVTMPDGDFSIRSWLEDPN---
1d6aA           --------------------------------
1dwmA           VWVIVNDHGVVTS-------------------
2a5fA           --------------------------------
2bwjD           --------------------------------
1d2zD           --------------------------------
3do6A           --------------------------------
1e2jB           --------------------------------
3dvlC           VEFVSDNVVILRNV------------------
2dx7A           VPLIDPMDVIAEV-------------------
2b0lB           ALVIESRSLGMKG-------------------
2bwjB           --------------------------------
3cddE           --------------------------------
3cr8B           LLRDGEGYMLAIL-------------------
2axnA           EASYQPLDPDKC--------------------
3dmdA           --------------------------------
3dzvA           --------------------------------
1dapA           --------------------------------
1as2A           --------------------------------
3cwzA           --------------------------------
2atvA           --------------------------------