[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for sent8:ACF67786.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3c9iA.bssp"
#ERROR : Can't open dsspfile "3c9iF.bssp"
#ERROR : Can't open dsspfile "2d1yD.bssp"
#ERROR : Can't open dsspfile "2d1yC.bssp"
#ERROR : Can't open dsspfile "2d1yA.bssp"

## Summary of PDB Search
:233
    1e-22 100%  3c9iA  [x.x.x] TAIL NEEDLE PROTEIN GP26
    2e-10  98%  3c9iF  [x.x.x] TAIL NEEDLE PROTEIN GP26
    1e-04  32%  2d1yD  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    3e-04  32%  2d1yC  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    4e-04  32%  2d1yA  [x.x.x] HYPOTHETICAL PROTEIN TT0321
:233

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MADPSLNNPVVIQATRLDASILPRNVFSKSYLLYVIAQGTDVGAIAGKANEAGQGAYDAQVKNDEQDVEL
3c9iA           MADPSLNNPVVIQATRLDASILPRNVFSKSYLLYVIAQGTDVGAIAGKANEAGQGAYDAQVKNDEQDVEL
3c9iF           MADPSLNNPVVIQATRLDASILPRNVFSKSYLLYVIAQGTDVGAIAGKANEAGQGAYDAQVKNDEQDVEL
2d1yD           ----------------------------------------------------------------------
2d1yC           ----------------------------------------------------------------------
2d1yA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ADHEARIKQLRIDVDDHESRITANTKAITALNVRVTTAEGEIASLQTNVSALDGRVTTAENNISALQADY
3c9iA           ADHEARIKQLRIDVDDHESRITANTKAITALNVRVTTAEGEIASLQTNVSALDGRVTTAENNISALQADY
3c9iF           ADHEARIKQLRIDVDDHESRITANTKAITALNVRVTTAEGEIASLQTNVSALDGRVTTAENNISALQADY
2d1yD           ----------------------------------------------------------------------
2d1yC           ----------------------------------------------------------------------
2d1yA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VSKTATTSQSLASPLNVTTSYSVGGKKVVGARQTGWTAATGTANKGVFDADLTFAVSDTYTQSEIQAIAN
3c9iA           VSKTATTSQSLASPLNVTTSYSVGGKKVVGARQTGWTAATGTANKGVFDADLTFAVSDTYTQSEIQAIAN
3c9iF           VSKTATTSQSLASPLNVTTSYSVGGKKVVGARQTGWTAATGTANKG------------VFDASEIQAIAN
2d1yD           ------------------------GKGVLGARGIGRAIAQAFAREGVALCDLRPEGKEVAEAIGGAFFQV
2d1yC           ------------------------GKGVLGARGIGRAIAQAFAREGVALCDLRPEGKEVAEAIGGAFFQV
2d1yA           ------------------------GKGVLGARGIGRAIAQAFAREGVALCDLRPEGKEVAEAIGGAFFQV


                         .         .         .         +         .         .         .:280
query           ALITERRRTKALEDALRAHGLID
3c9iA           ALITERRRTKAMEDALRAHGLID
3c9iF           ALITERRRTKAMEDALRAHGLID
2d1yD           DLEDERERVRFVEEAAYALGRVD
2d1yC           DLEDERERVRFVEEAAYALGRVD
2d1yA           DLEDERERVRFVEEAAYALGRVD