[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for sent8:ACF68005.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2auvA.bssp"

## Summary of PDB Search
:166
    5e-24  30%  2auvA  [x.x.x] POTENTIAL NAD-REDUCING HYDROGENASE SUBUNIT
:166

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2auvA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxQPVGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQTTFDGRFTLLPTCCLGNCDKG
2auvA           -----------VPKGKYPISVCMGTACFVKGADKVVHAFKEQLKIDIGDVTPDGRFSIDTLRCVGGCALA


                         +         .         .         .         .         *         .:210
query           PNMMIDEDTHSHLTPEAIPELLERYx
2auvA           PIVMVGEKVYGNVTPGQVKKILAEY-