[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for sent8:ACF67908.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bp8A.bssp"
#ERROR : Can't open dsspfile "3bp8B.bssp"
#ERROR : Can't open dsspfile "2aa4A.bssp"
#ERROR : Can't open dsspfile "2ap1A.bssp"
#ERROR : Can't open dsspfile "1bg3B.bssp"
#ERROR : Can't open dsspfile "1dgkN.bssp"
#ERROR : Can't open dsspfile "1bdgA.bssp"
#ERROR : Can't open dsspfile "1bg3A.bssp"
#ERROR : Can't open dsspfile "2ch6C.bssp"
#ERROR : Can't open dsspfile "2ch6A.bssp"
#ERROR : Can't open dsspfile "1czaN.bssp"
#ERROR : Can't open dsspfile "3b8aX.bssp"
#ERROR : Can't open dsspfile "2ch6B.bssp"
#ERROR : Can't open dsspfile "2ch5A.bssp"
#ERROR : Can't open dsspfile "2ch5C.bssp"
#ERROR : Can't open dsspfile "3c0bA.bssp"
#ERROR : Can't open dsspfile "3djcB.bssp"
#ERROR : Can't open dsspfile "3djcD.bssp"
#ERROR : Can't open dsspfile "3bexA.bssp"
#ERROR : Can't open dsspfile "1bu6Y.bssp"
#ERROR : Can't open dsspfile "3bf3C.bssp"
#ERROR : Can't open dsspfile "1bu6O.bssp"

## Summary of PDB Search
:406
    3e-54  89%  3bp8A  [x.x.x] PUTATIVE NAGC-LIKE TRANSCRIPTIONAL REGULATOR
    1e-35  79%  3bp8B  [x.x.x] PUTATIVE NAGC-LIKE TRANSCRIPTIONAL REGULATOR
    7e-33  22%  2aa4A  [x.x.x] PUTATIVE N-ACETYLMANNOSAMINE KINASE
    1e-28  22%  2ap1A  [x.x.x] PUTATIVE REGULATOR PROTEIN
    2e-27  12%  1bg3B  [c.55.1 - c.55.1 - c.55.1 - c.55.1] HEXOKINASE
    3e-27  11%  1dgkN  [c.55.1 - c.55.1 - c.55.1 - c.55.1] HEXOKINASE TYPE I
    1e-26  10%  1bdgA  [x.x.x] HEXOKINASE
    2e-26  11%  1bg3A  [c.55.1 - c.55.1 - c.55.1 - c.55.1] HEXOKINASE
    5e-26  11%  2ch6C  [x.x.x] NAGK PROTEIN
    5e-25  11%  2ch6A  [x.x.x] NAGK PROTEIN
    1e-24  11%  1czaN  [c.55.1 - c.55.1 - c.55.1 - c.55.1] HEXOKINASE TYPE I
    9e-23   9%  3b8aX  [x.x.x] HEXOKINASE-1
    9e-23  14%  2ch6B  [x.x.x] NAGK PROTEIN
    9e-22  11%  2ch5A  [x.x.x] NAGK PROTEIN
    3e-20  10%  2ch5C  [x.x.x] NAGK PROTEIN
    3e-17   9%  3c0bA  [x.x.x] CONSERVED ARCHAEAL PROTEIN Q6M145
    5e-16  14%  3djcB  [x.x.x] TYPE III PANTOTHENATE KINASE
    6e-16  12%  3djcD  [x.x.x] TYPE III PANTOTHENATE KINASE
    2e-11   9%  3bexA  [x.x.x] TYPE III PANTOTHENATE KINASE
    3e-10   8%  1bu6Y  [c.55.1 - c.55.1] PROTEIN (GLYCEROL KINASE)
    2e-08   6%  3bf3C  [x.x.x] TYPE III PANTOTHENATE KINASE
    7e-08   9%  1bu6O  [c.55.1 - c.55.1] PROTEIN (GLYCEROL KINASE)
:406

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MVADSQPGHIDQIKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVREMLEAHLVQELEIKEAGS
3bp8A           ----------DQIKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVREMLEAHLVQELEV-----
3bp8B           -----------QIKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVREMLEAHLVQE-LVGLVVE
2aa4A           ----------------------------------------------------------------------
2ap1A           ----------------------------------------------------------------------
1bg3B           -----ESGTGKGAAMVTAVAYRLAEQHRQIEETLAHFRLSKQTLMEVKKRLRTEMEMGLRKETNSKATKM
1dgkN           SDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLTKDMLLEVKKRMMELGLRKQTHNNAVVK
1bdgA           ----------------SDQQLFEKVVEI--------LKPFDLSVVDYEEICDRMGELGLQKSTN-EKSSI
1bg3A           ------------IAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDEILIDILTRFKKNGLSRDYNPTASVM
2ch6C           ----------------------------------------------------------------------
2ch6A           ----------------------------------------------------------------------
1czaN           -----LLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLTKDMLLEVKKRMRALGLRKQTHNNAVKM
3b8aX           ----------------------ADVPKELMDEIHQLEDMFTVDSETLRKVVKHFIDELNKGLTKGGNIPM
2ch6B           ----------------------------------------------------------------------
2ch5A           ----------------------------------------------------------------------
2ch5C           ----------------------------------------------------------------------
3c0bA           ----------------------------------------------------------------------
3djcB           ----------------------------------------------------------------------
3djcD           ----------------------------------------------------------------------
3bexA           ----------------------------------------------------------------------
1bu6Y           ----------------------------------------------------------------------
3bf3C           ----------------------------------------------------------------------
1bu6O           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RGRPAVGLMVETEAWHYLSIRISRGEIFLALRDLSSKLVVXXXXXXXXXXXXXXXXRIITHVDRFFTRHQ
3bp8A           ------GLVVETEAWHYLSLRISRGEIFLALRDLSSKLVVEESQELALKDDSPLLDRIISHIDQFFIRHQ
3bp8B           TEAWHYLSLRISRGEIFLALRDLSSKLVVEESQELALKD-----------DSPLLDRIISHIDQFFIRHQ
2aa4A           ---------------TTLAIDIGGTKLAAALIGADGQIR---DRRELPTPASQTPEALRDALSALVSPLQ
2ap1A           ---------------------------------------------------------FLDAVCELVEEAD
1bg3B           LPSFVRSIPDGTEHGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIYSIPLEIMQIVSCISDFLDYMG
1dgkN           LPSFVRRTPDGTENGDFLALDLGGANFRVLLVKIRSGKKYAIPIEIMQGTGEELFDHIVSCISDFLDYMG
1bdgA           KMFPSYVTKTPNETGNFLALDLGGTNYRVLSVTLEGGKSPRIQERTYCIPAEKMSGYIAETLADFLENNG
1bg3A           LPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNVSMESEIYDTPENIVHGSGTQLFDHVADCLGDFME
2ch6C           ----------------------------------------------------------------------
2ch6A           ----------------------------------------------------------------------
1czaN           LPSFVRRTPDGTENGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIYAIPIEIMQIVSCISDFLDYMG
3b8aX           IPGWVMEFPTGKESGNYLAIDLGGTNLRVVLVKLSGNHTFDTTQSKYKLPHDMRTTFIADSLKDFMVEQE
2ch6B           ------------------------------------------------------------------TNHI
2ch5A           ----------------------------------------------------------------------
2ch5C           ----------QFMAAIYGGVEGGGTRSEVLLVSEDGK-ILAEADGLSTNHWLIGTDKCVERINEMVNRAK
3c0bA           --------------------------------------------------------LYFPDKLAEVLKTY
3djcB           ---------------------------------------------------------LGIFLKSVLRENN
3djcD           ----------------------------------------------------------LKSVLRENNCSP
3bexA           ----------------------------------------------------------------------
1bu6Y           ----------------------------------------------------------------------
3bf3C           ----------------------------------------------------------------------
1bu6O           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           QKLERLTSIAITLPGIIDTENGVVHRMPYYEDVKEMPLGDALERHTGVPVYIQHDISAWTMAEALFGASR
3bp8A           KKLERLTSIAITLPGIIDTENGIVHRMPFYEDVKEMPLGEALEQHTGVPVYIQHDISAWTMAEALFGASR
3bp8B           KKLERLTSIAITLPGIIDTENGIVHRMPFYEDVKEMPLGEALEQHTGVPVYIQHDISAWTMAEALFGASR
2aa4A           AHAQR---VAIASTGIIRDGSLLALNPHNLGGLLHFPLVKTLEQLTNLPTIAINDAQAAAWAEFQALDGD
2ap1A           QRFGVKGSVGIGIPGMPETEDGTLYAANV-PAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
1bg3B           IKGPRMP-LGFTFSFPCHQTNLDWTKGFKATDCEGHDVASLLRDAVKRREEFDLDVVNDTVGTMMTCAYE
1dgkN           IK-GPRMPLGFTFSFPCQQTSLDAGILIKATDCVGHDVVTLLRDAIKRREEFDLDVVAVTVGTMMTCAYE
1bdgA           MKDKFDLGFTFSFPCVQKGLTHATTKGFSADGVEGHNVAELLQTELDKRELNVKCVVNDTVGTLASCALE
1bg3A           KKKIKDKKLPVGFTFSFPCRQSKIDEAVLISGVEGADVVKLLNKAIKKRGDYDANIVADTVGTMMTCGYD
2ch6C           ------------------------------------EELRDRFPYLSESYLITTDAAGSIATATPDGGVV
2ch6A           -------------------------------GRILIEELRDRFPYLSESYLITTDAAGSIATATPDGGVV
1czaN           IK-GPRMPLGFTFSFPCQQTSLDAGILIKATDCVGHDVVTLLRDAIKRREEFDLDVVAVTVGTMMTCAYE
3b8aX           LLNTDTLPLGFTFSYPASQNKINEGILQRIPNVEGHDVVPLLQNEISKRELPIEIVINDTVGTLIASYYT
2ch6B           GTDKCVERINEMGVDPLVPLRSLGLSLSG-GEDAGRILIEELRDRFPYLYLITTDAAGSIATATPDGG--
2ch5A           ------------------------------------EELRDRFPYLSESYLITTDAAGSIATATPDGGVV
2ch5C           RKAGVDPLVPLRSLGLSLSGGDQEDA-----GRILIEELRDRFPYLSESYLITTDAAGSIATATPDGGVV
3c0bA           SNDVSHVALVTTAEEGVDNILNAAESAFGSN----ISVFDSNGNFISLESAKTNKSASNWCGTAKWVSKN
3djcB           CSPETIRKIAICSVVPQVDRSACVKYFSIDPFLLQAGVKTGLNIKYRNPVEVGADRIANAIAATHSFP--
3djcD           ETIRKIAICSVVPQVDYSLRSACVKYFSIDPFLLQAGVKTGLNIKYRNPVEVGADRIANAIAATHSFPNQ
3bexA           --------KGIGVASVVPTQNTVIERFSQKYFHISPIWVKAKNGCVKWNVKNPSEVGADRVANVVAFVKE
1bu6Y           --WATQSSTLVEVLTKADISSDQIAAIGITNQRETTIVWEKETGKPIYNAIVWQCRRTAEICEHLKRDGL
3bf3C           --------VASVVPTQNTVIERFSQKYFHISPIWVKAKNGCVKWNVKNPSEVGADR----VANVVAFVKE
1bu6O           --WATQSSTLVEVLTKADISSDQIAAIGITNQRETTIVWEKETGKPIYNAIVWQCRRTAEICEHLKRDGL


                         .         .         .         +         .         .         .:280
query           GARDVIQVVIDHNVGAGVITDGHLLHAGSSSLVEIGHTQVDPYGKRCYCGNHGCLETIASVDSVLELTQL
3bp8A           GARDVIQVVIDHNVGAGVITDGHLLHAGSSSLVEIGHTQVDPYGKRCYCGNHGCLETIASVDSILELAQL
3bp8B           GARDVIQVVIDHNVGAGVITDGHLLHAGSSSLVEIGHTQVDPYGKRCYCGNHGCLETIASVDSILELAQL
2aa4A           I-TDMVFITVSTGVGGGVVSGCKLLTGPGGLAGHIGHTLADPHGPVCGCGRTGCVEAIASGRGIAAAAQG
2ap1A           QYPLVMGLILGTGVGGGLVLNGKPITGQSYITGEFGHMRLPVPLRRCGCGQMGCIENYLSGRGFAWLYQ-
1bg3B           EPTCEIGLIVGTGTNACYMEEMKNVEMVEGNQGQMCI-----NMEWGAFGDNGCLDDIRTDFDKVVDEYS
1dgkN           EPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINME-----WGAFGDNGCLDDIRTVDEYSLNAGK
1bdgA           DPKCAVGLIVGTGTNVAYIEDSSKVELMDGVKEPEVVINTEW----GAFGEKGELDCWRTMDIDSLHPGK
1bg3A           DQQCEVGLIIGTGTNACYMEELRHIDLVEGDEGRMCI-----NTEWGAFGDDGSLEDIRTLDRGSLNPGK
2ch6C           LITGSNCRLINPDGSESGCGGWGHMMGDEGSAYWIAHQAVKINLEAAPHDIGYVKQAMFHYFQVPDRLGI
2ch6A           LITGSNCRLINPDGSESGCGGWGHMMGDEGSAYWIAHQAVKIVLEAAPHDIGYVKQAMFHYFQVPDRLGI
1czaN           EPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEW-----GAFGDNGCLDDIRTVDEYSLNAGK
3b8aX           DPETKMGVIFGTGVNGAFYDVVSDIEKLEGKLADDIPSNSPAINCEYGSFDNEHLVLPRTKYDVA-----
2ch6B           ---------VVLISGTGSNCRLINPDGSESGCGGWGHM-MGDEGSAYWIAHQAVKIVFDSIDNLEAAPHD
2ch5A           LISGSNCRLINPDGSESGCGGWGHMMGDEGSAYWIAHQAVKIVLEAAPHDIGYVKQAMFHYFQVPDRLGI
2ch5C           LISGTNCRLINPDGSESGCGGWGHMMGDEGSAYWIAHQAVKIVLEAAPHDIGYVKQAMFHYFQVPDRLGI
3c0bA           IEENCILVDGSTTTDIIPIVEGKV-VAEKTDLERLNHELLYVGTLRTPISHLGNTISFKGVD--TNVSSE
3djcB           -NQNIIVIDFGTATTFCAISHKKAYLGGAILPGLRLSASVEIIKTESVVG-RSTIESIQSGVYYGVLGAC
3djcD           NII--------------------VIDFGTATTFCAISHKKAYLGGAILPGLRLSADALSKNTASVEI---
3bexA           YGKNGIIIDMGTATTVDLVVNGSYEGGAILPGFFMMVHSLFRGTAKLPLVEVKPADFVVG----------
1bu6Y           EDYIRSNTGLVIDPYFSGTKVKWILDRARRGELLFGTVDTWLIWKMTQGRVHVTDYTNA-----------
3bf3C           YGKNGIIIDMGTATTVDLVVNGSYEGGAILPGFFMMVHSLFRGTAKLPLVEVKPADFV------------
1bu6O           EDYIRSNTGLVIDPYFSGTKVKWILDHVERGELLFGTVDTWLIWKMTQGRVHVTDYTNASRTMLFNIHTL


                         .         *         .         .         .         .         +:350
query           RLNQSMSSMLHGQPLTVDSLCQAAMQGDLLAKDIISGVGTHVGRILAIMVNLFNPQKILIGSPLSKAADI
3bp8A           RLNQ----SMHGQPLTVDSLCQAALRGDLLAKDIITGVGAHVGRILAIMVNLFNPQKILIGSPLSKAADI
3bp8B           RLNQSMSSMLHGQPLTVDSLCQAALRGDLLAKDIITGVGAHVGRILAIMVNLFNPQKILIGSPLSKAADI
2aa4A           ELAGA----------DAKTIFTRAGQGDEQAQQLIHRSARTLARLIADIKATTDCQCVVVGGSVGLAEG-
2ap1A           --------HYYDQSLQAPEIIALWEQGDEQAHAHVERYLDLLAVCLGNILTIVDPDLLVIGGGLSNFTAI
1bg3B           LNSGKQISGMYLGEIVRNILIDFTKKGFLFRGQISEPLKTRGIFETKFLSQIESDRLALLQ------VRA
1dgkN           QRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRGIFETKFLSQIESDRLALLQVRAILQQLG
1bdgA           QLYEKMVSGMYLGELVRHIIVYLVEQKILFRGDLPERLKVRNSLLTRYLTDVERDPAHLLYNTHYMLTDD
1bg3A           QLFEKMVSGMYMGELVRLILVKMAKEGLLFEGRITPELLTDVSAIEKDKEGIQNAKEILTRLGVEPSDVV
2ch6C           LTHLYRDFDKCRFAGFCRKIAEGAQQGDPLSRYIFRKAGEMLGRHIVAVLPEIDPVLFQGKISVWKSWEL
2ch6A           LTHLYRDFDKCRFAGFCRKIAEGAQQGDPLSRYIFRKAGEMLGRHIVAVLPEIDPVLFQGKIGVWKSWEL
1czaN           QRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRGIFETKFLSQIESDRLALLQVRAILQQLG
3b8aX           --------VDEQSPRPGQQAFEKMTSGY------------YLGELLRLVLLELNEKGLMLKDQDLSK---
2ch6B           YVKQAMFHYFQVPDRFCRKIAEGAQQGDPLSRYIFRKAGEMLGRHIVAVLPEIDPVLFQGKIGVWKSWEL
2ch5A           LTHLYRDFDKCRFAGFCRKIAEGAQQGDPLSRYIFRKAGEMLGRHIVAVLPEIDPVLFQGKISVWKSWEL
2ch5C           LTHLYRDFDKCRFAGFCRKIAEGAQQGDPLSRYIFRKAGEMLGRHIVAVLPEIDPVLFQGKIGLPILCVG
3c0bA           YFAITADISVVLEKVTTEEYTCDTPDGKGTDKRSSLVRISKVLCSDLDQISEIDAENIAKNYY-ELWKEL
3djcB           KE-------------LIQRIHHEAFNGDQILILATGGFASLFDK--QGLYDHLVPDLVLQGIRLAAMMN-
3djcD           ---------IKTESVVGRSTIESIQSGVYYG---VLGACKELIQRIHHEAFNGDQILILATGGFASLFDK
3bexA           -----------------------KDTEENIRLGVVNGSVYALEGIIGRIKEVYGDLPVVLTGGQSKIVKD
1bu6Y           ----------------------------------------------------------------------
3bf3C           ----------------------------------------------------------------------
1bu6O           DWDDKMLEVLDIPREMLPEVRRSSEVYGQTNIGGKGGTRIPISGIAG-----------------------


                         .         .         .         .         *         .         .:420
query           LFPAIADSIRQQALPAYSRNTVVESTQFTNQGTMAGAALVKDAMYNGSLLIRLLQG
3bp8A           LFPVISDSIRQQALPAYSQHISVESTQFSNQGTMAGAALVKDAMYNGSLLIRLLQG
3bp8B           LFPVISDSIRQQALPAYSQHISVESTQFSNMAGAALVKD---AMYNGSLLIRLLQG
2aa4A           YLALVETYLAQEPAA---FHVDLLAAHYRHDAGLLGAALL----------------
2ap1A           T-TQLAERLPRHLLPVARAPRIERA-RHGDAGGMRGAAF-----------------
1bg3B           ILQQLG---LNSTCDDSILVKTVCGVVSKRAAQLCGAGM-----------------
1dgkN           LNSTCDDSILVK---------TVCGVVSRRAAQLCGAGMA----------------
1bdgA           LHVPVVEPIDNRIVR------YACEMVVKRAAYLAGAGIA----------------
1bg3A           SVQHICTIV---------------SFRSANLVAATLGAILNRLRDNKGTPRL----
2ch6C           LKEGFLLALTQGREIQAQNFFSSFTLMKLRHSSALGGALGARHIGHLLPMDYSANA
2ch6A           LKEGFLLALTQGREIQAQNFFSSFTLMKLRHSSALGGALGARHIGHLLPMDYSAN-
1czaN           LNSTCDDSILVKTVCG----------------------------------------
3b8aX           --------------------------------------------------------
2ch6B           LKEGFLLALTQGREIQAQNFFSSFTLMKLRHSSALGGASLRHMDYSANA-------
2ch5A           LKEGFLLALTQGRAQNFFSSFTMKLRHS---SALGGASLGARHIGHLLPMDYSAN-
2ch5C           SVWKSWELLKELALTQGREFFSSFTLMKLRHSSALGGAS-----------------
3c0bA           ILENVENVAEKYGSK-----------------------------------------
3djcB           --------------------------------------------------------
3djcD           QGLYDPDLVLQGIRLAAMMNT-----------------------------------
3bexA           MIK-----------------------------------------------------
1bu6Y           --------------------------------------------------------
3bf3C           --------------------------------------------------------
1bu6O           --------------------------------------------------------