[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for sent8:ACF68113.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3a2bA.bssp"
#ERROR : Can't open dsspfile "1bs0A.bssp"
#ERROR : Can't open dsspfile "1djeA.bssp"
#ERROR : Can't open dsspfile "2bwpB.bssp"
#ERROR : Can't open dsspfile "2bwoD.bssp"
#ERROR : Can't open dsspfile "2bwnD.bssp"
#ERROR : Can't open dsspfile "2bwpA.bssp"
#ERROR : Can't open dsspfile "2cdmA.bssp"
#ERROR : Can't open dsspfile "2bwoB.bssp"
#ERROR : Can't open dsspfile "2bwnB.bssp"
#ERROR : Can't open dsspfile "2bwnA.bssp"
#ERROR : Can't open dsspfile "2bwoA.bssp"
#ERROR : Can't open dsspfile "2bwnE.bssp"
#ERROR : Can't open dsspfile "1d2fB.bssp"
#ERROR : Can't open dsspfile "1d2fA.bssp"
#ERROR : Can't open dsspfile "1dfoB.bssp"
#ERROR : Can't open dsspfile "1djuA.bssp"
#ERROR : Can't open dsspfile "1ecxA.bssp"
#ERROR : Can't open dsspfile "1b5pA.bssp"
#ERROR : Can't open dsspfile "2c7tA.bssp"
#ERROR : Can't open dsspfile "2douB.bssp"
#ERROR : Can't open dsspfile "1bjwA.bssp"
#ERROR : Can't open dsspfile "2bhxB.bssp"
#ERROR : Can't open dsspfile "1eg5B.bssp"
#ERROR : Can't open dsspfile "2bieB.bssp"
#ERROR : Can't open dsspfile "1ecxB.bssp"
#ERROR : Can't open dsspfile "1eg5A.bssp"
#ERROR : Can't open dsspfile "1dfoA.bssp"
#ERROR : Can't open dsspfile "3e77A.bssp"
#ERROR : Can't open dsspfile "2dgmB.bssp"
#ERROR : Can't open dsspfile "2byjA.bssp"
#ERROR : Can't open dsspfile "1djuB.bssp"
#ERROR : Can't open dsspfile "2cfbA.bssp"
#ERROR : Can't open dsspfile "2douA.bssp"
#ERROR : Can't open dsspfile "2c81A.bssp"
#ERROR : Can't open dsspfile "2dkjA.bssp"
#ERROR : Can't open dsspfile "3bb8A.bssp"
#ERROR : Can't open dsspfile "1ay4B.bssp"
#ERROR : Can't open dsspfile "3dzzB.bssp"
#ERROR : Can't open dsspfile "1bkgA.bssp"
#ERROR : Can't open dsspfile "5bj4A.bssp"
#ERROR : Can't open dsspfile "3dydA.bssp"
#ERROR : Can't open dsspfile "3dzzA.bssp"
#ERROR : Can't open dsspfile "3dydB.bssp"
#ERROR : Can't open dsspfile "3cq6A.bssp"
#ERROR : Can't open dsspfile "1bjnA.bssp"
#ERROR : Can't open dsspfile "3e77C.bssp"
#ERROR : Can't open dsspfile "1b5oA.bssp"
#ERROR : Can't open dsspfile "1ay5B.bssp"
#ERROR : Can't open dsspfile "3cq4B.bssp"
#ERROR : Can't open dsspfile "2dgmE.bssp"
#ERROR : Can't open dsspfile "3cq4A.bssp"
#ERROR : Can't open dsspfile "1ejiA.bssp"
#ERROR : Can't open dsspfile "3bcxA.bssp"
#ERROR : Can't open dsspfile "3bn1C.bssp"
#ERROR : Can't open dsspfile "2cstA.bssp"
#ERROR : Can't open dsspfile "5bj3A.bssp"
#ERROR : Can't open dsspfile "2c0rA.bssp"
#ERROR : Can't open dsspfile "2aevA.bssp"
#ERROR : Can't open dsspfile "3cq5B.bssp"
#ERROR : Can't open dsspfile "2e7jA.bssp"
#ERROR : Can't open dsspfile "2aeuA.bssp"
#ERROR : Can't open dsspfile "1asfA.bssp"
#ERROR : Can't open dsspfile "3eiaA.bssp"
#ERROR : Can't open dsspfile "3bs8A.bssp"
#ERROR : Can't open dsspfile "1ariA.bssp"
#ERROR : Can't open dsspfile "1cl1B.bssp"
#ERROR : Can't open dsspfile "3ei7B.bssp"
#ERROR : Can't open dsspfile "3e2yA.bssp"
#ERROR : Can't open dsspfile "2bylA.bssp"
#ERROR : Can't open dsspfile "1c7gA.bssp"
#ERROR : Can't open dsspfile "1c4kA.bssp"
#ERROR : Can't open dsspfile "2bieA.bssp"
#ERROR : Can't open dsspfile "3bcxB.bssp"
#ERROR : Can't open dsspfile "3ei7A.bssp"
#ERROR : Can't open dsspfile "3ei8A.bssp"
#ERROR : Can't open dsspfile "2dgkC.bssp"
#ERROR : Can't open dsspfile "1bj4A.bssp"
#ERROR : Can't open dsspfile "1cj0A.bssp"
#ERROR : Can't open dsspfile "1dgdA.bssp"
#ERROR : Can't open dsspfile "2dgkA.bssp"
#ERROR : Can't open dsspfile "2ch2A.bssp"
#ERROR : Can't open dsspfile "2aatA.bssp"
#ERROR : Can't open dsspfile "3dr7B.bssp"
#ERROR : Can't open dsspfile "2e54A.bssp"
#ERROR : Can't open dsspfile "3drdA.bssp"
#ERROR : Can't open dsspfile "1cj0B.bssp"
#ERROR : Can't open dsspfile "2cinA.bssp"
#ERROR : Can't open dsspfile "2e7uA.bssp"
#ERROR : Can't open dsspfile "2dr1B.bssp"
#ERROR : Can't open dsspfile "1b8gB.bssp"
#ERROR : Can't open dsspfile "1e5eB.bssp"
#ERROR : Can't open dsspfile "2dgmA.bssp"
#ERROR : Can't open dsspfile "1e5eA.bssp"
#ERROR : Can't open dsspfile "3bn1D.bssp"
#ERROR : Can't open dsspfile "2ch1A.bssp"
#ERROR : Can't open dsspfile "1bw0A.bssp"
#ERROR : Can't open dsspfile "3dr4A.bssp"
#ERROR : Can't open dsspfile "2eh6A.bssp"
#ERROR : Can't open dsspfile "1aiaA.bssp"
#ERROR : Can't open dsspfile "3aatA.bssp"
#ERROR : Can't open dsspfile "1arhA.bssp"
#ERROR : Can't open dsspfile "1aamA.bssp"
#ERROR : Can't open dsspfile "1d7uA.bssp"
#ERROR : Can't open dsspfile "1dtyA.bssp"
#ERROR : Can't open dsspfile "1c7nA.bssp"
#ERROR : Can't open dsspfile "3ei6B.bssp"
#ERROR : Can't open dsspfile "3cbfA.bssp"
#ERROR : Can't open dsspfile "3dxvA.bssp"
#ERROR : Can't open dsspfile "3ei9A.bssp"
#ERROR : Can't open dsspfile "3dr4C.bssp"
#ERROR : Can't open dsspfile "3bcbA.bssp"
#ERROR : Can't open dsspfile "3e77B.bssp"
#ERROR : Can't open dsspfile "3ecdA.bssp"
#ERROR : Can't open dsspfile "1cl1A.bssp"
#ERROR : Can't open dsspfile "3b46B.bssp"
#ERROR : Can't open dsspfile "2egyD.bssp"
#ERROR : Can't open dsspfile "1ajsA.bssp"
#ERROR : Can't open dsspfile "3eiaB.bssp"
#ERROR : Can't open dsspfile "2dgmC.bssp"
#ERROR : Can't open dsspfile "3ei6A.bssp"
#ERROR : Can't open dsspfile "1arsA.bssp"
#ERROR : Can't open dsspfile "2dr1A.bssp"
#ERROR : Can't open dsspfile "3dxvB.bssp"
#ERROR : Can't open dsspfile "1bqaA.bssp"
#ERROR : Can't open dsspfile "3bc8A.bssp"
#ERROR : Can't open dsspfile "1aheA.bssp"
#ERROR : Can't open dsspfile "3ei9B.bssp"
#ERROR : Can't open dsspfile "1ay4A.bssp"
#ERROR : Can't open dsspfile "3cq5A.bssp"
#ERROR : Can't open dsspfile "1ax4A.bssp"
#ERROR : Can't open dsspfile "2egyC.bssp"
#ERROR : Can't open dsspfile "2ctzA.bssp"
#ERROR : Can't open dsspfile "3bn1A.bssp"
#ERROR : Can't open dsspfile "1c0nA.bssp"
#ERROR : Can't open dsspfile "1cs1A.bssp"
#ERROR : Can't open dsspfile "1czcA.bssp"
#ERROR : Can't open dsspfile "3ecdB.bssp"
#ERROR : Can't open dsspfile "2c44C.bssp"
#ERROR : Can't open dsspfile "3e2fA.bssp"
#ERROR : Can't open dsspfile "3bv0B.bssp"
#ERROR : Can't open dsspfile "1akaA.bssp"
#ERROR : Can't open dsspfile "3b8xA.bssp"
#ERROR : Can't open dsspfile "2d5yA.bssp"
#ERROR : Can't open dsspfile "1b9iA.bssp"
#ERROR : Can't open dsspfile "1b4xA.bssp"
#ERROR : Can't open dsspfile "1asbA.bssp"
#ERROR : Can't open dsspfile "3e9kA.bssp"
#ERROR : Can't open dsspfile "3dr4B.bssp"
#ERROR : Can't open dsspfile "3bwnD.bssp"
#ERROR : Can't open dsspfile "3b46A.bssp"
#ERROR : Can't open dsspfile "3bcaA.bssp"
#ERROR : Can't open dsspfile "2bkwA.bssp"
#ERROR : Can't open dsspfile "2a0yA.bssp"
#ERROR : Can't open dsspfile "3d6kB.bssp"
#ERROR : Can't open dsspfile "2d66A.bssp"
#ERROR : Can't open dsspfile "1bjoA.bssp"
#ERROR : Can't open dsspfile "3bv0A.bssp"
#ERROR : Can't open dsspfile "1bw0B.bssp"
#ERROR : Can't open dsspfile "3b8xB.bssp"
#ERROR : Can't open dsspfile "2cy8A.bssp"
#ERROR : Can't open dsspfile "2egyB.bssp"
#ERROR : Can't open dsspfile "3dr4D.bssp"
#ERROR : Can't open dsspfile "3ecdC.bssp"
#ERROR : Can't open dsspfile "3d6kC.bssp"
#ERROR : Can't open dsspfile "1b8gA.bssp"
#ERROR : Can't open dsspfile "1agxA.bssp"
#ERROR : Can't open dsspfile "2a7vA.bssp"
#ERROR : Can't open dsspfile "3bigA.bssp"
#ERROR : Can't open dsspfile "1b9hA.bssp"
#ERROR : Can't open dsspfile "1bqdA.bssp"
#ERROR : Can't open dsspfile "2cb1A.bssp"
#ERROR : Can't open dsspfile "3d19E.bssp"
#ERROR : Can't open dsspfile "3dc1A.bssp"
#ERROR : Can't open dsspfile "2d64A.bssp"
#ERROR : Can't open dsspfile "3cogB.bssp"
#ERROR : Can't open dsspfile "2d61A.bssp"
#ERROR : Can't open dsspfile "3d6kA.bssp"
#ERROR : Can't open dsspfile "1awiA.bssp"
#ERROR : Can't open dsspfile "3d6kD.bssp"
#ERROR : Can't open dsspfile "3caiA.bssp"
#ERROR : Can't open dsspfile "3du4A.bssp"
#ERROR : Can't open dsspfile "3bwnB.bssp"
#ERROR : Can't open dsspfile "1ajrA.bssp"
#ERROR : Can't open dsspfile "7aatA.bssp"
#ERROR : Can't open dsspfile "3ecdD.bssp"
#ERROR : Can't open dsspfile "2c44A.bssp"
#ERROR : Can't open dsspfile "3d19A.bssp"
#ERROR : Can't open dsspfile "3e6gD.bssp"
#ERROR : Can't open dsspfile "1eghA.bssp"
#ERROR : Can't open dsspfile "3e6gB.bssp"
#ERROR : Can't open dsspfile "3eh2A.bssp"
#ERROR : Can't open dsspfile "3dc1B.bssp"
#ERROR : Can't open dsspfile "2btwB.bssp"
#ERROR : Can't open dsspfile "2c44B.bssp"
#ERROR : Can't open dsspfile "3dc1D.bssp"
#ERROR : Can't open dsspfile "3bwnA.bssp"
#ERROR : Can't open dsspfile "3bwoA.bssp"
#ERROR : Can't open dsspfile "2btwA.bssp"
#ERROR : Can't open dsspfile "1btcA.bssp"
#ERROR : Can't open dsspfile "3cogD.bssp"
#ERROR : Can't open dsspfile "1c8nA.bssp"
#ERROR : Can't open dsspfile "1b93B.bssp"
#ERROR : Can't open dsspfile "1bybA.bssp"
#ERROR : Can't open dsspfile "3bh1C.bssp"
#ERROR : Can't open dsspfile "3drdB.bssp"
#ERROR : Can't open dsspfile "3dodB.bssp"
#ERROR : Can't open dsspfile "3dodA.bssp"
#ERROR : Can't open dsspfile "3bwnF.bssp"
#ERROR : Can't open dsspfile "2bhgA.bssp"
#ERROR : Can't open dsspfile "3e6gA.bssp"
#ERROR : Can't open dsspfile "2b34A.bssp"
#ERROR : Can't open dsspfile "2dbnA.bssp"
#ERROR : Can't open dsspfile "3bh1A.bssp"
#ERROR : Can't open dsspfile "3c01F.bssp"
#ERROR : Can't open dsspfile "3c01E.bssp"
#ERROR : Can't open dsspfile "3bmaD.bssp"
#ERROR : Can't open dsspfile "2bu3A.bssp"
#ERROR : Can't open dsspfile "3bh1D.bssp"
#ERROR : Can't open dsspfile "3bwoC.bssp"
#ERROR : Can't open dsspfile "1dy2A.bssp"

## Summary of PDB Search
:385
    e-103  28%  3a2bA  [x.x.x] SERINE PALMITOYLTRANSFERASE
    2e-96  74%  1bs0A  [c.67.1] PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)
    8e-96  73%  1djeA  [c.67.1] 8-AMINO-7-OXONANOATE SYNTHASE
    1e-74  27%  2bwpB  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    1e-40  23%  2bwoD  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    1e-38  23%  2bwnD  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    3e-37  23%  2bwpA  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    1e-35   8%  2cdmA  [x.x.x] TRWC
    1e-35  22%  2bwoB  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    1e-35  22%  2bwnB  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    2e-33  23%  2bwnA  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    2e-33  23%  2bwoA  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    6e-32  26%  2bwnE  [x.x.x] 5-AMINOLEVULINATE SYNTHASE
    1e-27  14%  1d2fB  [c.67.1] MALY PROTEIN
    1e-26  13%  1d2fA  [c.67.1] MALY PROTEIN
    2e-26  14%  1dfoB  [c.67.1] SERINE HYDROXYMETHYLTRANSFERASE
    1e-25  11%  1djuA  [c.67.1] AROMATIC AMINOTRANSFERASE
    1e-25  12%  1ecxA  [c.67.1] AMINOTRANSFERASE
    1e-25  14%  1b5pA  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    2e-25  11%  2c7tA  [x.x.x] GLUTAMINE-2-DEOXY-SCYLLO-INOSOSE
    2e-25  13%  2douB  [x.x.x] PROBABLE N-SUCCINYLDIAMINOPIMELATE
    7e-25  13%  1bjwA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    8e-25  10%  2bhxB  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    2e-24  12%  1eg5B  [c.67.1] AMINOTRANSFERASE
    2e-24  10%  2bieB  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    3e-24  13%  1ecxB  [c.67.1] AMINOTRANSFERASE
    3e-24  12%  1eg5A  [c.67.1] AMINOTRANSFERASE
    4e-24  15%  1dfoA  [c.67.1] SERINE HYDROXYMETHYLTRANSFERASE
    5e-24  11%  3e77A  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    9e-24  10%  2dgmB  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    9e-24  18%  2byjA  [x.x.x] ORNITHINE AMINOTRANSFERASE
    1e-23  11%  1djuB  [c.67.1] AROMATIC AMINOTRANSFERASE
    1e-23  15%  2cfbA  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    1e-23  13%  2douA  [x.x.x] PROBABLE N-SUCCINYLDIAMINOPIMELATE
    2e-23  11%  2c81A  [x.x.x] GLUTAMINE-2-DEOXY-SCYLLO-INOSOSE
    2e-23  11%  2dkjA  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE
    4e-23  12%  3bb8A  [x.x.x] CDP-4-KETO-6-DEOXY-D-GLUCOSE-3-DEHYDRASE
    5e-23  12%  1ay4B  [c.67.1] AROMATIC AMINO ACID AMINOTRANSFERASE
    6e-23  12%  3dzzB  [x.x.x] PUTATIVE PYRIDOXAL 5'-PHOSPHATE-DEPENDENT C-S
    6e-23  13%  1bkgA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    7e-23  14%  5bj4A  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    8e-23  12%  3dydA  [x.x.x] TYROSINE AMINOTRANSFERASE
    1e-22  12%  3dzzA  [x.x.x] PUTATIVE PYRIDOXAL 5'-PHOSPHATE-DEPENDENT C-S
    1e-22  12%  3dydB  [x.x.x] TYROSINE AMINOTRANSFERASE
    1e-22  11%  3cq6A  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    2e-22  11%  1bjnA  [c.67.1] PHOSPHOSERINE AMINOTRANSFERASE
    2e-22  11%  3e77C  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    2e-22  12%  1b5oA  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    2e-22  11%  1ay5B  [c.67.1] AROMATIC AMINO ACID AMINOTRANSFERASE
    3e-22  10%  3cq4B  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    3e-22  10%  2dgmE  [c.67.1 (1pmmA)] GLUTAMATE DECARBOXYLASE BETA
    4e-22  11%  3cq4A  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    5e-22  10%  1ejiA  [c.67.1] SERINE HYDROXYMETHYLTRANSFERASE
    5e-22  12%  3bcxA  [x.x.x] CDP-6-DEOXY-L-THREO-D-GLYCERO-4-HEXULOSE-3-
    9e-22  12%  3bn1C  [x.x.x] PEROSAMINE SYNTHETASE
    9e-22  10%  2cstA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    1e-21  13%  5bj3A  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    1e-21   8%  2c0rA  [c.67.1 (1bt4A)] PHOSPHOSERINE AMINOTRANSFERASE
    2e-21  12%  2aevA  [x.x.x] HYPOTHETICAL PROTEIN MJ0158
    2e-21  11%  3cq5B  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    2e-21  14%  2e7jA  [x.x.x] SEP-TRNA:CYS-TRNA SYNTHASE
    2e-21  12%  2aeuA  [x.x.x] HYPOTHETICAL PROTEIN MJ0158
    3e-21  12%  1asfA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    3e-21  10%  3eiaA  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    3e-21  10%  3bs8A  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    5e-21  11%  1ariA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    6e-21  11%  1cl1B  [c.67.1] CYSTATHIONINE BETA-LYASE
    6e-21   9%  3ei7B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    7e-21  10%  3e2yA  [x.x.x] KYNURENINE-OXOGLUTARATE TRANSAMINASE 3
    8e-21  20%  2bylA  [x.x.x] ORNITHINE AMINOTRANSFERASE
    9e-21   7%  1c7gA  [c.67.1] TYROSINE PHENOL-LYASE
    9e-21  11%  1c4kA  [c.23.1 - c.67.1 - d.125.1] PROTEIN (ORNITHINE DECARBOXYLASE)
    9e-21  11%  2bieA  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    1e-20  12%  3bcxB  [x.x.x] CDP-6-DEOXY-L-THREO-D-GLYCERO-4-HEXULOSE-3-
    1e-20  11%  3ei7A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    1e-20  10%  3ei8A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    1e-20  10%  2dgkC  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    2e-20  11%  1bj4A  [c.67.1] PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)
    2e-20  12%  1cj0A  [c.67.1] PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)
    2e-20  11%  1dgdA  [x.x.x] DIALKYLGLYCINE DECARBOXYLASE
    3e-20  10%  2dgkA  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    3e-20  10%  2ch2A  [x.x.x] 3-HYDROXYKYNURENINE TRANSAMINASE
    4e-20  11%  2aatA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    4e-20  13%  3dr7B  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    5e-20  16%  2e54A  [x.x.x] ACETYLORNITHINE AMINOTRANSFERASE
    5e-20  12%  3drdA  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    6e-20  13%  1cj0B  [c.67.1] PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)
    6e-20  17%  2cinA  [x.x.x] L-LYSINE-EPSILON AMINOTRANSFERASE
    6e-20  14%  2e7uA  [x.x.x] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE
    8e-20  14%  2dr1B  [x.x.x] 386AA LONG HYPOTHETICAL SERINE AMINOTRANSFERASE
    2e-19  10%  1b8gB  [c.67.1] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
    2e-19  11%  1e5eB  [c.67.1] METHIONINE GAMMA-LYASE
    2e-19  10%  2dgmA  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    2e-19  11%  1e5eA  [c.67.1] METHIONINE GAMMA-LYASE
    2e-19  13%  3bn1D  [x.x.x] PEROSAMINE SYNTHETASE
    3e-19  10%  2ch1A  [x.x.x] 3-HYDROXYKYNURENINE TRANSAMINASE
    3e-19   9%  1bw0A  [c.67.1] PROTEIN (TYROSINE AMINOTRANSFERASE)
    3e-19  12%  3dr4A  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    4e-19  14%  2eh6A  [x.x.x] ACETYLORNITHINE AMINOTRANSFERASE
    5e-19  11%  1aiaA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    7e-19   9%  3aatA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    7e-19  10%  1arhA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    7e-19  10%  1aamA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    7e-19  11%  1d7uA  [c.67.1] PROTEIN (2,2-DIALKYLGLYCINE DECARBOXYLASE
    7e-19  13%  1dtyA  [c.67.1] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    8e-19   9%  1c7nA  [c.67.1] CYSTALYSIN
    9e-19  10%  3ei6B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    9e-19  12%  3cbfA  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    1e-18  19%  3dxvA  [x.x.x] ALPHA-AMINO-EPSILON-CAPROLACTAM RACEMASE
    1e-18  11%  3ei9A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    1e-18  13%  3dr4C  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    1e-18   9%  3bcbA  [x.x.x] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    2e-18  10%  3e77B  [x.x.x] PHOSPHOSERINE AMINOTRANSFERASE
    2e-18  16%  3ecdA  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    3e-18  11%  1cl1A  [c.67.1] CYSTATHIONINE BETA-LYASE
    3e-18   9%  3b46B  [x.x.x] AMINOTRANSFERASE BNA3
    3e-18  13%  2egyD  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    3e-18   9%  1ajsA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    3e-18  10%  3eiaB  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    4e-18  10%  2dgmC  [x.x.x] GLUTAMATE DECARBOXYLASE BETA
    5e-18  11%  3ei6A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    6e-18  11%  1arsA  [c.67.1 (1argA)] ASPARTATE AMINOTRANSFERASE
    6e-18  13%  2dr1A  [x.x.x] 386AA LONG HYPOTHETICAL SERINE AMINOTRANSFERASE
    6e-18  16%  3dxvB  [x.x.x] ALPHA-AMINO-EPSILON-CAPROLACTAM RACEMASE
    7e-18  11%  1bqaA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    7e-18   9%  3bc8A  [x.x.x] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    7e-18  11%  1aheA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    8e-18  10%  3ei9B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    8e-18  13%  1ay4A  [c.67.1] AROMATIC AMINO ACID AMINOTRANSFERASE
    8e-18  12%  3cq5A  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    1e-17  11%  1ax4A  [c.67.1] TRYPTOPHANASE
    1e-17  11%  2egyC  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    1e-17  18%  2ctzA  [x.x.x] O-ACETYL-L-HOMOSERINE SULFHYDRYLASE
    2e-17  13%  3bn1A  [x.x.x] PEROSAMINE SYNTHETASE
    3e-17  12%  1c0nA  [c.67.1] PROTEIN (CSDB PROTEIN)
    3e-17  15%  1cs1A  [c.67.1] PROTEIN (CYSTATHIONINE GAMMA-SYNTHASE)
    4e-17  10%  1czcA  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    4e-17  15%  3ecdB  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    5e-17  13%  2c44C  [x.x.x] TRYPTOPHANASE
    5e-17   9%  3e2fA  [x.x.x] KYNURENINE-OXOGLUTARATE TRANSAMINASE 3
    5e-17  14%  3bv0B  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    6e-17  10%  1akaA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    8e-17  13%  3b8xA  [x.x.x] PYRIDOXAMINE 5-PHOSPHATE-DEPENDENT DEHYDRASE
    1e-16  10%  2d5yA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    1e-16  14%  1b9iA  [c.67.1] PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)
    1e-16  11%  1b4xA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    2e-16  11%  1asbA  [x.x.x] ASPARTATE AMINOTRANSFERASE
    2e-16   9%  3e9kA  [x.x.x] KYNURENINASE
    3e-16  13%  3dr4B  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    3e-16  12%  3bwnD  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    4e-16   9%  3b46A  [x.x.x] AMINOTRANSFERASE BNA3
    4e-16   8%  3bcaA  [x.x.x] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    5e-16  10%  2bkwA  [x.x.x] ALANINE-GLYOXYLATE AMINOTRANSFERASE 1
    8e-16  15%  2a0yA  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    9e-16  11%  3d6kB  [x.x.x] PUTATIVE AMINOTRANSFERASE
    2e-15   9%  2d66A  [x.x.x] ASPARTATE AMINOTRANSFERASE
    2e-15   9%  1bjoA  [c.67.1] PHOSPHOSERINE AMINOTRANSFERASE
    2e-15  15%  3bv0A  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    2e-15   9%  1bw0B  [c.67.1] PROTEIN (TYROSINE AMINOTRANSFERASE)
    2e-15  13%  3b8xB  [x.x.x] PYRIDOXAMINE 5-PHOSPHATE-DEPENDENT DEHYDRASE
    2e-15  13%  2cy8A  [x.x.x] D-PHENYLGLYCINE AMINOTRANSFERASE
    2e-15  13%  2egyB  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    3e-15  12%  3dr4D  [x.x.x] PUTATIVE PEROSAMINE SYNTHETASE
    4e-15  14%  3ecdC  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    8e-15   8%  3d6kC  [x.x.x] PUTATIVE AMINOTRANSFERASE
    1e-14   9%  1b8gA  [c.67.1] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
    1e-14   6%  1agxA  [x.x.x] GLUTAMINASE-ASPARAGINASE
    2e-14  10%  2a7vA  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE
    2e-14   8%  3bigA  [x.x.x] FRUCTOSE-1,6-BISPHOSPHATASE CLASS II GLPX
    3e-14  17%  1b9hA  [c.67.1] PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)
    4e-14   9%  1bqdA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    6e-14  19%  2cb1A  [x.x.x] O-ACETYL HOMOSERINE SULFHYDRYLASE
    6e-14   8%  3d19E  [x.x.x] CONSERVED METALLOPROTEIN
    6e-14   9%  3dc1A  [x.x.x] KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE
    6e-14  10%  2d64A  [x.x.x] ASPARTATE AMINOTRANSFERASE
    7e-14  14%  3cogB  [x.x.x] CYSTATHIONINE GAMMA-LYASE
    8e-14  10%  2d61A  [x.x.x] ASPARTATE AMINOTRANSFERASE
    9e-14   8%  3d6kA  [x.x.x] PUTATIVE AMINOTRANSFERASE
    9e-14  13%  1awiA  [d.110.1] PROFILIN
    1e-13   8%  3d6kD  [x.x.x] PUTATIVE AMINOTRANSFERASE
    2e-13  14%  3caiA  [x.x.x] POSSIBLE AMINOTRANSFERASE
    2e-13  16%  3du4A  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    3e-13  11%  3bwnB  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    5e-13  11%  1ajrA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    6e-13  10%  7aatA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    1e-12  16%  3ecdD  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    2e-12  13%  2c44A  [x.x.x] TRYPTOPHANASE
    2e-12   8%  3d19A  [x.x.x] CONSERVED METALLOPROTEIN
    2e-12  20%  3e6gD  [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN
    3e-12   9%  1eghA  [c.24.1] METHYLGLYOXAL SYNTHASE
    1e-11  20%  3e6gB  [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN
    2e-11  15%  3eh2A  [x.x.x] PROTEIN TRANSPORT PROTEIN SEC24C
    2e-11  10%  3dc1B  [x.x.x] KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE
    5e-11   8%  2btwB  [x.x.x] ALR0975 PROTEIN
    1e-10  13%  2c44B  [x.x.x] TRYPTOPHANASE
    1e-10   8%  3dc1D  [x.x.x] KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE
    2e-10  11%  3bwnA  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    1e-09   9%  3bwoA  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    1e-09  11%  2btwA  [x.x.x] ALR0975 PROTEIN
    2e-09   8%  1btcA  [x.x.x] BETA-AMYLASE
    3e-09  16%  3cogD  [x.x.x] CYSTATHIONINE GAMMA-LYASE
    3e-09   7%  1c8nA  [b.121.4] COAT PROTEIN
    1e-08   8%  1b93B  [c.24.1] PROTEIN (METHYLGLYOXAL SYNTHASE)
    9e-08   7%  1bybA  [x.x.x] BETA-AMYLASE
    2e-07   9%  3bh1C  [x.x.x] UPF0371 PROTEIN DIP2346
    7e-07  18%  3drdB  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    9e-07  18%  3dodB  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    9e-07  18%  3dodA  [x.x.x] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    2e-06  13%  3bwnF  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    3e-05  12%  2bhgA  [x.x.x] FOOT-AND-MOUTH DISEASE VIRUS 3C PROTEASE
    4e-05  29%  3e6gA  [x.x.x] CYSTATHIONINE GAMMA-LYASE-LIKE PROTEIN
    5e-05  11%  2b34A  [x.x.x] MAR1 RIBONUCLEASE
    6e-05  12%  2dbnA  [x.x.x] HYPOTHETICAL PROTEIN YBIU
    6e-05   5%  3bh1A  [x.x.x] UPF0371 PROTEIN DIP2346
    7e-05  10%  3c01F  [x.x.x] SURFACE PRESENTATION OF ANTIGENS PROTEIN SPAS
    1e-04  10%  3c01E  [x.x.x] SURFACE PRESENTATION OF ANTIGENS PROTEIN SPAS
    2e-04   9%  3bmaD  [x.x.x] D-ALANYL-LIPOTEICHOIC ACID SYNTHETASE
    3e-04  13%  2bu3A  [x.x.x] ALR0975 PROTEIN
    5e-04  14%  3bh1D  [x.x.x] UPF0371 PROTEIN DIP2346
    6e-04   9%  3bwoC  [x.x.x] L-TRYPTOPHAN AMINOTRANSFERASE
    9e-04  11%  1dy2A  [d.169.1] COLLAGEN ALPHA1(XV) CHAIN
:385

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSWQQRVDDALTARRVTDTLRRRYVVSQGAGRWLVANGRQYLNFSSNDYLGLSQHPQIIRAWQQAATRFX
3a2bA           ---QFKIVEELKAKG---LYAYFRPIQSKQDTEVKIDGRRVLMFGSNSYLGLTTDTRIIKAAQDALEKYG
1bs0A           -SWQEKINAALDARRAADALRRRYPVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIRAWQQGAEQFG
1djeA           -SWQEKINAALDARGAADALRRRYPVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIRAWQQGAEQFG
2bwpB           MDYNLALDKAIQKLHDEGRYRTFIDIEREKGAFPKAQWQDITVWCGNDYLGMGQHPVVLAAMHEALEAVG
2bwoD           MDYNLALDKAIQKLH-DEGRYRTFAFPKAQWNRPDGGKQDITVWCGNDYLGMGQHPVVLAAMHEALEAVG
2bwnD           MDYNLALDKAIQKLHFIDIEREKGAFPKAQWNRPDGGKQDITVWCGNDYLGMGQHPVVLAAMHEALEAVG
2bwpA           MDYNLALDKAIQKLHFIDIEREKGAFPKAQWNRPDGGKQDITVWCGNDYLGMGQHPVVLAAMHEALEAVG
2cdmA           ----------------------------------RAASFYASEWQGKGAEELGLSGEVDSKRFREHRIRS
2bwoB           MDYNLALDKAIQKLH-DEGRYRTFAFPKAQWNRPDGGKQDITVWCGNDYLGMGQHPVVLAAMHEALEAVG
2bwnB           MDYNLALDKAIQKLHFIDIEREKGAFPKAQWNRPDGGKQDITVWCGNDYLGMGQHPVVLAAMHEALEAVG
2bwnA           --IQKLHDEGR-YRTFIDIEREKGAFPKAQWNRPDGGKQDITVWCGNDYLGMGQHPVVLAAMHEALEAVG
2bwoA           MDYNLALDKAIQKLHFIDIEREKGAFPKAQWNRPDGGKQDITVWCGNDYLGMGQHPVVLAAMHEALEAVG
2bwnE           ----QKLHDEGRYRTFIDIEREKGAFPKAQWNRPDGGKQDITVWCGNDYLGMGQHPVVLAAMHEALEAVG
1d2fB           -----------------------------------FSKVVLLPFTISD-MDFATAPCIIEALNQRLMHGV
1d2fA           -----------------------------------------LPFTISDMDFAT-APCIIEALNQRLMHGV
1dfoB           ------------------------------EQEKVRQEEHIELIASENYTSPRVMQAQGSQLTNKYAEGY
1djuA           -----------------------------------VSAKDVISLGIGEPDF-DTPQHIKEYAKEALDKGL
1ecxA           --------------------------------------RVYFDNNATTRV----DDRVLEEMIVFYREKY
1b5pA           ------------------------AVNAKALELRR-QGVDLVALTAGEP-DFDTPEHVKEAARRALAQGK
2c7tA           --------------------------------------------------HWPEWPQHSDRTRRKIEEVF
2douB           ---------------------------------ARERGVGLIDLSIGSTLPPPEAPLKALAEALNDPTTY
1bjwA           ------------------------AVNAKALELR-RQGVDLVALTAGEP-DFDTPEHVKEAARRALAQKT
2bhxB           --------------------------------------KQVFNF----NAGPSAPKPALERAQKELLNFN
1eg5B           --------------------------------------RVYFDNNATTRV----DDRVLEEIVFYREKYG
2bieB           ----------------------------------------------NFNAGPSAPKPALERAQKELLNFN
1ecxB           --------------------------------------RVYF-----DNNATTRDDRVLEEMIVFYREYG
1eg5A           --------------------------------------RVYFDNNATTRV----DDRVLEEIVFYREKYG
1dfoA           --------------------DYDAELWQAMEQEKVRQEEHIELIASENYT----SPRVMQAQGSQLTNKY
3e77A           --------------------------------------------TENLYFQSMLLLEIQKELLDYKGVGI
2dgmB           ---SELLDSRFGAKSISTIAESKRLHEMRDDVAFQINDELYLDGNARQNLATFCDENVHKLMDLSINKNW
2byjA           --------------------PLPVALERGKGIYLWVEGRKYFDFLSSISAVNQCHPKIVNALKSQVDKLT
1djuB           -----------------------------ALSDRLELVSDVISLGIGEPDFDT-PQHIKEYAKEALDKGL
2cfbA           ------------------------VFDHVKGAHIWVDGNQYIDYVGSWGP----AIVGHAHPEVIDALHA
2douA           ---------------------------------ARERGVGLIDLSIGSTLPPPEAPLKALAEALNDPTTY
2c81A           ------------------------------------------------------SDRTRRKIEEVFQSNR
2dkjA           --------------------KRDEALFELIALEEKRQREGLELIASENFVSKQVREAVGSVLTNKYAEGY
3bb8A           ----------------------EELRQQIAELVYAETAMAPKPFEAGKSVVPPSGKVIGTKELQLMVEAS
1ay4B           -----------------------------------DPRQGKIDLGVGVYKDATGHTPIMRAVHAAEQRML
3dzzB           ------------------------VPKRQGNSIKWVLKEKELPWIAEDF---KIAPEIASEEKLKVAAFG
1bkgA           ------------------------AVNAKALELRR-QGVDLVALTAGEP-DFDTPEHVKEAARRALAQGK
5bj4A           -----------------------------------KPGVDLVALTAGEP-DFDTPEHVKEAARRALAQGK
3dydA           -----------------------WSVRPSDKVKP-NPNKTMISLSIGDFGNLPTDPEVTQAMKDALDSGK
3dzzA           ------------------------VPKRQGNSIKWVLKEKELPWIAEDFKI---APEIASEEKLKVAAFG
3dydB           -----------------------------------NPNKTMISLSIGDFGNLPTDPEVTQAMKDALDSGK
3cq6A           -------------------------------AYGAPQLNVDIRLNTNENPY-PPSEALVADLVATVDKIA
1bjnA           ----------------------------------------------NFSSGPAMPAEVLKQAQQELRDWN
3e77C           --------------------------------------------TENLYFQSMLLLEIQKELLDYKGVGI
1b5oA           ------------------------AVNAKALELRR-QGVDLVALTAGEP-DFDTPEHVKEAARRALAQGK
1ay5B           ------------------------LKPQAPDKILLMGEFGKIDLGVGVYKDATGHTPIMRAVHAAEQRML
3cq4B           -------------------------------LPLREELRVDIRLNTNEN-PYPPSEALVADLVATVDKIA
2dgmE           ---SELLDSRFGAKSISTIAESKRLHEMRDDVAFQINDELYLDGNARQNLATFCQTWDDENVHKLMDLSI
3cq4A           -----------------------------------EELRVDIRLNTNEN-PYPPSEALVADLVATVDKIA
1ejiA           -------ADRDATLWASHEKLSQPLKAEVYSIIKKESNRQLELIASENFASRAVLEALGSSLNNKYSGQR
3bcxA           ----------------------EELRQQIAELVAQETAMAPKPFEAGKSVVPPSGKVIGTKELQLMVEAS
3bn1C           -------------------------------------------------ISVA-APRLDGNERDYVLECM
2cstA           -----------------------------------DGDSRKVNLGVRTDEGQPWVLPVVRKVEQLIAGDG
5bj3A           -----------------------------------QAMKPLVALTAGEP-DFDTPEHVKEAARRALAQGK
2c0rA           ------------------------------------SERAYN-----FNAGPAAPLEVLERAQAEFVDYQ
2aevA           --------------------------------------NEKGRDALYDLSGLSGGFLIDEKDKALLNTYI
3cq5B           -------------KITLSDLPLREELRGEHAYGA-PQLNVDIRLNTNEN-PYPPSEALVADLVATVDKIA
2e7jA           ------------------------------------------DFIN--IDPLQTGGKLTEEARQALLEWP
2aeuA           --------------------------------------NEKGRDALYDLSGLSGGFLIDEKDKALLNTYI
1asfA           ------------------------DPILGLADLFRDERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLL
3eiaA           ------------------------ARRRSAHLL-KYPDAQVISLGIGDTTE-PIPEVITSAMAKKAHELS
3bs8A           -------------RAFKSVDMDPIFMERGKGSKIFIDGNEYIDYVL----SWGPLILGHTNDRVVESLKK
1ariA           --------------------AAPADPILGLADLFRAERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLL
1cl1B           --------------------------------------YTLGAVNSVIQRASSLVFDSVEAKKHATRNRA
3ei7B           --YKTKVSRNSNMSKLQAGYLFPEIARRRSAHLLKYPDAQVISLGIGDT-TEPIPEVITSAMAKKAHELS
3e2yA           --------NAKRIEGLDSNVWVEFT--------KLAADPSVVNLGQGFP-DISPPSYVKEELSKAAFIDN
2bylA           -------------------------LERGKGIYLWVEGRKYFDFLSSISAVNQCHPKIVNALKSQVDKLT
1c7gA           ----------AEPFRIKSVETVSMISRDERVKKMQEAGYNTFLLNSKDIYIDLLTDSGTNAMSDKQWAGM
1c4kA           -------------------------------IQFDCPGHQGGQYYRKHPAGREFYDFFGETVFRADLCNA
2bieA           ----------------------------------------------NFNAGPSAPKPALERAQKELLNFN
3bcxB           ----------------------EELRQQIAELVYAETAMAPKPFEAGKSVVPPSGKVIGTKELQLMVEAS
3ei7A           ------------------------ARRRSAHLLKY-PDAQVISLGIGDTTE-PIPEVITSAMAKKAHELS
3ei8A           ------------------------EIARRRSAHLLYPDAQVISLGIGDT-TEPIPEVITSAMAKKAHELS
2dgkC           --------------------KRFPLHEMRDDVAFQINDELYLDGNARQNLATFCDENVHKLMDLSINKNW
1bj4A           ------------WSSHDAMLAQPLKDSDVEVYNIIKESNRQRLIASENFASRAVLEALGSCLNNKYSEGY
1cj0A           --------------------DSDAEVYDIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSQRY
1dgdA           LNDDATFWRNARHRYGGTFEPMIIERAKGSFVYD-ADGRAILDFTSGHLFSGMLSRPVVDLATRLANITP
2dgkA           ------------------------LHEMRDDVAFQINDELYLDGNARQNLATFCDENVHKLMDLSINKNW
2ch2A           -----------------------------------PASLRNPLIIPEKIMMGPGPSNCSKRVLTAMTNTV
2aatA           ------------------------DPILGLADLFRDERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLL
3dr7B           ------------------------------------------------------APRLDGNERDYVLECM
2e54A           ------------------------TFVYGKGSWIYEKGNAYLDFTSGIAVNVLGHSHP---RLVEAIKDQ
3drdA           --SKKHLWLPFTQMKDYDENPLIIESGTGIKVKDIN-GKEYYDGFSSVWLN--VHGHRKKELDDAIKKQL
1cj0B           --------EQMLAQPLKDSDAEYDIIKKESNRQ----RVGLELIASENFA----SRAVLEALGSCLNNKY
2cinA           -----RVHEVLGRSMLVDGLDIVLDLTRSGGSYLVITGRRYLDMFTFVALGMN-PPALVDDREFHAELMQ
2e7uA           ------------VRAFKAVGGTPPFLVRGEGAYVWADGNRYLDYVMSWGPLILGHPKVLARVRETLERGL
2dr1B           -----------------------------------------YEMVKPKYKLFTAGPVACFPEVLEIMKVQ
1b8gB           ----------MLSRNATFNSSSYFWQEYEKNPYHVHNTNGIIQMGLESWLAKNPEAAAFKKNGESIFAEL
1e5eB           ---------------------------------CIHANPQKDQFGAAIPPIYQTSTFVFDNCQQGGNRFA
2dgmA           ---SELLDSRFGAKSISTIAESKRLHEMRDDVAFQINDELYLDGNARQNLATFCDENVHKLMDLSINKNW
1e5eA           ---------------------------------CIHANPQKDQFGAAIPPIYQTSTFVFDNCQQGGNRFA
3bn1D           ------------------------------------------------------APRLDGNERDYVLECM
2ch1A           -----------------------------------PASLRNPLIIPEKIMMGPGPSNCSKRVLTAMTNTV
1bw0A           -----------------------------------------LSVGDPTLDKNLLSAAQIKKLKEAIDSQE
3dr4A           ------------------------------------------------------APRLDGNERDYVLECM
2eh6A           --------------------RLPVKFVRGKGVYLYEEGKEYLDFVSGIGVNSLGHAYPKLT--EALKEQV
1aiaA           -----------------------------------DERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLL
3aatA           -----------------------------------DERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLL
1arhA           -----------------------------------DERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLL
1aamA           -----------------------------------DERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLL
1d7uA           LNDDATFWRNAR-QHLVRYGGTFMIIERAKGSFVYADGRAILDFTSGQLFSGMLSRPVVDLATRLANITP
1dtyA           -DDLAFDERHI-WHPYTSMTSPLYPVVSAEGCELISDGRRLVDGMSSWWAAIHGYPQLNAAMKSQIDAMS
1c7nA           -------------------DFTTKISRKNLGSLKWLMYSQNPEVGNEADMEFKNPPELIEGLKKYLDETV
3ei6B           ------------------------ARRRSAHLL-KYPDAQVISLGIGDT-TEPIPEVITSAMAKKAHELS
3cbfA           -------------EAFGKGAGRIQASTIRELLKL-TQRPGILSFAGGLPPELFPKEEAAEAAARILREKG
3dxvA           -ALYDRDGAAIGNLQKLR--FFPLAISGGRGARLIENGRELIDLSGAWGAASLGHPAIVAAVSAAAAN--
3ei9A           ------------------------EIARRRSAHLLYPDAQVISLGIGDT-TEPIPEVITSAMAKKAHELS
3dr4C           ----------------------------------------------------------------------
3bcbA           -----------------------------------LFLHELAVMDSNNFLGNCGVGEREGRVIGRSGDIS
3e77B           ----------------------------------------------NLYFQSMLLLEIQKELLDYKGVGI
3ecdA           ------------------------------------------NANPFFSQSLAEDASVRGAILRAVLDAQ
1cl1A           --------------------------------------YTLGAVNSVIQRASSLVFDSVEAKKHATRNRA
3b46B           ------------------------------------QGRELINLGQGFF-SYSPPQFAIKEAQKALDIPM
2egyD           -------------EAFGKGAGRIQASTIRELLKL-TQRPGILSFAGGLPPELFPKEEAAEAAARILREKG
1ajsA           ------------------SVFAEVVLVFKLIADFRDPDPRKVNLGVRTDDCQPWVLPVVRKVEQRIANNS
3eiaB           --YKTKVSRNSNMSKLQAGYLFPEIARRRSAHLLKYPDAQVISLGIGDTTE-PIPEVITSAMAKKAHELS
2dgmC           -----RFGAKSISTIAESKRFPLHEMRDDVAFQIIN-DELYLDGNARQNLATFCDENVHKLMDLSINKNW
3ei6A           ------------------------EIARRRSAHLLYPDAQVISLGIGDT-TEPIPEVITSAMAKKAHELS
1arsA           ------------------------DPILGLADLFRDERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLL
2dr1A           ---------------------------------FEEAFKEVYEMVKPKYKLFTAGPACFPEVLEIMKVQM
3dxvB           -------------RELIDLSGAWGAASLGYGHIVAAVSAAAANPAGATILSASNAPAVTLAERLLASFPG
1bqaA           -----------------------------------DERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLL
3bc8A           ----------EQGKCPEDGWDESTLELFLHELAV-MDSNNFLGNCGVGEREGRVASALVARRHYRFIHGI
1aheA           -----------------------------------DERPGKINLGIGLYYDETGKIPVLTSVKKAEQYLL
3ei9B           ------------------------EIARRRSAHLLYPDAQVISLGIGDTTE-PIPEVITSAMAKKAHELS
1ay4A           -------------------------------------RQGKIDLGVGVYKDATGHTPIMRAVHAAEQRML
3cq5A           -----------------SDLPLREELRGEHAYGA-PQLNVDIRLNTNEN-PYPPSEALVADLVATVDKIA
1ax4A           ------------AKRIVEPFRIKMVREEREAALK-EAGYNPFLLPSSAVYIDLLTDSGTNAMSDHQWA--
2egyC           -------------EAFGKGAGRIQASTIRELLKL-TQRPGILSFAGGLPPELFPKEEAAEAAARILREKG
2ctzA           -------------------------------------EPTTLSRQVPIYPTTSYVFKSPEHAANLFALKE
3bn1A           ----------------------------------------------------------------------
1c0nA           -----------------------DAVRADFPVLSEVNGLPLAYLDSA-ASAQK-PSQVIDAEAEFYRHGY
1cs1A           ----------------------------------------------------------------------
1czcA           --------------------TAPADPILGLADLLRAERPGKIDLGMGVYNDETGKTPVLTSVKKAEQYLL
3ecdB           ---------------------------------VRGAILKELERQQSQVELIASENIVSRAVLDAQGSVL
2c44C           LPEPFRIRVIEPVKRTTRAYREEAIIKSGMNPFLLDSEDVFIDLLTDSGTGAV-TQSMQAAMMRGDEAYS
3e2fA           --------NAKRIEGLDSNVWVEFTK--------LAADPSVVNLGQGFP-DISPPSYVKEELSKAAFIDN
3bv0B           --------EQIIAVDGAHLWHPSPVVVAAHGAWLTGQPIEVLDAMSSWWTAIHGHGHPALDQ--ALTTQL
1akaA           -------------------------VTEAFKRDT-NSKKMNLGVGAYDDNGKPYLNCVRKAEAMIAAKKM
3b8xA           ------------------------------------------------------SSTWDDLEYKAIQSVL
2d5yA           -----------------------------------DERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLL
1b9iA           ------------------------------------------------------WPQYDDAERNGLVRAL
1b4xA           ------------------------DPILGLADLFRDERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLL
1asbA           -----------------------------------DERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLL
3e9kA           -----------HFREFYIPKIQDLPPVDLSLVNKD-ENAIYFLGNSLGLQPKMVKTYLEEELDKWA--KI
3dr4B           ------------------------------------------------------APRLDGNERDYVLECM
3bwnD           ------------------------------------MSDFVVNLDHGDPTAYEEYWRKMGDRCTVTIRGC
3b46A           ------------------------TNEAAAKAANN-QGRELINLGQGFF-SYSPPQFAIKEAQKALDIPM
3bcaA           ---RRAHEHLIRLLLEQGKCPED-GWDESTLELFLHELAVMDSNNFLGNCGVGEEGRVASALVARRHYHG
2bkwA           ----------------------------------------------SVDTLLIPGPILSGAVQKALDVPS
2a0yA           ----------------------------------------------------------------------
3d6kB           -----------------------------------KAKNLSLDLTRGKPQLDL-SNDLLSLPGGDFRTKD
2d66A           -----------------------------------DERPGKIDLGMGVYNDETGKTPVLTSVKKAEQYLL
1bjoA           ----------------------------------------------NFSSGPAMPAEVLKQAQQELRDWN
3bv0A           --------EQIIAVDGAHLWHPPVVAVAAHGAWLTLQPIEVLDAMSSWWTAIHGHPALDQALTTQLRVMN
1bw0B           -----------------------------------------LSVGDPTLDKNLLSAAQIKKLKEAIDSQE
3b8xB           ------------------------------------------------------SSTWDDLEYKAIQSVL
2cy8A           ------------------------FISDAQGVHKTDDGNVYLDFFGGHVLGHG-HPRVNAAIAEALSHGV
2egyB           -------------EAFGKGAGRIQASTIRELLKL-TQRPGILSFAGGLPPELFPKEEAAEAAARILREKG
3dr4D           ------------------------------------------------------APRLDGNERDYVLECM
3ecdC           ----------------------------------LAERDASVRGAILKELERQQSQVSENIVSRAVLDAQ
3d6kC           -----------------------------------KAKNLSLDLTRGKPQLDL-SNDLLSLPGGDFRTKD
1b8gA           --------------------NTNGIIQMGLAENQLCF------DLLESWLAKNPEAAAFKKNGESIFAEL
1agxA           ----------------------------------------------------------------------
2a7vA           ------------------------------------------------------DPEMWELLQREKDRQC
3bigA           ----------------------------------------------------------------------
1b9hA           ------------------------------------------------------WPQYDDAERNGLVRAL
1bqdA           -----------------------------------DERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLL
2cb1A           ----------------------------------------------------------------------
3d19E           ----------------------------------------------------------------------
3dc1A           -----------------------RFITAASAARNPPGPKSMISLAGGITVENGKTIQFGEEMMKRALQYS
2d64A           -----------------------------------DERPGKIDLGMGVYNDETGKTPVLTSVKKAEQYLL
3cogB           ----------------------------------------------PEQWTSRAVVPPISLSTTFKQGAP
2d61A           -----------------------------------DERPGKIDLGMGVYNDETGKTPVLTSVKKAEQYLL
3d6kA           -----------------------------------KAKNLSLDLTRGKPQLDL-SNDLLSLPGGDFRTKD
1awiA           ----------------------------------------------------------------------
3d6kD           -----------------------------------KAKNLSLDLTRGKPQLDL-SNDLLSLPGGDFRTKD
3caiA           -----------------------YDVARVRGLHP-SLGDGWVHFDAPAGMLI--PDSVATTVSTAFRRSG
3du4A           ------------------------IIESGTGIKVKINGKEYYDGFSSVWLNVHGHRK--KELDDAIKKQL
3bwnB           ----------------------------------IPMSDFVVNLDHGDPAYEEYWRKMGDRCTVTIRGCD
1ajrA           ------------------------VLVFKLIADFRDPDPRKVNLGVGAYRTDDCQPWVLPVVRKVEQRIA
7aatA           -------------------------VTEAFKRDT-NSKKMNLGVGA--YRDDNGKPYVLNCVRKAEAMIA
3ecdD           -------------------------------------RDASVRGAILKELERQQSQVELIASENIVSRAV
2c44A           LPEPFRIRVIEPVKRTTRAYREEAIIKSGMNPFLLDSEDVFIDLLTDSGTGAV-TQSMQAAMMRGDEAYS
3d19A           ----------------------------------------------------------------------
3e6gD           ----------------------------------------------------------------------
1eghA           ----------------------------------------------------------------------
3e6gB           ----------------------------------------------------------------------
3eh2A           ----------------------------------------------------------------------
3dc1B           MNYARFITAASAARNPSPIRGPKSMISLAGGLPNPNMFFKTAVITVENGKTIQFGEEMMKRALQYSPSAG
2btwB           ----------------------------------------------------------------------
2c44B           LPEPFRIRVIEPVKRTTRAYREEAIIKSGMNPFLLDSEDVFIDLLTDSGTG-AVTQSMQAAMMRGDEAYS
3dc1D           ------------------------SAARNPSPIR-RGPKSMISLAGGLPPNMFPFKTAVITALQYSPSAG
3bwnA           ----------------------------------IPMSDFVVNLDHGDPAYEEYWRKMGDRCTVTIRGCD
3bwoA           ---------------------------------NIPMSDFVVNLDHGDP-TAYEEYWRKMGDRCTVTIRG
2btwA           ----------------------------------------------------------------------
1btcA           ----------------------------------------------------------------------
3cogD           --------------------------------------------QDPEQWTSRAVVPPISLSTTFKQGAP
1c8nA           ----------------------------------------------------------------------
1b93B           ----------------------------------------------------------------------
1bybA           ------------------------------------------------------PVYVMLPLGVLKEQLL
3bh1C           ----------------------------------------------------------------------
3drdB           ------------------------IIESGTGIKVKINGKEYYDGFSSVWLNVHGHRK--KELDDAIKKQL
3dodB           ------------------------IIESGTGIKVKINGKEYYDGFSSVWLNVHGHRK--KELDDAIKKQL
3dodA           ------------------------IIESGTGIKVKINGKEYYDGFSSVWHGHR-KKELDDAIKKQLGKI-
3bwnF           -----------------------------------------VNLDHGDPAYEEYWRKMGDRCTVTIRGCD
2bhgA           ----------------------------------------------------------------------
3e6gA           ----------------------------------------------------------------------
2b34A           ----------------------------------------------------------------------
2dbnA           ----------------------------------------------------------------------
3bh1A           ----------------------------------------------------------------------
3c01F           ----------------------------------------------------------------------
3c01E           ----------------------------------------------------------------------
3bmaD           ----------------------------------------------------------------------
2bu3A           ----------------------------------------------------------------------
3bh1D           ----------------------------------------------------------------------
3bwoC           ----------------------------------IPMSDFVVNLDHGDPAYEEYWRKMGDRCTVTIRGCD
1dy2A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXXXXXVAHQALEEELAQWLGYPRALLFISGFAANQAVITALMKKNDRIVADRLSHASLLEAA
3a2bA           TGCAGSRFLNGTLDIHVELEEKLSAYVGKEAAILFSTGFQSNLGPLSCLMGRNDYILLDERDHASIIDGS
1bs0A           IGSGGSGHVSGYSVVHQALEEELAEWLGYSRALLFISGFAANQAVIAAMMAKEDRIAADRLSHASLLEAA
1djeA           IGSGGSGHVSGYSVVHQALEEELAEWLGYSRALLFISGFAANQAVIAAMMAKEDRIAADRLSHASLLEAA
2bwpB           AGSGGTRNISGTTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVPGLIIYSDSLNHASMIEGI
2bwoD           AGSGGTRNISGTTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVLFPGLIIYSDSLNHASMIE
2bwnD           AGSGGTRNISGTTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVLFPGLIIYSDSLNHASMIE
2bwpA           AGSGGTRNISGTTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVLFPGLIIYSDSLNHIEGIK
2cdmA           ATRQDSKERIGLDLTFSAPKSVSLQALVAGDAEIIKAHDRAVARTLEQ-AEARAQARQKIQGKTRI---E
2bwoB           AGSGGTRNISGTTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVLFPGLIIYSDHASMIEGIK
2bwnB           AGSGGTRNISGTTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVLFPGLIIYSDSLNHASMIE
2bwnA           AGSGGTRNISGTTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVLFPGLIIYSDSLNHASMIE
2bwoA           AGSGGTRNISGTTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVLFPGLIIYSDSLNHASMIE
2bwnE           AGSGGTRNISGTTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVLFPGIYSDSLNHASMIEGI
1d2fB           FGYSRWKNDEFLAAIAHWFSTQHYTAIDSQTVVYGPSVIYMVSELIRQWSETGEGVVIHTPAYDAFYKAI
1d2fA           FGYSRWKNDEFLAAIAHWFSTQHYTAIDSQTVVYGPSVIYMVSELIRQWSETGEGVVIHTPAYDAFYKAI
1dfoB           PGKRYYGGCEYVDIVEQLAIDRAKELFGADYANVQPHSGSANFAVYTALLEPGDTVLGMNLAHGGHLTHG
1djuA           THYGPNIGLLELREAIAEKLKKQNGIEADPKTEIMVGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAV
1ecxA           GNPNSAHGMGIEANLMEKAREKVAKVLGVSPSEIFFTSNWILKTVAETFEKRKRTIITTPIEHKAVLETM
1b5pA           TKYAPPAGIPELREAAEKFRRENGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMV
2c7tA           QSNRWAISGYWTGEMERKFAKAFADFNGVPYCVPTTSGSALMLALEALGIGEGDEVIVPSLTWIATATAV
2douB           GYCLKSCTLPFLEEAARWYEGRYGVGLDPRREALALIGSEGLAHLLLALTEPEDLLLLPEVAYPSYFGAA
1bjwA           KYAPPAGIPELREALAEKFRRENGLSVTPEETIVTVGGKQALFNLFQAILDPGDEVIVLSPYWVSYPEMV
2bhxB           DTQMSVMELSHRSQSYEEVHEQAQNLLDYQILFLQGGASLQFTMLPMNLLTKGTIGNYVLTGSWSEKALK
1eg5B           NPNSAHGGIEAN--LHEKAREKVAKVLGVSPSEIFFCATESINWILKTVAETFEKIITTPIEHKAVLETK
2bieB           DTQMSVMELSHRSQSYEEVHEQAQNLLRYQILFLQGGASLQFTMLPMNLLTKGTIGNYVLTGSWSEKALK
1ecxB           NPNSAHGMGIEANLHMEKAREKVAKVLGVSPSEIFFTSNWILKTVAETFEKRKRTIITTPIEHKAVLETM
1eg5A           NPNSAHGGIEAN--LHEKAREKVAKVLGVSPSEIFFCATESINWILKTVAETFEKIITTPIEHKAVLETK
1dfoA           AEGYPGKRYYGGCEYVDIVEQLAIDRAADYANVQPHSGSQANFAVYTALLEPGDTVLGMNLAHGGHLTHG
3e77A           SVLEMSHRSSDFAKIINNTENLVRELLAVPVIFLQGGGCGQFSAVPLIGLKAGRCADYVVTGAWSAKAAE
2dgmB           IDKEEYPQSAAI---DLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMPTDKPNLVCGPVQICWHKFA
2byjA           LTSRAFYNN-----VLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKKAKIVFAAGNFWGRTLSAI
1djuB           THYGPNIGLLELREAIAEKLKKQNGIEADPKTEIMVLLNQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAV
2cfbA           ALEKGTSFGAPCLLENILAEMVIAAVPSVEMVRFVNSGTEACMAVLRLMRAYTQREKVIKFEGCYHGHAA
2douA           GYCLKSCTLPFLEEAARWYEGRYGVGLDPRREALALIGSEGLAHLLLALTEPEDLLLLPEVAYPSYFGAA
2c81A           WAISGYWTGEES--MERKFAKAFADFNGVPYCVPTTSGSALMLALEALGIGEGDEVIVPSLTWIATATAV
2dkjA           PGARYYGGCEVIDRVESLAIERAKALFGAAWANVQPHSGQANMAVYMALMEPGDTLMGMDLAAGGHLTHG
3bb8A           LDGWLTTGR-----FNDAFEKKLGEYLGVPYVLTTTSGSSANLKLGVRALKPGDEVITVAAGFPTTVNPT
1ay4B           ETETTKTYAGLS--GEPEFQKAMGELILGDGLKSETTGALRQALELARMANPDLRVFVSDPTWPNHVSIM
3dzzB           YESVPAEYYK----AVADWEEIEHRARPKEDWCVFASGVVPAISAVRQFTSPGDQILVQEPVYNFYSVIE
1bkgA           TKYAPPAGIPELREAAEKFRRENGLSVTPEETIVTVGGKQALFNLFQAILDPGDEVIVLSPYWVSYPEMV
5bj4A           TKYAPPAGIPELREAAEKFRRENGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMV
3dydA           YNGYAPSIGFLSSREIASYYHCPEAPLEAKDVILTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLA
3dzzA           YESVPAEYYK----AVADWEEIEHRARPKEDWCVFASGVVPAISAVRQFTSPGDQILVQEPVYNFYSVIE
3dydB           YNGYAPSIGFLSSEEIASYYHCPEAPLEAKDVILTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLA
3cq6A           TELNRYPERD-----AVELRDELAAYITKQTGWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILA
1bjnA           GLGTSVMEVSHRGKEFIQVAEEAEKDFNYKVLFCHGGGRGQFAAVPLNILGDKTTADYVDAGYWAASAIK
3e77C           SVLEMSHRSSDFAKIINNTENLVRELLAVPVIFLQGGGCGQFSAVPLIGLKAGRCADYVVTGAWSAKAAE
1b5oA           TKYAPPAGIPELREAAEKFRRENGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMV
1ay5B           ETETTKTYAGLS--GEPEFQKAMGELILGDGLKSETTGALRQALELARMANPDLRVFVSDPTWPNHVSIM
3cq4B           TELDAVELRDE---LAAYITKQTGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILA
2dgmE           NKNWIDKEEYPQSAADLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMPTDKPNLVCGPVQICWHKFA
3cq4A           TELRDAVELRDE--LAAYITKQTGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILA
1ejiA           YYGGTEFIDELELCQKRALQAYHLDPQCWGVNVQPYSGSPANFAVYTALVEPHGRIGLDLPDGGHLTHGF
3bcxA           LDGWLTTGR-----FNDAFEKKLGEYLGVPYVLTTTSGSSANLKLGVRALKPGDEVITVAAGFPTTVNPT
3bn1C           DTTWISSVGR----FIVEFEKAFADYCGVKHAIACNNGTTALHLALVAMGIGPDEVIVPSLTYIASANSV
2cstA           SLNHEYLPILGLPEFRANASRIALGDDSPAIAQKRVGSVQFLRRWYNGNNNTATPVYVSSPTWENHNSVF
5bj3A           TKYAPPAGIPELREAAEKFRRENGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMV
2c0rA           HTGMSIMEMSHRGAVYEAVHNEAQARLLALLGFIQGGASTQFAMIPMNFLKEGQTANYVMTGSWASKALK
2aevA           GSSYF---------AEKVNEYGLKHLGGDENDKCVGFNRTSSAILATILALKPKKVIHPELPGHPSIERS
3cq5B           TELNRYPERDAVEL-RDELAAYITKQTGVANLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILA
2e7jA           P-------------IHDFIHNQLPKFLGCDVARVTNGAREAKFAVMHSLAKKDAWVVMDENCHYSSYVAA
2aeuA           GSSYF---------AEKVNEYGLKHLGGDENDKCVGFNRSSAILATILALKPKKVIHYLPELPGHPSIER
1asfA           ENETTKNYLGIDGITQELLFGKGSALINDKRARTAQGGTGALRVAADAKNTSVKRVWVSNPSWPNHKSVF
3eiaA           TIEGYSGYGAEQGAKPAAIAKTFYGGLGIGDDDVFVDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSS
3bs8A           VAEYGTSFGAPTEVENELAKLVIDRVPSVEIVRMVSSGTEATMSALRLARGYTGRNKIATLGLPDSPGVP
1ariA           ENETTKNYLGID--GIPEFGRCTQELLFGKGSALIGTGALRVAADFLAKNTSVKRVWVSNPSHPNHKSVF
1cl1B           NGELFYGRRGT--LTHFSLQQAMCELEGGAGCVLFPCGAAAVANSILAFIEQGDHVLMTNTAYEPSQDFC
3ei7B           TIEGYSGYGAEQGAKRAAIAKTFYGGLGGDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSS
3e2yA           MNQYTRGFGHPA--LVKALSCLYGKIYQRQEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMV
2bylA           LTSRAFYNN-----VLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKKAKIVFAAGNFWGRTLSAI
1c7gA           MIGDEAYAGSE---NFYHLEKTVKELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRFHQE
1c4kA           DVALGDLLIHEG--PAVAAEKHAARVYNADKTYFVLGGSSANNTVTSALVSNGDLVLFDRNNHKSVYNSA
2bieA           DTQMSVMELSHRSQSYEEVHEQAQNLLDYQILFLQGGASLQFTMLPMNLLTKGTIGNYVLTGSWSEKALK
3bcxB           LDGWLTTGR-----FNDAFEKKLGEYLGVPYVLTTTSGSSANLKLGVRALKPGDEVITVAAGFPTTVNPT
3ei7A           TIEGYSGYGAEQGAKRAAIAKTFYGGLGGDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSS
3ei8A           TIEGYSGYGAEQGAKRAAIAKTFYGGLGIGDDDVFVSDGAKCDSRLQVMFGSNVTIAVQDPSYPAYVDSS
2dgkC           IDKEEYPQSAA---IDLRCVNMVADLWHAPAPKNGQAVGTNTIRMEAAGKPTDKPNLVCGPVQICWHKFA
1bj4A           PGQRYYGGTEFIDELETLCQKRALQAYKLDVNVQPYSGSPANFAVYTALVEPHGRIMGLDLPDGGHLTHG
1cj0A           YGGTEHIDELETLCQKRALQAYGLDPQCWGVNVQPYSGSPANFAVYTALVEPHGRIMGLDLTHGFMTDKK
1dgdA           PGLDRALLLSTGAESNEAAIRMAKLVTGKYEIVGFAQSWHGMTGAAASATYSRKGVGPAAVGSFAIPAPF
2dgkA           IDKEEYPQSAA---IDLRCVNMVADLWHAPAPKNGQAVGTNTKRMEAAGKPTDKPNLVCGPVQICWHKFA
2ch2A           LSNFHAELFR----TMDEVKDGLRYIFQTETMCVSGSAHAGMEAMLSNLLEEGDRVLIAVNGIWAERAVE
2aatA           ENETTKNYLGIDGIPQELLFGKGSALINDKRARTAQTPGGTGAADFLAKNTSVKRVWVSNPSWPNHKSVF
3dr7B           DTTWISSVGR----FIVEFEKAFADYCGVKHAIACNNTTALHLALVAMGIGPGDEVIVPSLTYIASANSV
2e54A           AEKLIHCSNLFWNRPQMELAELLSKNTFGGKVFFANTGTEANEAAIKIARKKKYRILSAHNSHGRTLGSL
3drdA           GKIAHSTLLGMTNVPATQLAETLIDISPKKLTRVFYSDSGAMEIALKMAFQYWKNIGKPEKQKFIAMKSY
1cj0B           SEGYPGQRYYGGTEHIDELETLCQKRACWGVNVQPYSGSPANFAVYTALVEPHGRIMGLDLPDGGHLTHG
2cinA           AALNKPSNSDVYSVAMARFVETFARVLGDPHLFFVEGGALAVENALIDPALGTQVLHLRGAFHGRSGYTL
2e7uA           TFGAPSP-------LEVALAKKVKRAYPFVDLVRFVNSGTEALRLARGYTGRPYIVKFRGNYHGHADGLL
2dr1B           MFSHRSKEYRKVHMDTVERLREFLEVEKGEVLLVPSSGTGIMEASIRNGVSKGGKVLVTIIGAFGKRYKE
1b8gB           ALFQDYHGLPAFKKAMVDMAEIRGNKVTFDHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDL
1e5eB           GQESGYIYTRLGNPTVSNLEGKIAFLEKTEACVATSSGMGAIAATVLTILKAGDHLISDECLYGCTHALF
2dgmA           IDKEEYPQSAA---IDLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGDKPNLVCGPVQICWHKFA
1e5eA           GQESGYIYTRLGNPTVSNLEGKIAFLEKTEACVATSSGMGAIAATVLTILKAGDHLISDECLYGCTHALF
3bn1D           DTTWISSVGR----FIVEFEKAFADYCGVKHAIACNNGTTAHLALVAMGIGPGDEVIVPSLTYIASANSV
2ch1A           LSNFHAELFR----TMDEVKDGLRYIFQTETMCVSGSAHAGMEAMLSNLLEEGDRVLIAVNGIWAERAVE
1bw0A           CNGYFPTVGSPEARESFVHKEELKSTIVKDNVVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVC
3dr4A           DTTWISSVGR----FIVEFEKAFADYCGVKHAIACNNGTTAHLALVAMGIGPGDEVIVPSLTYIASANSV
2eh6A           EKLLHVSNLYENPWQEELAHKLVKHFWTEGKVFFANSGTESVEAAIKLARKNKWKFISFENSHGRTYGSL
1aiaA           ENETTKNYLGIDGIPGRCTQELLFGKGSKRARTAQTPGGTGALRVAADFNTSVKRVWVSNPSWPNHKSVF
3aatA           ENETTKNYLGID--GIPEFGRCTQELLDKRARTAQTPGGTGALRVAADFNTSVKRVWVSNPSWPNHKSVF
1arhA           ENETTKNYLGID--GIPEFGRCTQELLFKRARTAQTPGGTGALRVAADFLAKVKRVWVSNPSWPNHKSVF
1aamA           ENETTKNYLGIDGIPGRCTQELLFGKGSALRTAQTPGGTGALRVAADAKNTSVKRVWVSNPSWPNHKSVF
1d7uA           PGLDRALLLSTGAESNEAAIRMAKLVTGKYEIVGFAQSWHGMTGAAASATYSRKGVGPAAVGSFAIPAPF
1dtyA           HVMFGEITHAPAIELCRKLVAMTAKGEARDRFLTFRNGYHGDTFGAMSVCDPDNSMHSLWKGYLPENLFA
1c7nA           LGYTGPTEEYKKTVK-KWMKDRHQWDIQTDWIINTAGVVPAVFNAVREFTKPGDGVIIITPVYYPFFMAI
3ei6B           TIEGYSGYGAEQGAKRAAIAKTFYGGLGGDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSS
3cbfA           EVALQYSPTE----GYAPLRAFVAEWIGVRPEEVLIGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAF
3dxvA           -PAGATILSASNAPAVTLAERLLASFPGEGTHKIWFSGSDANEAAYRAITGRSGVIAFAGAYHGCTVGSM
3ei9A           TIEGYSGYGAEQGAKRAAIAKTFYGGLGIGDDDVFVSDAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSS
3dr4C           --------------FIVEFEKAFADYCGVKHAIACNNGTTALHALVAMGIGPGDEVIVPSLTYIASANSV
3bcbA           AVQPKAAGSSLLNKITNSLVLNVIKLAGVHSCFVVPMATGMSLTLCFLTRPKAKYIIWPRIDQKSCFKSM
3e77B           SVLEMSHRSSDFAKIINNTENLVRELLAVPVIFLQGGGCGQFSAVPLNLIGAGRCADYVVTGAWSAKAAE
3ecdA           GSVLTNKYAEGADEVEALAIERVKRLFNAGHANVQPHSGQANGAVMLALAKPGDTVLGMSLFNALQYGVS
1cl1A           NGELFYGRRGTL--THFSLQQAMCELEGGAGCVLFPCGAAAVANSILAFIEQGDHVLMTNTAYEPSQDFC
3b46B           VNQYSPTRGRPSLINIKLYSPIYNTELKAENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNI
2egyD           EVALQYSPTE----GYAPLRAFVAEWIGVRPEEVLIGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAF
1ajsA           SLNHEYLPILGLAEFRTCASRLALGDDSPAGTGALRIGAEFLARWYNGTNNKDTPVYVSSPTWENHNGVF
3eiaB           TIEGYSGYGAEQGAKRAAIAKTFYGGLGIGDDDVFVSGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSS
2dgmC           IDKEEYPQSAAI---DLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMPTDKPNLVCGPVQICWHKFA
3ei6A           TIEGYSGYGAEQGAKRAAIAKTFYGGLGIGDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSS
1arsA           ENETTKNYLGIDGIPGRCTQELLFGKGSKRARTAQTPGGTGALRVAADFLAKVKRVWVSNPSWPNHKSVF
2dr1A           FSHRSKEYRKVHMDTVERLRE-FLEVEKGEVLLVPSSGTGIMEASIRNGVSKGGKVLVTIIGAFGKRYKE
3dxvB           EGTHKIWFGHSGSDANEAAYRAIVKATGRSGVIAFAGAYHGCTVGSMAFSGHSVQADAAKADGLILLPYP
1bqaA           ENETTKNYLGIDGIPEELLFGKGSALINDKRARTAQTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVF
3bc8A           GRQPKAAGSSLLNKITNSLVLNVIKLAGVHSVASCFVVPMATGMSLTLCFPKAKYIIWPRIDQKSCFKSM
1aheA           ENETTKLYLGIDGITQELLFGKGSALINDKRARTAQTPGGRVAADFLAKNTSVKRVWVSNPSWPNHKSVF
3ei9B           TIEGYSGYGAEQGAKRAAIAKTFYGGLGIGDDDVFVSDGAKCDSRLQVMFGSNVTIAVQDPSYPAYVDSS
1ay4A           ETETTKTYAGLS--GEPEFQKAMGELILGDGLKSETTGALRQALELARMANPDLRVFVSDPTWPNHVSIM
3cq5A           TELNRYPERD-----AVELRDELAAYITKDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILA
1ax4A           -AMITGDEAYAGSRNYYDLKDKAKELFNYDYIIPAHQGRGAENILFQKEGKAKNPVFISNFHFDTTAAHV
2egyC           EVALQYSPTE----GYAPLRAFVAEWIGVRPEEVLITSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAF
2ctzA           FGNIYSRIMNPT---VDVLEKRLAALEGGKAALATASGHAAQFLALTTLAQAGDNIVSTPNLYGGTFNQF
3bn1A           --------------FIVEFEKAFADYCGVKHAIACNNGTTALHLALVAMGGPGDEVIVPSLTYIASANSV
1c0nA           AAVHAGAHTLSAQAKMENVRKRASLFINARSAEELVGINLVANSWGNSNVRAGDNIIISQMEHHANIVPW
1cs1A           -------------PTRDVVQRALAELEGGAGAVLTNTGMSAIHLVTTVFLKPGDLLVAPHDCYGGSYRLF
1czcA           ENETTKNYLGIDGIPE--FGRCTQELLFGKGSALI--NDKRARTAQTAKNTSVRRVWVSNPSWPNHKSVF
3ecdB           TNKYAEGYADEVEAL--AIERVKRLFNAGHANVQPHSGAQANGAVMLALAKPGDTVLGMSLFNALQYGVS
2c44C           GSR-----------SYYALAESVKNIFGYQYTIPTHQGRGAEQIEQEKGLDRSKMVAFSNYFFDTTQGHS
3e2fA           MNQYTRGFGHPA--LVKALSCLYGKIYQRQEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMV
3bv0B           RVMNHVMFGGLTHEPAARLAKLLVDITPAGLDTVFFSDSGSVSGGYHGDTFLAMSICDPHGGMHSLWTDV
1akaA           DKEYLPIAGLAD--FTRASAELALGENSEAFKSGRYVTVRVGANFLQRFFKFSRDVYLPKPSWGNHTPIF
3b8xA           DSKMFTMGE-----YVKQYETQFAKTFGSKYAVMVSSGSTANLLMIAALFFTKKPRIVPAVSWSTTYYPL
2d5yA           ENETTKNYLGIDGIPQELLFGKGSALINDKRARTAQTPGGRVAADFLAKNTSVKRVWVSNPSWPNHKSVF
1b9iA           EQGQWWRMGGD---EVNSFEREFAAHHGAAHALAVTNGTHALELALVMGVGPGTEVIVPAFTFISSSQAA
1b4xA           ENETTKNYLGIDGITQELLFGKGSALINDKRARTAQTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVF
1asbA           ENETTKNYLGIDGIPQELLFGKGSALINDKRARTAQTPGGRVAADFLAKNTSVKRVWVSNPSWPNHKSVF
3e9kA           AAYGHEVGKRPWITGDESIVGLMKDIVGANEKEIALMNALTVMLSFFKPTPKRYKILLEAKAFPSDHYAI
3dr4B           DTTWISSVGR----FIVEFEKAFADYCGVKHAIACNNGTTALHLALVAMGIGPDEVIVPSLTYIASANSV
3bwnD           DLMSYFSDMTNLCWFEPELEDAIKDLHGVVGNAATQLCQAAVHALSSLARSQPVSVVAAAPFYSTYVEET
3b46A           VNQYSPTRGRPSLINIKLYSPIYNTELKAENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNI
3bcaA           IGQPKAAGSSLLNKITNSLVLNVIKLAGVHSVASCFVVPMATGMSLTLCFPKAKYIIWPRIDQKSCFKSM
2bkwA           LGHTSPEFVSIFQRVLKNTRAVFKSAAASKSQPFVLSGTLGWDIFASNFKAPNKNVLVVSTGTFSDRFAD
2a0yA           --------------WKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFVGDIMLIRDHINLPGFSGQNPLRGP
3d6kB           GVDCRNYGGLL---GIADIRELWAEALGLPDLISWSYTWGNNDSSRPWSAEEKVKWLCPVPGYDRHFTIT
2d66A           ENETTKNYLGIDGTQELLFGKGSALINDKRARTAQTPGGTGALRVAAAKNTSVKRVWVSNPGWPTHKSVF
1bjoA           GLGTSVMEVSHRGKEFIQVAEEAEKDFNYKVLFCHGGGRGQFAAVPLNILGDKTTADYVDAGYWAASAIK
3bv0A           HVMFGGLTHE----PAARLAKLLVDITPAGLDTVFFSDSGSVS-VEVAAKGKRRLMTWRGGYHGDTFLAM
1bw0B           CNGYFPTVGSPE--AREAVATWWRNSFVHKNVVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVC
3b8xB           DSKMFTMGE-----YVKQYETQFAKTFGSKYAVMVSSGSTANLLMIAALLKKGDEIIVPAVSWSTTYYPL
2cy8A           QYAASHPL------EVRWAERIVAAFPSIRKLRFTGSGTETTLLALRVARAFTGRRMIL---------RF
2egyB           EVALQYSPTE----GYAPLRAFVAEWIGPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAF
3dr4D           DTTWISSVGR----FIVEFEKAFADYCGVKHAIACNNTTALHLALVAMGIGPGDEVIVPSLTYIASANSV
3ecdC           GSVLTNKYAEGYDEVEALAIERVKRLFNAGHANVQPHGAQANGAVMLALAKPGDTVLGMSLFNALQYGVS
3d6kC           GVDCRNYGGLL---GIADIRELWAEALGLPDLISWSYTWGNNDSSRPWSAEEKVKWLCPVPGYDRHFTIT
1b8gA           ALFQDYHGLPAFKKAMVDFMAEIRGNKDPNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDL
1agxA           --------------SIFAARDVTKGINIHTHAFVSQWGALGTLVEGKPYWFRSSVKKHTNNSEFNIEKIQ
2a7vA           RGLELIAS-------ENFCSRAALEALGSCLNNKYEIELLCQRRALEAFDLDPAQWGVNVQPYSGSPANL
3bigA           -------------MYMEKLIVGPGAKGTIDLNLPLADNLRNVAAALGKPLSELTVTILAKPRHDAVIAEM
1b9hA           EQGQWWRMGGD---EVNSFEREFAAHHGAAHALAVTNGTHALELALVMGVGPGTEVIVPAFTFISSSQAA
1bqdA           ENETTKNYLGID--GIPEFGRCTQELLFGKGSALQTPGGTGALRVAADFLASVKRVWVSNASWPNHKSVF
2cb1A           ---------------AKALEERLKALEGALEAVVLASGQAATFAALLALLRPGDEVVAAKGLFGQTIGLF
3d19E           ----------------RSLNEI--------RFWSRIMKEHSFFLRLGFRCEDTQLIEEANQFYRLFEHIE
3dc1A           PSAGIPELLSWLKKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSL
2d64A           ENETTKNYLGIDGTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLASVKRVWVSNPGWPTHKSVF
3cogB           GQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAFASGLAAT-VTITHLLKAGDQIICMDDVYGGTNRYF
2d61A           ENETTKNYLGIDGITQELLFGKGSALINDKRARTAQTPGGRVAADFLAKNTSVKRVWVSNPSWPNHKSVF
3d6kA           GVDCRNYGGLLG---IADIRELWAEALGLPDLISWSYTWGNNDSSRPWSAEEKVKWLCPVPGYDRHFTIT
1awiA           ----------------------------------------------------------------------
3d6kD           GVDCRNYGGLL---GIADIRELWAEALGLPDLISWSYTWGNNDSSRPWSAEEKVKWLCPVPGYDRHFTIT
3caiA           ASTVGAHPSARRSAAVDAAREAVADLVNAPGGVVLGADRAVLLSLLSSRAGLGYEVIVSRLDEANIAPWL
3du4A           GKIAHSTLLGMTNVPATQLAETLIDISKLTRVFYSDSGAEAMEIALIGKPEKQKFIAMKNGYHGDTIGAV
3bwnB           LMSYFSDMTNLCWFLEPELEDAIKDLHGDRYIVVGTGSTQLCQAAVHALSSLARSQPVAAPFYSTYVEET
1ajrA           NNSSLNHEYLPIL-GLAEFRTCASRLALGDDSPALQEGAEFLARWYNGTNNKDTPVYVSSPTWENHNGVF
7aatA           AKKMDKEYLPIA--GLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSFSRDVYLPKPSWGNHTPIF
3ecdD           LDAQGSVLTNKYADEVEALAIERVKRLAGHANVQPHSGAQANGAVMLALAKPGDTVLGMSLFNAL-----
2c44A           GSR-----------SYYALAESVKNIFGYQYTIPTHQGRGAEQREQEKGLDRSKMVAFSNYFFDTTQGHS
3d19A           ---------------ERSLNEI--------RFWSRIMKEHSFFLRLGFRCEDTQLIEEANQFYRLFEHIE
3e6gD           ---------------RFAYERCVAALEGGTRAFAFASGMAATSTVMELLDAGSHVVAMDDLYGGTFRLFE
1eghA           ---------------------ELTTRTLPARKHIALVAHDHCKQMLMSWVERHQPLLEQHVLYATGTTGN
3e6gB           ---------------RFAYERCVAALEGGTRAFAFASGMAATSTVMELLDAGSHVVAMDDLYGGTFRLFE
3eh2A           ----------------------------------------------------------------------
3dc1B           IPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSL
2btwB           -----------------------------------NLIGFNSNEGEKLLLTSRSREDFFPLSQFVTQVNQ
2c44B           GSR-----------SYYALAESVKNIFGYQYTIPTHQGRLIKKREQEKGLDRSKMVAFSNYFFDTTQGHS
3dc1D           IPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSL
3bwnA           LMSYFSDMTNLCWFLEPELEDAIKDLHGVVGNAATQLCQAAVHALSSLARSQPVSVVAAAPFYSTYVEET
3bwoA           CDLMSYFSDMTNLCWEPELEDAIKDLHGVVGNAATQLCQAAVHALSSLARSQPVSVVAAAPFYSTYVEET
2btwA           -----------------------------------NLIGFNSNEGEKLLLTSRSREDFFPLSQFVTQVNQ
1btcA           ----------------------KQYDWRAYRSLFQLVQECGLTLQAIMSFHQCGGNVGDIVNIP------
3cogD           GQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAFASGLAAT-VTITHLLKAGDQIICMDDVYGGTNRYF
1c8nA           ----------------------------------------------------------------------
1b93B           ---------------------------LPARKHIALVAHDHCKQMLMSWVERHQPLLEQHVLYATGTTGN
1bybA           QLRAAGVDGVMVDVWWGIIELKGQYDWRAYRSLFQLVQECGLTLQAIMSFHQCGGNVGDIV-------NI
3bh1C           ----------------------------------------------------------------------
3drdB           GKIAHSTLLGMTNVPATQLAETLIDISKLTRVFYSDSGAEAMEIALNIGKPEKQKFIAMKSYKAPIPYVY
3dodB           GKIAHSTLLGMTNVPATQLAETLIDISKLTRVFYSDSGAEAMEIALNIGKPEKQKFIAMKSYKAPIPYVY
3dodA           ---AHSTLLGMTNVPATQLAETLIDISKLTRVFYSDSGAEAMEIALNIGKPEKQKFIAMKSYKAPIPYVY
3bwnF           LMSYFSDMTNLCWFLEPELEDAIKDLHGVVGNAVVGTGQAAVHALSSLARSQPVSVVAAAPFYSTYVEET
2bhgA           ----------------------------------------------------------------------
3e6gA           ---------------RFAYERCVAALEGGTRAFAFASGMAATSTVMELL-DAGSHVVAMRLFERVRRRTA
2b34A           --------------------------------------SMCIPPTEDTLKKVQNVILVGIEAHVCVLQTT
2dbnA           ----------------------------------------------------------------------
3bh1A           ----------------------------------------------------------------------
3c01F           ----------------------------------------------------------------------
3c01E           ----------------------------------------------------------------------
3bmaD           ---------------SSEWLRFDGAHPAVYRPYLLGQGQYFGMQQMLPQLENKQVVYVISPQWFSKNGYD
2bu3A           ------------------SREDFFPLSQFVTQVNQAYCGVASIIVLNSLAVIAPEVVARQGTLDELGRLI
3bh1D           ----------------------------------------------------------------------
3bwoC           LMSYFSDMTNLCWFLEPELEDAIKDLHATEDRYIVVGTGSAVHALSSLARSQPVSVVAAAPFYSTYVEET
1dy2A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           NLSPAQLRRFIHNDTQHLSRLLQSPCVGQQLVVTEGVYSMDGDSAPLAEIQHIARRHHAWLLVDDAHGIG
3a2bA           RLSFSKVIKYGHNNMEDLRAKLSRPEDSAKLICTDGIFSMEGDIVNLPELTSIANEFDAAVMVDDAHSLG
1bs0A           SLSPSQLRRFAHNDVTHLARLLASPCPGQQMVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTG
1djeA           SLSPSQLRRFAHNDVTHLARLLASPCPGQQMVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTG
2bwpB           KRNAGPKRIFRHNDVAHLRELIADDPAAPKLIAFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVG
2bwoD           GIKRNAGPKRIFRHNDVAHLRELIAADDPALIAFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVG
2bwnD           GIKRNAGPKRIFRHNDVAHLRELIAADDPALIAFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVG
2bwpA           RNAGPKRIFRHNDVAHLRELIAADDPAAPKLIAFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVG
2cdmA           TTGNLVIGKFRHETSRERDPQLHTHAVILTKRSDGQWRALKND-EIVKATRYLGAVYN-AELAHELQKLG
2bwoB           RNAGPKRIFRHNDVAHLRELIAADDPAAPKLIAFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVG
2bwnB           GIKRNAGPKRIFRHNDVAHLRELIAADDPALIAFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVG
2bwnA           GIKRNAGPKRIFRHNDVAHLRELIAADDPALIAFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVG
2bwoA           GIKRNAGPKRIFRHNDVAHLRELIAADAPKLIAFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVG
2bwnE           KRNAGPKRIFRHNDVAHLRELIAADPAAPKLIAFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVG
1d2fB           EGNQRTVMPVALCDMGKLEAVLAKPECKIMLLCSQNPTGKVWTCDELEIMADLCERHGVRVISDEIHMDM
1d2fA           EGNQRTVMPVALEKQKLEAVLAKPECKIMLLCSPQNPTGKVWTCDELEIMADLCERHGVRVISDEIHMDM
1dfoB           SPVNFSGKLYNIVPYGIDATYADLEKQAKEPKMIIGGFSAYSGVVDWAKMREIADSIGAYLFVDMAHVAG
1djuA           ILAGGKPVEVPTYEEDEFRLNVDELKKYVTINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHF
1ecxA           KYLSMKGFKVKYVPVDSLEKLVDEDTF---LVSIMAANNEVGTIQPVEDVTRIVKKKNKETLVHVDAVQT
1b5pA           RFAGGVVVEVETLPEEGFVPDPERVRRAITALVVNSPNNPTGAVYPKEVLERLAVEHDFYLVSDEIYEHL
2c7tA           LNVNALPVFVDVEADTYCIDPQLIKSAITDKTKAIIPVHLFGSMANMDEINEIAQEHNLFVIEDCAQSHG
2douB           RVASLRTFLIPLREDGLADLKAVPEGVWREVLLLNYPNNPTGAVGYFEEALGLARKHGLWLIHDNPYVDQ
1bjwA           RFAGGVVVEVETLPEEGPERVRRAITPRTKALVVNSPNNPTGAVYPLEALARLAVEHDFYLVSDEIYEHL
2bhxB           EAKLLGETHIAASTKANSYQSIPDFSEFQLNENDAYLHITSNNTIYGTQYQNFPEINHAPLIADMSSDIL
1eg5B           YLSKGFKVKYVPVDSRGVVKLLEKLVDEDTFLVSIAANNEVGTIQPVEDVTRIVKKKNKETLVHVDAVQT
2bieB           EAKLLGETHIAASTKANSYQSIPDFSEFQLNENDAYLHITSNNTIYGTQYQNFPEINHAPLIADMSSDIL
1ecxB           KYLSMKGFKVKYVPVDSLEKLVDEDTF---LVSIMAANNEVGTIQPVEDVTRIVKKKNKETLVHVDAVQT
1eg5A           YLSKGFKVKYVPVDSRGVVKLLEKLVDEDTFLVSIAANNEVGTIQPVEDVTRIVKKKNKETLVHVDAVQT
1dfoA           SPVNFSGKLYNIVPYGIDATGHIDYADLEKQKMIIGGFSAYSGVVDWAKMREIADSIGAYLFVDMAHVAG
3e77A           EAKKFGTINIVHPKLGSYTKIPDPSTWNLN-PDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSFLS
2dgmB           RYWDVELREIPMRPGQLFKRMIEACDENTIGVVPTFGVTYTGNYEFALDKFQADTGIDIDMHIDAASGGF
2byjA           SSSTDPTSYDGYNDLPALERALQDPNVA--AFMVEPIQGEAGVVVPLMGVRELCTRHQVLFIADEIQT-G
1djuB           ILAGGKPVEVPTYEEDEFRLNVDELKKYVTINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHF
2cfbA           TLTAP------YNDLEAVSRLFEQYPNDIAGVILEPVVGNAGFIPPLEGLRELTKQYGALLVFDEVMTGF
2douA           RVASLRTFLIPLREDGLADLKAVPEGVWREVLLLNYPNNPTGAVADWGEALGLARKHGLWLIHDNPYDQV
2c81A           LNVNALPVFVDVEADTYCIDPQLIKSAITDKTKAIIPVHLFGSMANMDEINEIAQEHNLFVIEDCAQSHG
2dkjA           SRVNFSGKLYKVVSYGVRPDTELIDLEEVRPKVIVAGASAYPRFWDFKAFREIADEVGAYLVVDMAHAGL
3bb8A           IQNGLIPVFVDVDIPTYNVNASLIEAAVSDKTKAIMIAHTLGNLFDLAEVRRVADKYNLWLIEDCCDALG
1ay4B           NFMGLPVQTYRYFDFEGMKADLAAAKKGDMVLLHGCCHNPNLTLDQWAEIASILEKTGALPLIDLAYQGF
3dzzB           GNGRRVISSDLIKYSVNWADLEEKLATPSVRVFCNPHIGYAWSEEEVKRIAELCAKHQVLLISDEIHGDL
1bkgA           RFAGGVVVEVETLPEEGPERVRRAITPRTKALVVNSPNNPTGAVEVLEALARLAVEHDFYLVSDEIYEHL
5bj4A           RFAGGVVVEVETLPEEGFVPDPERVRRRTKALVVNSPNNPTGAVYPLEALARLAVEHDFYLVSDEIYEHL
3dydA           ESMGIEVKLYNLLPEKSWEIDLKQLEYLIDCLIVNNPSNPCGSVFSLQKILAVAARQCVPILADEIYGDM
3dzzA           GNGRRVISSDLIYENSKYSVNWAATPSVRVFCNPHNPIGYAWSEEEVKRIAELCAKHQVLLISDEIHGDL
3dydB           ESMGIEVKLYNLLPEKSWEIDLKQLEYLIDCLIVNNPSNPCGSVFSKRKILAVAARQCVPILADEIYGDM
3cq6A           KGTHTEFIAVSRGAFRIDMDVALEEIRAKQIVFVTTPNNPTGDVTSLDDVERIINVAPGIVIVDEAYAEF
1bjnA           EAKKYCTPNVFDAKVTVDGLRAVKPMREWQLSAAYMHYCPNETIDGIAIDETPDFGADVVVAADFSSTIL
3e77C           EAKKFGTINIVHPKLGSYTKIPDPSTLNPDASY---VYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFL
1b5oA           RFAGGVVVEVETLPEEGFVPDPERVRRAITALVVNSPNNPTGAVYPKEVLEALAVEHDFYLVSDEIYEHL
1ay5B           NFMGLPVQTYRYFDAKADLAAAKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGF
3cq4B           KGTHTEFIAVSRGADFRIDMDVALEEIRPDIVFVTTPNNPTGDVTSLDDVERIINVAPGIVIVDEAYAEF
2dgmE           RYWDVELREIPMRPGQLPKRMIEACDENTIGVVPTFGVTYTGNYEFALDKFQADTGIDIDMHIDAASGGF
3cq4A           KGTHTEFIAVSRGADFRDVALEEIRAKQPDIVFVTTPNNPTGDVTSLDDVERIINVAPGIVIVDEAYAEF
1ejiA           TDKKKISATSIFFESPYKVYPETGYINYDQLKLIIAGTSCYSRNLDYARLRKIADDNGAYLADAHISGLV
3bcxA           IQNGLIPVFVDVDIPTYNVNASLIEAAVSDKTKAIMIAHTLGNLFDLAEVRRVADKYNLWLIEDCCDALG
3bn1C           TYCGATPVLVDNDPRTFNLDAAKLEALITPRTKAIMPVHLYGQICDMDPILEVARRHNLLVIEDAAEAVG
2cstA           MDAGFKDIRKRGLDLQGLLDDMEKFSIFILHACAHNPTGTDPTPDEWKQIAAVMKRRCLFPFFDSAYQGF
5bj3A           RFAGGVVVEVETLPEEGFVPDPERVRRAITVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHL
2c0rA           EAKLIGDTHVAASSEASNYMTLPKLQEIQLQDNAAYLHLTSNETIEGAQFKAFPDTGSVPLIGDMSDILS
2aevA           CKIVNAKYFESDKVGEILNKIDKDTLV---IITGSTMDLKVIELENFKKVINTAKNKEAIVFVDDASGAR
3cq5B           KGTHTEFIAVSRGADFRIDMDVALEEIRAKIVFVTTPNNPTGDVTSLDDVERIINVAPGIVIVDEAYAEF
2e7jA           ERAGLNIALVPKITPENFAQTIEKKRGEVVLALITYPDGNYGNLPDVKKIAKVCSEYDVPLLVNGAYAIG
2aeuA           SCKIVNAKYFESDKVGEILNKIDKDTLV--IITGSTMDLKVIELENFKKVINTAKNKEAIVFVDDASGAR
1asfA           NSAGLEVREYAYYDAENLINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLSVEKGWLPLFDFAFQGF
3eiaA           VIMGQTGQFNTDCTPENGFFPDLSTVGRTDIIFFCNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMY
3bs8A           EGIAKNTITVPYNDLESVKLAFQQFGEDIAGVIVEPVAGNMGVVPPLQGLRDITEQYGSLLIFDEVMTGF
1ariA           NSAGLEVREYAYYDFDALINSLNEAQVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGF
1cl1B           SKILSKLGVTTSWFDPLGADIVKHLQPNTKIVFLESPGSITMEVHDVPAIVAAVRSVVPDAIIMIDNTWA
3ei7B           VIMGQTGQFNTDVNGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMY
3e2yA           RMAGAVPVFIPLRSKPTPRELESKFSSKTKAIILNTPHNPLGKVYTLQVIADLCVKHDTLCISDEVYEWL
2bylA           SSSTDPTSYIPYNDLPALERALQDPNV--AAFMVEPIQGEAGVVVPLMGVRELCTRHQVLFIADEIQGLA
1c7gA           KNGATFVDIVRDEAHDAATLIKEKGAENIAYICLAVTVNLAGSMANMRAVHEMASTYGIKIFYDATRCVE
1c4kA           LAMAGGRPVYLQTNRNPYGFIGGIYDSDFDRLAVIQLGTYDGTIYNAHEVVKRIGHLCDYIEFDSAWVGY
2bieA           EAKLLGETHIAASTKANSYQSIPDFSEFQLNENDAYLHITSNNTIYGTQYQNFPEINHAPLIADMSSDIL
3bcxB           IQNGLIPVFVDVDIPTYNVNASLIEAAVSDKTKAIMIAHTLGNLFDLAEVRRVADKYNLWLIEDCCDALG
3ei7A           VIMGQTGQFNTDCTPENGFFPDLSTVGRTDIIFFCNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMY
3ei8A           VIMGQTGQFNTDCTPENGFFPDLSTVGRTDIIFFCNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMY
2dgkC           RYWDVELREIPMRPGQLPKRMIEACDENTIGVVPTFGVTYTGNYEFALDKFQADTGIDIDMHIDAASGGF
1bj4A           FMTDKKKISATSIFFESMPYKLEENARLFHPKLIIAGTSCYSRNLEYARLRKIADENGAYLMADMAHISG
1cj0A           KISATSIFFESMAYKVNPDTGYIDYDRLEENALIIAGTSCYSRNLDYGRLRKIADENGAYLMADMAHISG
1dgdA           TYRPRFERNGAYDYLAEFDLIDRQSSGNLAAFIAEPILSSGGIIELPDGLKRKCEARGMLLILDEAQTGV
2dgkA           RYWDVELREIPMRPGQLPKRMIEACDENTIGVVPTFGVTYTGNYEFALDKFQADTGIDIDMHIDAASGGF
2ch2A           MSERYGADVRTIEGPPDRPFSLAIELHQPKCLFLTHGDSSSGLLQPLEGVGQICHQHDCLLIVDAVALCG
2aatA           NSAGLEVREYAYYDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTWQTLAQLSVEKGWLPLFDFAYQGF
3dr7B           TYCGATPVLVDNDPRTFNLDAAKLEALITPRTKAIMPVHLYGQICDMDPILEVARRHNLLVIEDAAEAVG
2e54A           TATGQPKYQKPFEPLVPGFEYFEFNNVEDLAVFLEPIQGESGIVPATKEARKLCDEYDALLVFDEVQCGM
3drdA           KAPIPYVYRSESGDLRELAQLLEEHHEEAALSIESMVQGASGMIVMLAGVRELCTTYDVLMIVDEVATGF
1cj0B           FMTDKKKISAPDTGYIDYDRLEENARLFHPKLIIAGT-SCYSRNLDYGRLRKIADENGAYLMADMAHISG
2cinA           SLTNTKPTIWPRIDAPYMRPGLDEPAMAALCFVAEPIQGEGGDRHFRPEFFALCDEFDALLIFDEVQTGC
2e7uA           VEAAKLTLVLEYNDPEGLREVLKRRGEEIAAIIFEPVVGNAGVLVPTEDFLKAAKAYGVLLIADEVMTGF
2dr1B           VVESNGRKAVVLEYKPEDLDDALRKNPDVEAVTITYNETSTGVLNPLPELAKVAKEHDKLVFVDAVSAMG
1b8gB           KWRTGVEIVPIHTALEEAYQEAEKRNLRVKGVLVTNPSNPLGTTMTRNLLLSFVEDKGIHLISDEIYSGT
1e5eB           EHALTKFGIQVDFINTAPGEVKKHMKPNTKIVYFETPANPTLKIIDMERVCKDAHSQEGVLVIADNTFCS
2dgmA           RYWDVELREIPMRPGQLFMDMIEACDENTIGVVPTFGVTYTGNYEFALDKFQADTGIDIDMHIDAASGGF
1e5eA           EHALTKFGIQVDINTAIPGEVKKHMKPNTKIVYFETPANPTLKIIDMERVCKDAHSQEGVLVIADNTFCS
3bn1D           TYCGATPVLVDNDPRTFNLDAAKLEALITPRTKAIMPVHLYGQICDMDPILEVARRHNLLVIEDAAEAVG
2ch1A           MSERYGADVRTPFSLETLARAIELHQP--KCLFLTHGDSSSGLLQPLEGVGQICHQHDCLLIVDAVALCG
1bw0A           KAYGIGMHFYNCRPENDIRRLKDDKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGM
3dr4A           TYCGATPVLVDNDPRTFNLDAAKLEALITPRTKAIMPVHLYGQICDMDPILEVARRHNLLVIEDAAEAVG
2eh6A           SATGQPKFHKGFEPLDSVYKLLDEETAGIIIEVIQGEGGNEASEDFLSKLQEICKEKDVLLIIDEVQTGI
1aiaA           NSAGLEVREYAYLDFDALINSLNEAQAGDVVLFHGNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGF
3aatA           NSAGLEVREYAYYDAENHTNSLNEAQAGDVVLFHHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGF
1arhA           NSAGLEVREYAYYDAENHTLDFDALINSLNHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFARQGF
1aamA           NSAGLEVREYAYYDAENHTLDFDAAGDVVLFHGCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGF
1d7uA           TYRPRFERNGAYDYLAELDYAFDLIDRNLAAFIAEPILSSGGIIELMAALKRKCEARGMLLILDEAQTGV
1dtyA           PAPQSRMDGEWDERDMVGFARLMAAHRHEIVIIEPIVQGAGGMRMYHPEIRKICDREGILLIADEIATGF
1c7nA           KNQERKIIECELIDFQKLEKLSDKNNKALLFCSPHNPVGRVWKKDELQKIKDIVLKSDLMLWSDEIHFDL
3ei6B           VIMGQTGQFNTDCTPENGFFPDLSTVDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMY
3cbfA           RLQGPRFLTVPAGEEGPDLDALEEVLKPRFLYLIPSFQNPTGGLTPRKRLLQMVMERGLVVVEDDAYREL
3dxvA           AFSGLILLPYGDAILTLLTEKLAAVPAGSIAAFIEPIQSDGGLIVPLRKFADICRAHGILVVCDEVKVGL
3ei9A           VIMGQTGQFNTDCTPENGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLAKKNGSIIVYDSAYAMY
3dr4C           TYCGATPVLVDNDPRTFNLDAAKLEALITPRTKAIMPVHLYGQICDMDPILEVARRHNLLVIEDAAEAVG
3bcbA           VTAGFEPVVIENVDLKAVEAKIQEGPEHILCLHSTTACFAPRVPDRLEELAVICANYDIPHVVNNAYGLQ
3e77B           EAKKFGTINIVHPKLGSYTKIPDPSTWNLNYVYYCANETVHGVE-----FDFIPDVKGAVLVCDMSSNFL
3ecdA           -------RDTMLIDYDQVEALAQQHK----PSLIIAGFSAYPRKLDFARFRAIADSVGAKLMVDMAHIAG
1cl1A           SKILSKLGVTTSWDPLIGADIVKHLQPNTKIVFLESPGSITMEVHDVPAIVAAVRSVVPDAIIMIDNTWA
3b46B           ELCGGKVVYVPINDFEQFEKAITSKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHL
2egyD           RLQGPRFLTVPAGEEGPDLDALEEVLKRERLYLIPSFQNPTGGLTPLPARKRMVMERGLVVVEDDAYREL
1ajsA           TTAGFKDIRSYRYDLQGFLSDLENAPEFSIFVLHANPTGTDPTPEQWKQIASVMKRRFLFPFFDSAYQGF
3eiaB           VIMGQTGQFNTDTPENGFFPDLSTVGRTDIIFFCNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMY
2dgmC           RYWDVELREIPMRPGQLPKRMIEACDENTIGVVPTGNYEFPQPLHDALDKFQADTGIDIDMHIDAASGGF
3ei6A           VIMGQTGQFNTDTPENGFFPDLSTVGRTDIIFFCSNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMY
1arsA           NSAGLEVREYAYYDAEALINSLNEAQAGDVVLFHGCCHNPTGIDPTLETLAQLSVEKGWLPLFDFAYQGF
2dr1A           VVESNGRKAVVLEYEPGKAVKPEDLDDALRKVTITYNETSTGVLNPLPELAKVAKEHDKLVFVDAVSAMG
3dxvB           DYRPYRNDPTGDAILTLLTEKLAAVPAGSIAAFIEPIQSDGGLIVPPDGFLRKFARAHGILVVCDEVKVG
1bqaA           NSAGLEVREYAYYDAINSLNEAQAGDVVLFHGCCHNATGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGF
3bc8A           VTAGFEPVVIENVDLKAVEAKIQEGPEHILCLHSTTACFAPRVPDRLEELAVICANYDIPHVVNNAYGLQ
1aheA           NSAGLEVREYAYYDAENHTLDFDALINSLNVLFHGCCHNPTGIDPTLEQWQQLSVEKGWLPLFDFAYQGF
3ei9B           VIMGQTGQFNTDCTPENGFFPDLSTVGRTDIIFFCNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMY
1ay4A           NFMGLPVQTYRYFDAETMKADLAAAKKGDMVLLHGCCHNPTGANLTLAEIASILEKTGALPLIDLAYQGF
3cq5A           KGTHTEFIAGADFRIDMDVALEEIRAKQPDIVFVTTPNNPTGDVTSLDDVERIINVAPGIVIVDEAYAEF
1ax4A           ELNGCKAINIGDFDIKKLKENIQHGADNIVAIVSTVTCNSAGGQPVLKEVYEIAKQHGIFVVMDSARFCE
2egyC           RLQGPRFLTVPAGEEGPDLDALEEVLKRERFLYLIPSFQNPTPLPARKRLLQMVMERGLVVVEDDAYREL
2ctzA           KVTLKRLGIEVRFTSREEREFLALTDEKTRAWWVESIGNPALNIPDLEALAQAAREKGVALIVDNTFGMG
3bn1A           TYCGATPVLVDNDPRTFNLDAAKLEALITPRTKAIMPVHLYGQICDMDPILEVARRHNLLVIEDAAEAVG
1c0nA           QMLCARVGAELRVIPLNPDGTLQLETLPTLFLAITHVSNVLGTENPLAEMITLAHQHGAKVLVDGAQAVM
1cs1A           DSLAKRGCYRVLFVQGDEQALRAALAEKPKLVLVESPSNPLLRVVDIAKICHLAREVGAVSVVDNTFLSP
1czcA           NSAGLEVREYAYYDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTWQTLAQLSVEKGWLPLFDFAYQGF
3ecdB           -------RDTMLIDYDQVEALAQQHK----PSLIIAGFSAYPRKLDFARFRAIADSVGAKLMVDMAHAGV
2c44C           QINGCTVRNKGNFDLEGLERGIEVGPNNVPYIVATITSNSAGSLANLKAMYSIAKKYDIPVVMDSARFAE
3e2fA           RMAGAVPVFIPLDWTFDPRELESKFSSKTKAIILNTPHNPLGKVYTRQVIADLCVKHDTLCISDEVYEWL
3bv0B           LAAQVFAPQVPRDAFEAQLAQHAGELAA--VVVEPVVQGAGGDPRYLHDLRDICRRYEVLLIFDEIAT-G
1akaA           RDAGLQLQAYRYYDFTGAMEDISKIPEKSIILLHACAHNPTGVDPRQEELASVVKKRNLLAYFDMAYQGF
3b8xA           QQYGLRVKFVDIDINTLNIDIESLKEAVTDSTKAILTVNLLGNPNNFDEINKIIGGRDIILLEDNCESMG
2d5yA           NSAGLEVREYAYYDAENHTLDFDALINSLNHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGF
1b9iA           QRLGAVTVPVDVDAATYNLDPEAVAAAVTPRTKVIMPVHMAGLMADMDALAKISADTGVPLLQDAAHAHG
1b4xA           NSAGLEVREYHTLDFDALINSLNEAQAGDVVLFHGSCHNPTGIDEQWQTLAQLSVEKGWLPLFDFAYQGF
1asbA           NSAGLEVREYAYYDFDALINSLNEAQAGDVVLFHGCCHNPTGTLEQWQTLAQLSVEKGWLPLFAFAYQGF
3e9kA           ESQLQLHGLNIELRIEDILEVIEKEGDSIAVILFSGVHFYTGQHFNIPAITKAGQAKGCYVGFDLAHAVG
3dr4B           TYCGATPVLVDNDPRTFNLDAAKLEALITPRTKAIMPVHLYGQICDMDPILEVARRHNLLVIEDAAEAVG
3bwnD           TYVRSGMYKWEGDAWGFDKK-------GPYIELVTSPNNPDGT--------IRETVVNAKVIHDFAYYWP
3b46A           ELCGGKVVYVPINDFEQFEKAITSKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHL
3bcaA           VTAGFEPVVIENTDLKAVEAKIQEGPEHILCLHSTTACFAPRVPDRLEELAVICANYDIPHVVNNAYGLQ
2bkwA           CLRSYGAQLKIGESVPLELITEKLSQNSYGAVTVTHVDTSTAVLSDLKAISQAIKQTSPETFFDAVCSIG
2a0yA           NDERFGDRFPAMSDAYDRTMRQRWKQMGEQRELQEGTYMVAGPSFETVAECRVLQKLGADAVGMSTVPEV
3d6kB           EHFGFEINVPTDEGPDGVVRELVKDPQVKGWTVPGNPTGVTFSEQTCRELAESTAAPDFRIVWDNAYALH
2d66A           NSAGLEVREYAYYDAENHTLDFDALINSLNHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGF
1bjoA           EAKKYCTPNVFDAKVTVKPMREWQLSDNAAYMHYCPNETIDGIAID----ETPDFGADVVVAADFSSTIL
3bv0A           SICPQVPRDYDPAYSAAFEAQLAQHAGELAAVVVEPVVQGAGGMRFLHDLRDICRRYEVLLIFDEIAT-G
1bw0B           KAYGIGMHFYNCRPENDIRRLKDDKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGM
3b8xB           QQYGLRVKFVDIDINTLNIDIESLKEAVTDSTKAILTVNLLGNPNNFDEINKIIGGRDIILLEDNCESMG
2cy8A           EGTTANTLLIRPDDIEGMREVFANHGSDIAAFIAEPVGSHFGVTPVSDSGAELARQYGALFILDEVISGF
2egyB           RLQGPRFLTVPAGEEGPDLDALEEVLKRERLYLIPSFQNPTGGLTPLPARKRMVMERGLVVVEDDAYREL
3dr4D           TYCGATPVLVDNDPRTFNLDAAKLEALITPRTKAIMPVHLYGQICDMDPILEVARRHNLLVIEDAAEAVG
3ecdC           -------RDTMLIDYDQVEALAQQHK----PSLIIAGFSAYPRKLDFARFRAIADSVGAKLMVDMAHAGV
3d6kC           EHFGFEINVPTDEGPDGVVRELVKDPQVKGWTVPGNPTGVTFSEQTCRELAESTAAPDFRIVWDNAYALH
1b8gA           KWRTGVEIVPIHCALEEAYQEAEKRNLRVKGVLVTNPSNPLGTTMTLYLLLSFVEDKGIHLISDEIYSGT
1agxA           GDALPGVQIVYGSDNMMPDAYQAFAKAGVKAIIHAGTGNGSMANYLVPEVRKLHDEQGLQIVRSSRVAQG
2a7vA           AVYTALLQPHDRIMGYKYNQLALTARLFRPRLIIAGT-SAYARLIDYARMREVCDEVKAHLLADMAHISG
3bigA           QQLGVRVFAIPDGDVAASILTCMPGGAPEGVVSAAVIRALDGDMNGRLLARHDVKNEIGEQELARCKAMG
1b9hA           QRLGAVTVPVDVDAATYNLDPEAVAAAVTPRTKVIMPVHMAGLMADMDALAKISADTGVPLLQDAAHAHG
1bqdA           NSAGLEVREYAYYDAENHTLDFDALINSLNHGCCHNATGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGF
2cb1A           GQVLSLMGVTVRYVDPEPEAVREALSAKTRAVFVETVANPALLVPDLEALATLAEEAGVALVVDNTFGAA
3d19E           QIAHSYTNETDPEQIKRFNAEVQQA--------ATNIWGFKRKILGLILTCKLPGQNNFPLLVDHTSREA
3dc1A           HPLGCNIINVASDESGIVPDSLRDILSRWKPLYTVPNGNNPTGNSTSERKKEIYERKYDFLIIEDDPYYF
2d64A           NSAGLEVREYAYYDAENHTINSLNEAQAGDVVLFHGCTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGF
3cogB           RQVASEFGLISFVDCSKIKLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMS
2d61A           NSAGLEVREYAYLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTWQTLAQLSVEKGWLPLFDFAYQGF
3d6kA           EHFGFEINVPTDEGPDGVVRELVKDPQVKGWTVPGNPTGVTFSEQTCRELAESTAAPDFRIVWDNAYLHT
1awiA           ----------------------------------------NAYIDNL--MADGTCQDAAIVGYKDSPSVW
3d6kD           EHFGFEIN-VPTDEGPDGVVRELVKDPQVKGWTVPVFGNPTGVTQTCRELAESTAAPDFRIVWDNAYALH
3caiA           RAAHRYGAKVKWAEVDIETGELPTWQWESLLVAVNSASGTLGGVTDLRAMTKLVHDVGALVVVDHSAAAP
3du4A           SVGSIEVYRSESGDPDECRDQLRELAQLLELSIESMVQGASGMIVMLAGVRELCTTYDVLMIVDEVAGFG
3bwnB           TYVRSGMYKWEGDAWGFDKK-------GPYIELVTSPNNPDGT--IRETVVNRPDDDEAKVIHDFAYYWP
1ajrA           TTAGFKDIRSYRYWDTEKRGLDLENAPEFSIFVLHACAHTDPTPEQWKQIASVMKRRFLFPFFDSAYQGF
7aatA           RDAGLQLQAYRYLDFTGAMEDISKIPEKSIILLHACAHNPDPRQEQWKELASVVKKRNLLAYFDMAYQGF
3ecdD           --QYGVSRDTMLIDYDQVEALAQQHK----PSLIIAGFSAYPRKLDFARFRAIADSVGAKLMVDMAHAGV
2c44A           QINGCTVRNKGNFDLEGLERGIEVGPNNVPYIVATITSNSAGSLANLKAMYSIAKKYDIPVVMDSARFAE
3d19A           QIAHSYTNETDPEQIKRFNAEVQQA--------ATNIWGFKRKILGLILTCKLPGQNNFPLLVDHTSREA
3e6gD           RVRRTAGLDFSFVDLTDPAAFKAAIRADTKMVWIETPTNPMLKLVDIAAIAVIARKHGLLTVVDNTFASP
1eghA           LISRATGMSGPMGGDQQVGALISEGKI-DVLIFFWDPLNAVPHDPDVKALLRLATVWNIPVATNVATADF
3e6gB           RVRRRTAGDFSFVDLTDPAAFKAAIRADTKMVWIETPTNPMLKLVDIAAIAVIARKHGLLTVVDNTFASP
3eh2A           ----------------------------------------------------------------------
3dc1B           HPLGCNIINVASRWKPEDAKNPQTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFL
2btwB           AYCGVASITAQYSPYRVFTQDNFFSNE---KTKAVIAPEVVAKQGTLDELGRLIASYGVKVKVNHASDTN
2c44B           QINGCTVRNKGNFDLEGLERGIEVGPNNVPYIVATITSNSAGSLANLKAMYSIAKKYDIPVVMDSARFAE
3dc1D           HPLGCNIILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYD-FLIIEDDPYYF
3bwnA           TYVRSGMYKWEGDAWGFD-------KKGPYIELVTSPNNPDGTIRETVVDEAKVIHDFAYYWPHYTPITR
3bwoA           TYVRSGMYKWEGDAWGFDKK-------GPYIELVTSPNNPDGTIRETVVAKDFAYYWPHYTPITRRQDHG
2btwA           AYCGVASIIAQYSPYRVFTQDNFFSNEK---TKAVIAPEVVARQGTLDELGRLIASYGVKVKVNHASDTN
1btcA           -IPQWVLDIGESNHDIFYTNRSRNKEYLTVGVDNEPIFHGRTAIEIMKSFRENMSDFLESGLIIDIEVGL
3cogD           RQVASEFGLISFVDCSKIKLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMS
1c8nA           -------------CLSYDRNDVAPGSRVQLSQTYKAINFPPYAGYDGAAILNTDVTPTSAIYVDVDVTRF
1b93B           LISRATGMSGPMGGDQQVGALISEGKI-DVLIFFWDPLNAVPHDPDVKALLRLATVWNIPVATNVATADF
1bybA           PIPQWVLDIGESNHDIFYTNRSGTKEYLTVGVDNEPIFHGRTAIEIMKSFRENMSDFLESGLIIDIE-VG
3bh1C           -------------------------------LGSSNPRLHTDEVLIALSVSAATDSNAQKALDQLKNLRG
3drdB           RSESGDPDECRDQCLRELAQLLEEHHEEAALSIESMVQGASGMIVMLAGVRELCTTYDVLMIVDEVAGFG
3dodB           RSESGDPDECRDQCLRELAQLLEEHHEEAALSIESMVQGASGMIVMLAGVRELCTTYDVLMIVDEVAGFG
3dodA           RSESGDPDECRDQCLRELAQLLEEHHEEAALSIESMVQGASGMIVMLAGVRELCTTYDVLMIVDEVAGFG
3bwnF           TYVRSGMYKWEGDAWGFDKK-------GPYIELVTSPNNPDG---------TIRETVVAKVIHDFAYYWP
2bhgA           -----------DGRATDSDYRVFEFEIKVKGQDLSDAALVLHRGNKTKHFRDTARKKGTPVVGVVNADVG
3e6gA           GLDPAAFKAAIRADT----KMVWIETPTNPM----------LKLVDIAAIAVIARKHGLLTVVDNTFASP
2b34A           YDLLERGLNVVVDAVSSRSDRHFAFKQMEQAGAILTTSEATILGLVGGSD-HPKFKEVQKLILTSAPDTG
2dbnA           ----------------------------------------------------------------------
3bh1A           ------------------------------HLGSSNPRLHTDEVLIALSVSAATDSNAQKALDQLKNLRG
3c01F           ---------------------------------------VYETNQRALAVRAYAEKVGVPVIVDIKLARS
3c01E           ---------------------------------------VYETNQRALAVRAYAEKVGVPVIVDIKLARS
3bmaD           PAAFQQYFNGDQLKHQSGDQASQYAAT--RLLQQFPNVAMKDLVQKLASKEELSTLARFNERQASFFGQF
2bu3A           ADFRKQVAENLKQDGNFVIVNYLRKEIGQ---ERGGHISPAYNEQTDRFLIDVSRYKYPPVWVKTTDLWK
3bh1D           ---PESIEPIQTLKTVHLG-------SSNPRLHTDEVLIAL-------SVSAATDSNAQKALDQLKNLRG
3bwoC           TYVRSGMYKWEGDAWGFDK-----KGPYIELVTSNNPDGTIRETVVAKVIHDFAYYWPHYTPITRRQDHD
1dy2A           --------------------------------------------QDLSTVVRKAERFGLPIVNLKGQVLF


                         .         .         .         +         .         .         .:280
query           VTGDEGRGTCWQRGVKPELLVVTFGKGFGVSGAAVLCSESVADYLLQFARHLVYSTSMXXXXXXXXXXXX
3a2bA           VIGHKGAGTASHFGLNDDLIMGTFSKSLASLGGFVAGDADVIDFLKHNARSVMFSASMTPASVASTLKAL
1bs0A           VIGEQGRGSCWLQKVKPELLVVTFGKGFGVSGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASL
1djeA           VIGEQGRGSCWLQKVKPELLVVTFGKGFGVSGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASL
2bwpB           MYGPRGAGVAERDGLMHRIFNGTLAKAYGVFGGYIAASARMVDAVRSYAPGFIFSTSLPPAIAAGAQASI
2bwoD           MYGPRGAGVAERDGLMHRIFNGTLAKAYGVFGGYIAASARMVDAVRSYAPGFIFSTSLPPAIAAGAQASI
2bwnD           MYGPRGAGVAERDGLMH--RIDIFNGTLAVFGGYIAASARMVDAVRSYAPGFIFSTSLPPAIAAGAQASI
2bwpA           MYGPRGAGVAERDGLMHRIDIFTLAKAYGVFGGYIAASARMVDAVRSYAPGFIFSTSLPPAIAAGAQASI
2cdmA           YLRYGKDGNFD-----------LAHIDRQQIEGFSKRTEQIAEWYAARGLDPNSVSLEQKQAAKVLSRAK
2bwoB           MYGPRGAGVAERDGLMHRIDIFTLAKAYGVFGGYIAASARMVDAVRSYAPGFIFSTSLPPAIAAGAQASI
2bwnB           MYGPRGAGVAERDGLMH--RIDIFNGTLGVFGGYIAASARMVDAVRSYAPGFIFSTSLPPAIAAGAQASI
2bwnA           MYGPRGAGVAERDGLMH--RIDIFNGTLGVFGGYIAASARMVDAVRSYAPGFIFSTSLPPAIAAGAQASI
2bwoA           MYGPRGAGVAERDGLMH--RIDIFNGTLAVFGGYIAASARMVDAVRSYAPGFIFSTSLPPAIAAGAQASI
2bwnE           MYGPRGAGVAERDGL--MHRIDIFNGTLAVFGGYIAASARMVDAVRSYAPGFIFSTSLPPAIAAGAQASI
1d2fB           VWGEQPHIPWSNVARGDWALLTSGSKSFALTGAYGIIENSSSRDAYLSALKGRDGLSSPSVLALTAHIAA
1d2fA           VWGEQPHIPWSNVARGDWALLTSGSKSFNITGAYGIIENSSSRDAYLSALKGRDGLSSPSVLALTAHIAA
1dfoB           LVA---------AGVYPNVTTTTHKTLAGPRGGLILAKGGSEELYKKLNSAVFPGGQGGPLMHVIAGKAV
1djuA           IYDDARHYSIASLDGMFEITVNGFSKTFAMTGGFVAAPSWIIERMVKFQMYNATCPVT-FIQYAAAKALK
1ecxA           IGKIPFSLEKLEV----DYASFSAHKFHGVGITYIRKGVPIRPLIHGGGQERGLRSGTQNVPGIVGAARA
1b5pA           LYEGEHFSPGRVA-PEHTLTVNGAAKAFGWRIGYACGPKEVIKAMASVSRQSTTSPD-----TIAQWATL
2c7tA           SVWN-NQRAGTIGDIGAFSCQQGKVLTAGEGGIIVTKNPRLFELIQQLRADSRVYCDDSSELMHGDMQLV
2douB           VYEGEAPSPLALPGAKERVVELSLSKSYNLAGFRLGFALGSEEALARLERVKGVIDFNQYAGVLRMGVEA
1bjwA           LYEGEHFSPGRVAPEHT--LTVNGAAAFGWRIGYACGPKEVIKAMASVSSQSTTSPDTIAQWATLEALTN
2bhxB           SRPLKVNQFGMIYAGAQKNLGSGVTVVIVKKDLLVEQVPTMLQYATHIKSDSLYNTPPTFSIYMLRNVLD
1eg5B           IGKIPFSLEKLEV----DYASFSAHKFHGVGITYIRKGVPIRPLIHGGGQERGLRSGT--QNVPGIVGAA
2bieB           SRPLKVNQFGMIYAGAQKNLGPGVTVVIVKKDLLVEQVPTMLQYATHIKSDSLYNTPPTFSIYMLRNVLD
1ecxB           IGKIPFSLEKLEVDY----ASFSAHKFHGPKGTYIRKGVPIRPLIHGGGQERGLRSGTQNVPGIVGAARA
1eg5A           IGKIPFSLEKLEV----DYASFSAHKFHGVGITYIRKGVPIRPLIHGGGQERGLRSGTQNVPGIVGAARA
1dfoA           LVA---------AGVYPNVTTTTHKTLAGPRGGLILAKGGSEELYKKLNSAVFPGGQGLMHVIAGKAVAL
3e77A           KPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYAGNSSLYNTPPCFSIYVMGLVLE
2dgmB           LAPFVAPDIVWDFRLPRVKSIASGHKFGLAPLWVIWRDEEALPQELVFNVDYLGGQIGTFAINFSRPAGQ
2byjA           LARTGRWLAVDYENVRPD--IVLLGKALSGGLYPVSAVLCDDDIMLTIKPGEHGSTGGNPLGCRVAIAAL
1djuB           IYDDARHYSIASLDGMFEITVNGFSKTFAMTGWRLGFVAAPSWIIERMVKFQMYNATCPVTFIQYAAAKA
2cfbA           RIAYGGA--QEKFGVTPDLTTLGKVIGGGLPVGAYGGRAEIMKMVAPAGPTLSGNPLAMTAGIKTLE---
2douA           YEGEAPSPLALPGAKERVVELFSLSKSYNLAGFRLGFALGSEEALARLERVKGVIDFNQYAGVLRMGVEA
2c81A           SV-WNNQRAGTIGDIGAFSCQQGKVLTAGEGGIIVTKNPRLFELIQQLRADSRVYCDDSSELMHGDMQLV
2dkjA           VAAGLHPNPLPYA----HVVTSTTHKTLPRGGLILSNDPELGKRIDKLIFPGIQGGPL--EHVIAGKAVA
3bb8A           STYDGKMA-GTFGDIGTVSFYPAKHITMGEGGAVFTQSAELKSIIESFRDWGRDCQLGSLPFGYDHKYTY
1ay4B           GDGLEEDAAGTRLIASRILIAASCSKNFGIYRERTGCLLALCADAATRELFLNRQTYSFPPFHGAKIVST
3dzzB           VLTDEDITPAFTVDWDAKVVSLISPSTFNLAALHAACAIIPNPDLRARAEESFFLAGIGEPNLLAIPAAI
1bkgA           LYEGEHFSPGRVAPEHTLTVNGAAKAFAGWRIGYACGPKEVIKAMASVSSQSTTSPDT-----IAQWATL
5bj4A           LYEGEHFSPGRV-APEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSRQSTTS-PDTIAQWATLE
3dydA           VFSDCKYEPLATLSTDVPILSCGLAKRWGWRLGWILIHDRRDIFGNEIRDGLVKLSQRILGPCTIVQGAL
3dzzA           VLTDEDITPAFTVDWDAKVVSLISPSTFNLAALHAACAIIPNPDLRARAEESFFLAGIGEPNLLAIPAAI
3dydB           VFSDCKYEPLATLSTDVPILSCGLAKRWLVPGGWILIHDRRDIFGNEIRDGLVKLSQRILGPCTIVQGAL
3cq6A           SPSPSATTLLEKYPT--KLVVSRTMSAFDFAGGRLGYFVANPAFIDAVMLVRLPYHLSALSQAAAIVALR
1bjnA           SRPIDVSRYGVIYAGAQNIGPAIVIVREDLLGKANIACPSILDYSILNDNGSMFNTPPTFAWYLSGLVFK
3e77C           SKPVDVSKFGVIFAGAQKNVGSGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGL
1b5oA           LYEGEHFSPGRVAPEHTLTVNGAAKAMTGWRIGYACGPKEVIKAMASVSSQSTTSPDT-----IAQWATL
1ay5B           GDGLEEDAAGTRLIASRILIAASCSKNFGIYRGCLLALCADAATRELAQGAFLNRQTYSFPPFHGAKIVS
3cq4B           SPSPSATT-LLEKYPTKLVVSRTMSKAFDFAGGRLGYFVANPAFIDAVMLVRLPYHLSALSQAAAIVALR
2dgmE           LAPFVAPDIVWDFRLRVKSISASGHKFGLAPLWVIWRDEEALPQELVFNVDYLGGQIGTFAINFSRPAGQ
3cq4A           SPSPSATTLLEKYP-TKLVVSRTMSKAFDFAGGRLGYFVANPAFIDAVMLVRLPYHLSALSQAAAIVALR
1ejiA           AAGVVPSPFEHKTLRGCRAGIFYRKGVSVDPKTGKETYYELESLINSAVFPGLQGGPH--NHAIAGVAVA
3bcxA           STYDGKMA-GTFGDIGTVSFYPAHHITMGEGGAVFTQSAELKSIIESFRDWGRDCYCLGSLPFGYDHKYT
3bn1C           ATYRGKKS-----GSLGDCATFSFFGNIITTGDLAAKMRLLRGQGMDPNRRYWFPIVGFNYRMTNIQAAI
2cstA           ASGSLDKDAWAVRYFVSEGFELSFSKNFNERVGNLSVVGKDEDNVQRVLSQMEKIVRT-TWSNPPSQGAR
5bj3A           LYEGEHF-SPGRVAPEHTLTVNGAAKAFGWRIGYACGPKEVIKAMASVSRQSTTSPDT-----IAQWATL
2c0rA           RPFDLNQFGLVYAGAQKNLGPSGVTVVIVREDLVAESPKHLPTMLRYVKNNSLYNTPPSFGIYMVNEVLK
2aevA           VRL--LFNQPPALKLGADLVVTSTDLMEGPRGGLLAGKKELVDKIYIEGTKFGLEAQ--PPLLAGIYRAL
3cq5B           SPSPSATT-LLEKYPTKLVVSRTMSKAFDFAGGRLGYFVANPAFIDAVMLVRLPYHLSALSQAAAIVALR
2e7jA           RM----PVSLKEIGADFIVGSGHKSMAASGPIGVMGMKEEWAEIVLRRSEKYKNKEVELLGCTARGATII
2aeuA           VRLLFNQPPALKLGA--DLVVTSTDKLMGPRGGLLAGKKELVDKIYIEGTKFGLEAQPPLLAGIYRALKN
1asfA           ARGLEEDAEGLRAFAKELIVASSYSKNFGLYNGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASV
3eiaA           MSDDNPRSIFEIPGAEEVAMEASFSQYAGFTGVRLGWTVIPKKLLYSDGFPVACFNGASNISQAGALACL
3bs8A           RVDYNCAQGYFGVTP----DLTCLGKVIGLPVGAYGGKAEIMEQIAPSGPIYQAGTLSGNPLAMTAGLET
1ariA           ARGLEEDAEGLRAFAAMHIVASSYSKNFGLYNGACTLVAADSETVDRAFSQMKAARANYSNPPAHGASVV
1cl1B           AGVLFKALDFG-----IDVSIQAATYLVGHSDAMIGTAVCNARCWEQLRELMGQMVDADTAYITSRGLRT
3ei7B           MSDDNPRSIFEIPGAEEVAMETSFSKYAGVRLGWTVIPKKLLYSDGFPVAKDFTCFNGASNISQAGALAC
3e2yA           VYTGHTHVKIATLPGMWEITIGSAGKTFGWKLGWSIGPAHLIKHLQTVQQNSFYTCATPLQAALAEAFWI
2bylA           RTGR--WLAVDYENVRPD--IVLLGKALSGGLYPVSAVLCDDDIMLTIKPGEHFSTGGNPLGCRVAIAAL
1c7gA           NAYFIKEQEDIVHEMFSYADGCTMSGKKVNIGGFLCMNDEEMFSAAKELVVVYEGMPSYGGLAGRDMEAM
1c4kA           EQ-FIPMMRNSSPLLIDDIVVQSVHKQQAGTSQIHKKDSHIKGQLFNNSFNLFMSTSPFYPMYAALDVNA
2bieA           SRPLKVNQFGMIYAGAQKNLGPSGVTVVIVKKDLLNTKVEQVPTMLQYATHIKSDSLYNTPPTFSIYMLR
3bcxB           STYD-GKMAGTFGDIGTVSFYPAHHITMGEGGAVFTQSAELKSIIESFRDWGRDCLGGYNLKITDMQAAC
3ei7A           MSDDNPRSIFEIPGAEEVAMETSFSKYAGFTGVRLGWTVIPKKLLYSDGFPRIICTCFNGASNISQAGAL
3ei8A           MSDDNPRSIFEIPGAEEVAMETSFSNYAGFTGVWTVIPKKLLYSDGFPVAKDFNRIICTCFNGASNISQA
2dgkC           LAPFVAPDIVWDFRLPRVKSISSGHKFGLAPLWVIWRDEEALPQELVFNVDYLGGQIGTFAINFSRPAGQ
1bj4A           LVAAGVVPSPFERGCRAGMIFYRKGVKSVDPATGKEILYNLESLINSAVFPGLQGGPH-NHAIAGVAVAL
1cj0A           LVVAGVVP--SPFEHCHVVTTTTHKTLRGCRAGMIFYRRGVRSVDILYNLESLINSAVFPGLQGGPHNHA
1dgdA           GRTGTMFACQRDGVTP---DILTLSKTLGLPLAAIVTSAAIEERAHELGYLFYTTHVSDPLPAAVGLRVL
2dgkA           LAPFVAPDIVWDFRLRVKSISASGHKFGLAPLGCGWVIWRDEEALPQELVFNVDYLSRPAGQVIAQYYEF
2ch2A           VPFYMDKWGITPISISPKAL-DVIRNRRTKSKVFYWDLLLLGNYWGCYDEPKRYHHTVASNLIFALREAL
2aatA           ARGLEEDAEGLRAFAAMHIVASSYSANFGLYNGACTLVAADSETVDRAFSQAAIRANYSNPPAHGASVVA
3dr7B           ATYR-----GKKSGSLGDCAIITTGEGGMITDDLAAKMRLLRGQGMDPNRRYWFPIVGFNYRMTNIQAAI
2e54A           GRTGKLFAYQKYGVV---PDVLTTAKGLGGGVPIGAVIVNERANVLEPGDHGTTFGGNPLACRAGVTVIK
3drdA           GRTG-KMFACEHENVQPDL--MAAGKGITGGYLPIAVTFATEDIYKAFYDDYFFHGHSYTGNQLGCAVAL
1cj0B           LVVAGVVPSPFEHCTTHKTLRGCRAGMIFYRRGVRSVDKEILYNLESLINSAVFQGGPHNHAIAGVAVAL
2cinA           GLTGTA-WAYQQLDVAPD--IVAFGKKTQVCGVMAGRRVDEVADNVFAVPSRLNSTWGGNLTDMVRARR-
2e7uA           RLAFGGATELLGLKP----DLVTLGKILGLPAAAYAGRREIMEKVAPLGPVYQAGTLSGNPLAMAAGLAT
2dr1B           --GADIKFDKWGLDVVFSSSQKAFGVPPGLAIGAFSERFLEILYVKYLKEKESTPSTPPMPQVFGINVAL
1b8gB           AFSSPSFISVMEVLKDRNHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGLVSSQTQHLLSAML
1e5eB           PMITNPVD--FGVDVVVHSATKYINGHTDVVAGLICGKADLLQQIRMVGIKDITGSVPHDAWLITRGLST
2dgmA           LAPFVAPDIVWDFRLPRVKSISSGHKFGLAPLWVIWRDEEALPQELVFNVDYLGGQIGTFAINFSRPAGQ
1e5eA           PMITNPVD--FGVDVVVHSATKYINGHTDVVAGLICGKADLLQQIRMVGIKDITGSVIHDAWLITRGLST
3bn1D           ATYR-----GKKSGSLGDCATFSFGEGGMITDDLAAKMRLLRGQGMDPNRRYWFPIVGFNYRMTNIQAAI
2ch1A           VPFYMDKWQVLGAPPGITPISIVIRNRRTKSKVFYWDLLLLGNYWGCYDEPKRYHHTVASNLIFALREAL
1bw0A           VFKGKDPN-ATFTSVADFRVILGGTANLVVPGWRLGWLLYVDPHGNGPSFLEMLVCGPCTVVQAALGEAL
3dr4A           ATYRGKKSGSLGDCATGEGGMITTNDDDLAAKMRLLRGQGMDPNRRYWFPIVGFNYRM-----TNIQAAI
2eh6A           GRTG-EFYAYQHFNLKP--DVIALAKGLGGGVPIGAILAREEVAQSFTPGSHGSTFGGNPLACRAGTVVV
1aiaA           ARGLEEDAEGLRAFAKELIVASSYSHNFGLYNGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASV
3aatA           ARGLEEDAEGLRAFAKELIVASSYSKNFNERVGACTLVAADSETVDRAFSQAAIRANYSNPPAHGASVVA
1arhA           ARGLEEDAEGLRAFAKELIVASSYSKNFGLYNGACTLVAADSETVDRAFSQAAIRANYSNPPAHGASVVA
1aamA           ARGLEEDAEGLRAFAKELIVASSYSKNFGLYNGACTLVAADSETVDRAFSQMKAAIDANYSNPPAHGASV
1d7uA           GRTGTMFACQRDGVTP---DILTLSKTLGLPLAAIVTSAAIEERAHELGYLFYTTHVSDPLPAAVGLRVL
1dtyA           G-RTGKLFACEHAEIAPD--ILCLGKALTGGTMTLSATLTTREVAETISDGEAGCFMHGPTFMGNPLACA
1c7nA           IMPGYEHTVFQSIDEQLAITFTAPSKTFNIAGSNIIIKNPDIRERFTKSRDATSGMPF-TTLGYKACEIC
3ei6B           MSDDNPRSIFEIPGAEEVAMETSFSKYAGFTGGWTVIPKKLLYSDGFPVAKDFTCFNGASNISQAGALAC
3cbfA           YFGEARLPSLFELAREAGYPGVGSFSKVLSPGLRVAFAVAHPEALQKLVQAKQGADLHTPMLNQMLVHEL
3dxvA           ARSG-RLHCFEHEGFVPDILVLGKGLGGGLPLSAVIAPAEILDCASAFAMQTLHGNPI--SAAAGLAVLE
3ei9A           MSDDNPRSIFEIPGAEEVAMETSFSNYAGFTGVRLGWTVIPKKLLYSDGFPVCTCFNGASNISQAGALAC
3dr4C           A-----TYRGKKSGSLGDCATFSFFGNAIIDDDLAAKMRLLRGQGMDPNRRYWFPIVGFNYRMTNIQAAI
3bcbA           SSKCMHLIQQGARVGRIDAFVQSLDNFMVGGAIIAGFNEPFIQDISKMYPGRASASPSLDVLITLLSLGC
3e77B           SPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYAGNSSLYNTPPCFSIYVMGLVLE
3ecdA           -----VIAAGRHANPVEHAHVVTSTTHKTLRGPRGGFVLTNDEEIAKKINSAVFGPLM--HVIAGKAVAF
1cl1A           AGVLFKALDFG-----IDVSIQAATYLVDAMIGTAVCNARCWEQLRENAYLMGQMVDADTAYITSRGLRT
3b46B           YFTDSFTRIATLSPEIGQLTLTSFAATGWRIGWVLSLNAELLSYAAKAHTRICFASPS-PLQEACANSIN
2egyD           YFGEARLPSLFELAREAGYPGVIYVLSPGLRVAFAVAHPEALQKLVQAKQGADLHTPMLNQMLVHELLKE
1ajsA           ASGNLEKDAYFVSEGFELFCAQSFSKNFGLYNGNLTVVAKEPDSILRVLSQMPPAQGARIVARTLSDPEL
3eiaB           MSDDNPRSIFEIPGAEEVAMEASFSQYAGFTGVRLGWTVIPKKLLYSDGFPVATCFNGASNISQAGALAC
2dgmC           LAPFVAPDIVWDFRLPRVKSISSGHKFGLAPLGCGWVIWRDEEALPQELVFNVDYLSRPAGQVIAQYYEF
3ei6A           MSDDNPRSIFEIPGAEEVAMETSFSKYAGFTGVRLGWTVIPKKLLYSDGFPVATCFNGASNISQAGALAC
1arsA           ARGLEEDAEAFAAMHKELIVASSYSKNFGLYNGACTLVAADSETVDRAFSQMAIRANYSNPPAHGASVVA
2dr1A           GAD--IKFDKWGLDVVFSSSQKAFG-VPPGLAIGAFSERFLEIAEVKYLKEKESTPSTPPMPQVFGINVA
3dxvB           LARSGRLHCFEHEGFVPDILVLGKGLGGGLPLSAVIAPAEILDCASAFAMQTLHGNPISAAAGLAVLETI
1bqaA           ARGLEEDAEGLRAFAAMHKELISSYSNFGLYNGACTLVAADSETVDRAFSQMKAARANYSNPPAHGASVV
3bc8A           SSKCMHLIQQGARVGRIDAFVQSLDNFMVGGAIIAGFNEPFIQDISKMYPGRASASPSLDVLITLLSLGC
1aheA           ARGLEEDAEGLRAFAAMHKELISYSKNFGLRVGACTLVAADSETVDRAFSQAAIRANYSSPPAHGASVVA
3ei9B           MSDDNPRSIFEIPGAEEVAMETSFSNYAGVRLGWTVIPKKLLYSDGFPVAKDFTCFNGASNISQAGALAC
1ay4A           GDGLEEDAAGTRLIASEVLIAASCSKNFGIYRGCLLALCADAATRQGAMAFLNRQTYSFPPFHGAKIVST
3cq5A           SPSPSATT-LLEKYPTKLVVSRTMSKAFDFAGGRLGYFVANPAFIDAVMLVRLPYHLSALSQAAAIVALR
1ax4A           NAYFIKARDPKYKNAEVIFDMYKYADALTMSAKDPLLNIGGLVAIRDNEEIFTLARTYGGLAGRDMAAMV
2egyC           YFGEARLPSLFELAREAGYPGVGSFSKVLSPGLRVAFAVAHPEALQKLVQAKQGADLHTPMLNQMLVHEL
2ctzA           GYL------LRPLAWGAALVTHSLTKWVGGHGAVI-----------------------------------
3bn1A           A-----TYRGKKSGSLGDCATFSFFGNIITTGEGGMITRLLRGQGMDPNRRYWFPIVGFNYRMTNIQAAI
1c0nA           HH-PVDVQALDCDFYVFSGHKLYGPTGIGILGSMIATVSLSEGTTWTKAPWRFEAGTPNTGGIIGLGAAL
1cs1A           ALQNPLA---LGADLVLHSCTYLNGHSDVVAGVVIAKDPDVVTELAWWANNIGVTGGAFDSYLLLRGLRT
1czcA           ARGLEEDAEGLRAFAAMHKELISYSKNFGLRVGTCTLVAADSETVDRAFSQMKAARVNYSSPPAHGASVV
3ecdB           IAAGRHANPVEHA----HVVTSTTHKTLRGPGFVLTNDEEIAKKINSAVFPGPLMHVI-----AGKAVAF
2c44C           NAYFIKQREQITRETYKYADMLAMSAKKDAMVGLLCMKDDSFFDVYTECRTLCVVQEGFPTYGGLEGGAM
3e2fA           VYTGHTHVKIATLPGMWERTITIGFSVTGWKLGWSIGPAHLIKHLQTVQQNSFYTCATPLQAALAEAFWI
3bv0B           FGRTGALFAADHAGVSP--DIMCVGKALTGGYLSLAATLCTADVAHTISAGPTFMANPLACAVSVA----
1akaA           ASGDINRDAWALRHFIDVVLSQSYAHNMGLRAGAFTVICRDAEEAKRVESQLKILIMYSNPPMNGARIAS
3b8xA           ATFNNKCA-GTFGLMGTFSSFYSNHIATMEGGCIVTDDEEIYHILLCIRAHGWTRNLP-----KKNKVTG
2d5yA           ARGLEEDAEGLRAFAAMHKELSSYSKNFGLYNGACTLVAADSETVDRAFSQAAIRVNYSSPPAHGASVVA
1b9iA           ARWQ-GKRVGELDSIATFSFQNGKLMTAGEGGAVVFPDGETEKYETAFLRHSCGRPRDSVLRAQLARLDE
1b4xA           ARGLEEDAEAFAAMHKELIVASSYSKNFNERVGACTLVAADSETVDRAFSQAAIRANYSNPPAHGASVVA
1asbA           ARGLEEDAEGLRAFAKELIVASSYSKNFNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASV
3e9kA           NYLNAGAGGIAGAFIHEKHAHTIKPALVGWFGHELSTRFKMDNKLQLIPGVCGFRINPPILLVCSLHASL
3dr4B           ATYRGKKS-GSLGDCATFSFIITTGEGNDDDLAAKMRLLRGQGMDPNRRYWFPIVGFN--YRMTNIQAAI
3bwnD           HYTPITRRQDH------DIMLFTFSKITSRIGWALVKDKEVAKKMVEYIIVNSIGVSKESQVRTAKILNV
3b46A           YFTDSFTRIATLSPEIGQLTLTSFAATGWRIGWVLSLNAELLSYAAKAHTRICFASPS-PLQEACANSIN
3bcaA           SSKCMHLIQQGARVGRIDAFVQSLDNFMVGGAIIAGFNEPFIQDISKMYPGRASASPSLDVLITLLSLGC
2bkwA           CEEFEAPAGLSISLCSSRFDYALNDSKNGHVHGYFSSLRRWTPIENYEAGKGAYFATPPVQLINSLDVAL
2a0yA           IVARHCGLRV------FGFSLITNKVIMDYESLEKANDEEVLAAGKQAAQKL------------------
3d6kB           TLSDEFPIVAQAAGNPNRFWFSSTSKITGSGVSFFASSKENIEWYASHANVRGIGPN-----KLNQLAHA
2d66A           ARGLEEDAEAFAAMHKELIVASSYSKNFGLYNGACTLVAADSETVDRAFSQAAIRVNYSSPPAHGASVVA
1bjoA           SRPIDVSRYGVIYAGAQKNIGPAGLTIVIVREDLLGKANIACPSILDYSILNDNGSMFNTPPTFAWYLSG
3bv0A           FGRTGALFAADHAGVSPD--IMCVGKALTGGYLSL--AATLCTADVAHTISAGPTFMANPLACAVSVASV
1bw0B           VFKGKDPNAVADFETTVPRVILGGTANLVVPGGWLLYVDPHGNGPSFLEGLKRVGMLVCGPCTVVQAALG
3b8xB           ATFNNKCA-GTFGLMGTFSSFYSNHIATMEGGCIVTDDEEIYHILLCIRAHGWTRNLPKKNKVTGVKSDD
2cy8A           RVGNHGMQALLDV----QPDLTCLAKASAGGLPGGILGGREDVMGVLSRGSFTGNPITAAAAIAAIDTIL
2egyB           YFGEARLPSLFELAREAGYPGVIYVLSPGLRVAFAVAHPEALQKLVQAKQGADLHTPMLNQMLVHELLKE
3dr4D           ATYRGKKSGSLGDCATGEGGMITTNDDDLAAKMRLLRGQGMDPNRRYWFPIVGFNYRMTNIQAAIGLAQL
3ecdC           IAAGRHANPVEHAHV----VTSTTHKTLRGPRGGFVLTNDEEIAKKINSAVGPLMHVI-----AGKAVAF
3d6kC           TLSDEFPIVEFAQAAGNPNRFWSTSKITGSGVSFFASSKENIEWYASHANVRGIGPNQLAHAQFFGDVAG
1b8gA           AFSSPSFISVMENSEVWQRVHVVYSLSPGFRVGAIYSNDDMVVAAATKMSSFGLVSSQTQHLLSAMLSDK
1agxA           FVLRNAEQPDDKYGWIA-AHDLNPQKARLLMATKTNDAKEIQNMFWNY----------------------
2a7vA           VAAKVIPSPFKHADIV----TTTTHKTLRGARGLIFYRKGVKAVDPKTGREIPYTFEDHNHAIAAVAVAL
3bigA           IEAGKVLRLGDMARSDNVIFSATGIT----KGDLLEGISRKGNIA--TTETLLIRGK-------------
1b9hA           ARWQ-GKRVGELDSIATFSFQNGKLMTAGEGGAVVFPDGETEKYETAFLRHSCGRPR-------------
1bqdA           ARGLEEDAEGLRAFAAMHKVASSYSNLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASV
2cb1A           GALCRPLAWGA------HVVVESLTWASSVLGGAVLSRETELWRNYPQFLQPWEALR-------------
3d19E           DYFRKRLIQLNEGKLDALAIIKENVFFLRIMADHAKFIGHLLDPSERKLVDTARNFS-------------
3dc1A           LQFNKFRVPTFLSMDVDGRVIRADSFSIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQL
2d64A           ARGLEEDAEGLRAFAAMHKELISYSKNFGLYNGACTLVAADSETVDRAFSQAAIRVNYSSPPAHGASVVA
3cogB           PYFQRPLALGAD------ISMYSATKYMNGHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPIDCYLCN
2d61A           ARGLEEDAEGLRAFAAMHKELIVASSLYNERVGACTLVAADSETVDRAFSQMKAAIRVNYSSPPAHGASV
3d6kA           LSDEFPIVHNVIEFAQAAFWFSSTSKITGSGVSFFASSKENIEWYASHANVRGIGPNQLAHAQFFGDVAG
1awiA           AAVPGKTFVNITPA-EVGVLVGKDRSSFYVNGLTLGGQKCSRDSLLQDGEFSMDLRTK--STGGAPTFNV
3d6kD           TLSDEFPIVAAGNPNRFWFSSTSKITHAGSGVSFFASSKENIEWYASHANVRGIGPNQLAHAQFFGDVAG
3caiA           YRLLDIRETDA------DVVTVNAHAWGGPPIAMVFRDPSVMNSFGSVSTNPYATGPARLEIGVHQFGLL
3du4A           RTG--KMFACEHENVQPD--LMAAGKGITLPIAVTFATEDIYKAFYDDYENLFFHGHSYTGNQLGCAVAL
3bwnB           HYTPITRRQDHD------IMLFTFSKITGHAGSALVKDKEVAKKMVEYIIVNSIGVSKESQVRTAKILNV
1ajrA           ASGNLEKDAWAIRYFVSELFCAQSFSNFGLYNENLTVVAKEPDSILRVLSQMQKIRVTWSNPPAQGARIV
7aatA           ASGDINRDAWALRHFIDVVLSQSYAKNMGLYGGAFTVICRDAEEAKRVESQLKILIRPMYSNPPMNGARI
3ecdD           IAAGRHANPVEHA----HVVTSTTHKTLRGPRGGFVLTNDEEIAKKINSAVGPLMHVI-----AGKAVAF
2c44A           NAYFIKQREAEYKDWTIEQITRETYKYADMLAGLLCMKDDSFFDVYTECRTLCVVQEGFPTYGGLEGGAM
3d19A           DYFRKRLIQLNEGKLDALAIIKENVFFLRIMADHAKFIGHLLDPSERKLVDTARNFS-------------
3e6gD           MLQRPLS-------LGADLVVHSATKYLNGHSDMV-----------------------------------
1eghA           I---------------------------------------------------------------------
3e6gB           MLQRPLS-------LGADLVVHSATKYLNGHSDMV-----------------------------------
3eh2A           ----------------------------------------------------------------------
3dc1B           QFNKFRVPTFLSMDVDGRVIRADSFSSSGLRIGFLTGPKPLIERVILHIQVSTLHPST-----FNQLMIS
2btwB           IEDFRKQVAENLKQDGNFVIVNYLRKEIGQERGGHIS---------------------------------
2c44B           NAYFIKQREAEYKDWTIEQITRETDAMVPMGGLLCMKDDSFFDVYTTLCVVQEGFPTYGGLEGGAMERLA
3dc1D           LQFNKFRVPTFLSMDVDGRVIRADSFSIISSGGFLTGPKPLIERVILHIQVSTLHPS-----TFNQLMIS
3bwnA           RQD-------------HDIMLFTFSKITGHAGWALVKDKEVAKKMVEYIIVNSIGVSKESQVRTAKILNV
3bwoA           HAGSRIGWVKDKEVAKKMVEYIIVNSIGVSKESQVRTAKILNVLKETCKSESESENFFKYGREMMKNRWE
2btwA           IEDFRKQVAENLKQDGNFVIVNYLRKEIGQERGGHIS--PLAAYNEQTDRFL------------------
1btcA           GWEFPRIGEFQCYDKYLKADFKAAVARAGHPEWELPDDAGKYNDV-------------------------
3cogD           PYFQRPLALGA------DISMYSATKYMNGHSDVVMGLVSVNCESLHNRLR-------------------
1c8nA           DKAWYSTIGTAAFAALTAFDQNCPCTVHIGSDAVAVPPGDIFF---KYVIELIEPIN-------------
1b93B           I---------------------------------------------------------------------
1bybA           LGPAGELRYPSYPQSQGWEFPRIGEFQCYDKYLKADF---------------------------------
3bh1C           ---------CDVHTT----TILGSVDIFRNLGVLVTSDPKFQ----------------------------
3drdB           RTG--KMFACEHENVQPD--LMAAGKGITLPIAVTFATEDIYK---------------------------
3dodB           RTG--KMFACEHENVQPD--LMAAGKGITLPIAVTFATEDIYK---------------------------
3dodA           RTG--KMFACEHENVQPD--LMAAGKGITLPIAVTFATEDIYK---------------------------
3bwnF           HYT------PITRRQDHDIMLFTFSKITGHAGSALVKDKEVAKKMVEYIIVNSIGVSKESQVRTAKILNV
2bhgA           RLIFSGEALTYKDVVTPGLFAYKAATRAGYAGGAVLAKDGADTF--------------------------
3e6gA           M---------------------------------------------------------------------
2b34A           ----------------------------------------------------------------------
2dbnA           ------------------------------------------------ASTFTSDTLPADHKAAIRQMKH
3bh1A           C---------------------------------------------------------------------
3c01F           LFKTHRRYD-------------------------------------------------------------
3c01E           LFKTHRRYD-------------------------------------------------------------
3bmaD           GYV----------NYDKHVAKYILPDQFSYQA--------------------------------------
2bu3A           ----------------------------------------------------------------------
3bh1D           CDVH------------------------------------------------------------------
3bwoC           I---------MLFTFS------ITGHAGSRIGWALVKDKEVAKKMVEYIIVNSIGVSKESQVRTAKILNV
1dy2A           NNWDSIFSGDG-----------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           XVIRSDEGGERREKLAALVQRFRAGVNASRFTLLNAHSAIQPLIVGDNSRALRLAEALRQQGCWATAIRP
3a2bA           EIIQNEPE--HIEKLWKNTDYAKAQLLDHGFDLGATESPILPIFIRSNEKTFWVTKMLQDDGVFVNPVVS
1bs0A           AVIRSDEGDARREKLAALITRFRAGVQDLPFTLADSCSAIQPLIVGDNSRALQLAEKLRQQGCWVTAIRP
1djeA           AVIRSDEGDARREKLAALITRFRAGVQDLPFTLADSCSAIQPLIVGDNSRALQLAEKLRQQGCWVTGIRP
2bwpB           AFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHGSHIVPVVIGDPVHTKAVSDMLSDYGVYVQPINF
2bwoD           AFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHGSHIVPVIGDPVHTKAVSDMLLSDYGVYVQPINF
2bwnD           AFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHGSHIVPVIGDPVHTKAVSDMLLSDYGVYVQPINF
2bwpA           AFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHGSHIVPVIGDPVHTKAVSDMLLSDYGVYVQPINF
2cdmA           ---------KTSVDREALRAEWQATAKELGIDF-------------------------------------
2bwoB           AFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHGSHIVPVIGDPVHTKAVSDMLLSDYGVYVQPINF
2bwnB           AFLKTAEGQKLRDAQQMHAKVLKMRLKAGMPIIDHGSHIVPVVIGDPVHTKAVSDMLLSDYGVYVQPINF
2bwnA           AFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHGSHIVPVIGDPVHTKAVSDMLLSDYGVYVQPINF
2bwoA           AFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHGSHIVPVIGDPVHTKAVSDMLLSDYGVYVQPINF
2bwnE           AFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHGSHIVPVIGDPVHTKAVSDMLLSDYGVYVQPINF
1d2fB           YQQGAPWLDALRIYLKDNLTYIADKMNAAFPELNWQIPQAWLDLRPLNIDDNALQKALIEQEKVAIMPGY
1d2fA           YQQGAPWLDALRIYLKDNLTYIADKMNAAFPELNWQIYLAWLDLRPLNIDDNALQKALIEQEKVAIMPGY
1dfoB           ALKEAMEPETYQQQVAKNAKAMVEVFLERGYKVVTDNHLFLVDLVDKNLTGKEADAALGRANITVNKNSV
1djuA           DERSWKAVEEMRKEYDRRRKLVWKRLNEMGLPTVKPKGAIFPRIRDTGLTSKKFSELMLKEARVAVVPGS
1ecxA           MEIAVEELSEAAKHMEKLRSKLVSGLMNLGAHIITPLEISLPNTLSPNIRGSTLQNLLSGYGIYVSTHVL
1b5pA           EALTNQEASRAFVEMAREAYRRRRDLLLEGLTALSGAFYVLMDTSPIAPDEVRAAERLLEAGVA---VVP
2c7tA           KKGDIQELDDKNAIREKNAMFLNDALSKIDGIKVMKRPPRFDPVKFGGLNADQFCEILREKLNMGTFYLH
2douB           LKTPKEVVRGYARVYRERALGMAEALKGVLSLLPPRATMYLWGRLPEGVDDLEFGLRLVERGVALAPGR-
1bjwA           QEASRAFVEMAREAYRRRRDLLLEGLTALKAVRPSGAFYVLMDTSPIAPDEVRAAERLLEAGV---AVVP
2bhxB           WIKDLGGAEAIAKQNEEKAKIIYDTIDESNGFYVGRSLMNVTFNLRNEELNQQFLAKAKEQGF---VGLN
1eg5B           RAEIAVEELSEAAKHEKLRSKLVSGLNLGAHIITPLEISNTLSVSFPNIRGSTLQNLLSGYGIYVSTRHV
2bieB           WIKDLGGAEAIAKQNEEKAKIIYDTIDESNGFYVGRSLMNVTFNLRNEELNQQFLAKAKEQGF---VGLN
1ecxB           MEIAVEELSEAAKHMEKLRSKLVSGLMNLGAHIITPLEISLPSVSFPNIRGSTLQNLLSGYGIYVSTRHV
1eg5A           EIAVEEL--SEAAKHEKLRSKLVSGLNLGAHIITPLEISNTLSVSFPNIRGSTLQNLLSGYGIYVSTHVL
1dfoA           KEAMEPEFKTYQQQVAKNAKAMVEVFLERGYKVVSGGTDNHLFLVDKNLTGKEADAALGRANITVNKNSV
3e77A           WIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVSKMNIPFRIGNAKGDDALEKRFLDKALELNMLS
2dgmB           VILGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPDPGYTLYDLSERLRLRGWQVPAFTL
2byjA           EVLEEENLAENADKLGIILRNELMKLPSDVVTAVRGKGLLNVIKETKDWDAWKVCLRLRDNGLL------
1djuB           LKDERSWKAEMRKEYDRRRKLVWKRLNEMGLPTVKPKGAIFPRIRDTGLTSKKFSELMLKEARVAVVPGS
2cfbA           -ILSRPGSYEHDRITGKLVQGLLDAAREFGHEVCGGHISGMFGLTAGPVTNYEQAKQSDLKKFAAFMLEQ
2douA           LKTPKEVVRGYARVYRERALGMAEALKGVLSLLPPRATMYLWGRLPEGVDDLEFGLRLVERGV---ALAP
2c81A           KKGDIQELDDKNAIREKNAMFLNDALSKIDGIKVMKRPPRFDPVKFGGLNADQFCEILREKLNMGTFYLH
2dkjA           FFEALQPEFKLVVENAKRLAEELARRGYRIVTGGTDNHLFLVDLRPKGLTGKEAEERLDAVGITVNKNAI
3bb8A           SHLGYERIEEFVEKRKANFKYLKDALQSCADFIESWFGFPITLKEDSGVSRIDLVKFLDEAKVGTRLLFA
1ay4B           VLTTPELRADWMAELEAVRSGMLRLREQLAGELRDLSGSDRFGFVAEH-RGMFSRLGATPEQVKRIKEEF
3dzzB           AAYEEGHDWELKQVLRDNFAYAREFLAKEVPEVKVLDSYLAWVDISALGNAEDFCKYLREKTGLIISAGN
1bkgA           EALTNQEASRAFVEMAREAYRRRRDLLLEGLTALSGAFYVLMDTSPIAPDEVRAAERLLEAG---VAVVP
5bj4A           ALTNQEASRAFVEMAREAYRRRRDGLTALGLKAVRPSGAFYMDTSPIAPDEVRAAERLLEAGV---AVVP
3dydA           KSILCRTPGETLSFLKSNADLCYGALAAIPGLRPVRPSGIEMEHFPEFENDVEFTERLVAEQSV--HCLP
3dzzA           AAYEEGHDWELKQVLRDNFAYAREFLAKEVPEVKVNASYLAWVDISALGNAEDFCKYLREKTGLIISAGN
3dydB           KSILCRTPGETLSFLKSNADLCYGALAAIPGLRPVRPSGIEMEHFPEFENDVEFTERLVAEQSV--HCLP
3cq6A           HS---ADTLGTVEKLSVERVRVAARLEELGYAVVPSESN--FVFFGDFSDQHAAWQAFLDRGVLIRDVGI
1bjnA           WLKANGGVAEMDKINQQKAELLYGVIDNSDFYRNDVAKRNVPFQLADSALDKLFLEESFAAGL---HALK
3e77C           VLEWIKNNGAMEKLSSIKSQTIYEIIDNSQGFYVNRSKMNIPFRIGNAKGDDALEKRFLD-KALELNMLS
1b5oA           EALTNQEASRAFVEMAREAYRRRRDLLLEGLTALSGAFYVLMDTSPIAPDEVRAAERLLEAGV---AVVP
1ay5B           TVLTTPELRADRSGMLRLREQLAGELRDLSGSDRFGFVAEHRGMFSRLGATPEQVKRIKEEFGIYM----
3cq4B           HS---ADTLGTVEKLSVERVRVAARLEELGYAVVPSESNFVFFGDQH-----AAWQAFLDRGVLIRDVGI
2dgmE           VILGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRKLKDGEDPGYTLYDLSERLRLRGWQVPAFTL
3cq4A           HS---ADTLGTVEKLSVERVRVAARLEELGYAVVPSESNF--VFFGDFSDQHAAWQAFLDRGVLIRDVGI
1ejiA           LKQATTEFKIYQLQVLANCRALSDALTELGYKIVTSDNHLILDLRSKGTDGGRAEKVLEAIACNKNTCPG
3bcxA           YSHLGERIEEFVEKRKANFKYLKDALQSTENSDPSWFGFPITLKEDSGVSRIDLVKFLDEAKVGTRLLFA
3bn1C           GLAQLERVDEHLAARERVVGWYEQKLARLGNRVTVFWMYTVRLGEGLSTTRDQVIKDLDALGIESRPVFH
2cstA           IVATTLTSPQLFAEWKDNVKTMADRVSLGTPGTWNHITDQIGMFSFTGLNPKQVEYMIKEKHIYLMAGRI
5bj3A           EALTNQEASRAFVEMAREAYRRRRDLLLEGLTALSGAFYVLMDTSPIAPDEVRAAERLLEAGV---AVVP
2c0rA           WIEERGGLEGVQQANRKKASLIYDAIDQSCVDVDSRSDMNITFRLASEELEKEFVKASEQEGFVG-----
2aevA           KNFNLERIRKAFERAKNFDLSKIEKLNKELKAIDDNIKRVYKDDTINIKKLIEIGFNLLKNYGII-TITV
3cq5B           HS---ADTLGTVEKLSVERVRVAARLEELGYAVVPSESNF--VFFGDFSDQHAAWQAFLDRGVLIRDVGI
2e7jA           TLMASFPHVKRWDEEVEKARRFAAEMEKLGIKQLGDNPHNHDLMFFHAEVLYEISKKAKGGRRELKSRKI
2aeuA           FNLERIRKARAKNFDLSKIEKLNKELKAIDDNINIVYIKRVYKDDTINIKKLIEIGFNLLKNYGIITITV
1asfA           VATIEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQGMFSFSGLTKEQVLRLREEFG---VYAVA
3eiaA           TPEGLEAMHKVIGFYKENTNIIIDTFTSLGYDVYGGKAPYVWVHFPNQSSWDVFAEILEKTH---VVTTP
3bs8A           LKQLTPDSYKFIKKGDRLEEGISKAAEAHGIPHTFNRAGSMIGFFVINYETAKASDLKLFASYYKGMANE
1ariA           ATILSNDLTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQGMFSFSGLTKEQVLRLREEFGVYAVRVNV
1cl1B           LGVRLRQHHESSLKVAEWLAEHPQVFWKRDFTGSSGLFSFVLKKKLNNEELANYLDNFSLFSMAYSWGGY
3ei7B           LTPEGLEAHKVIGFYKENTNIIIDTFTSLGYDVYGKNAPYVWVHFPNQSSWDVFAEILEKTHVV---TTP
3e2yA           DIKRMDDPECYFNSLPKELEVKRDGGYFIIADVSSLGADLSDMNSDEPYDYKFVKWMTKHKKLTAIPCDS
2bylA           EVLEEENLAENADKLGIIL-RNELMKLPSDVRGKGLLNAIVI-KETKDWDAWKVCLRLRDNGLL------
1c7gA           AIGLREAMYEYIEHRVKQVRYLGDKLREAGVPIVEPTGGCPHLTQDQFPAQSLAASIYMETGVRSMKETG
1c4kA           AMQEGEAGRKLWHDLLITTIEARKKLIKAGSMFRPFVPPVVNGKKWEDGDANNIDYWRFEKGAKWEGYGD
2bieA           NVLDWIKDLGGAEAIAKQNEEKAKGFYVGHAEKGSRSLMNVTFNLRNEELNQQFLAKAKEQGF---VGLN
3bcxB           GLAQLERIEEFVEKRKANFKYLKDALEATENSDPSWFGFPITLKEDSGVSRIDLVKFLDEAKVGTRLLFA
3ei7A           ACLTPEGLEAVIGFYKENTNIIIDTFTSLGYDVYGGKNAYVWVHFPNQSSWDVFAEILEKTHVV---TTP
3ei8A           GALACLTPEGVIGFYKENTNIIIDTFTSLGYDVYGGKNAPYVWVFPNQSSWDVFAEILEKTH---VVTTP
2dgkC           VILGREGYTKVQNASYQVAAYLADEIAKRPDEGIPAVCFKLKDGEDPGYTLYDLSERLRLRGWQVPAFTL
1bj4A           KQAMTLEFKVYQHQVVANCRALSEALTELGYKIVTGGSDNHLILVGTDGGRAEKVLEACSIACNKNTCPG
1cj0A           IAAMTPEFKEYQRQVVANCRALSAALVELGYKIVTGGSDNHLILVSKGTDGGRAEKVLEACSCNKNTCPG
1dgdA           DVVQRDGLVARANVMGDRLRRLMERFDCGRGLLLGVEIKDRRTKEPADGLGAKITRECMNLGL---SMNI
2dgkA           LRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPDPGYTLYDLSERLRLRGWQVPAFTL
2ch2A           AQIAEEGLENQIKRRIECAQILYEGLGKMGLDIFVLPTVTGIMIPKGVDWWKVSQYAMNNFSLEVQGGLG
2aatA           TILSNDALTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGTKEQVLRLREEFGVYAVASGR
3dr7B           GLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPHVYTVRLGEGLSTTRDQVIKDLDALGIESRPVFH
2e54A           ELTKEGFLEEVEEKGNYLMKKLQEMKEEYDVADVRGMGLMIGIQFREEVSNREVATKCFENKLL------
3drdA           ENLALFESENIVEQVAEKSKKLHFLLQDLHALPHVGDIRQLGFMCGETKEPYPADRRIGYKVSLKMRELG
1cj0B           KQAMTPEFKEYQRQVVANCRALSAALVELGYKIVTGGSDNHLILVSKGTDGGRAEKVLEACSCNKNTCPG
2cinA           -ILEVIEAEGLFERAVQHGKYLRARLDELAADFPAVVLDPRGFSLPTTADRDELIRQLWQRAVI------
2e7uA           LELLEENPGRLEAGLKEVLKEKGLPHTVNRVGSMGPVVTFQDARRTDTELFKRFFHGLLDRGIY------
2dr1B           RIIEKMGGKEKLEMYEKRAKMVREGVREIGLDILHESPTITAVLTPPGIKGDEVYEAMRKRGF---ELAK
1b8gB           SDKKLTKNYENHKRLKQRQKKLVSGLQKSGISCLNWVDMRHLLRSNTFEAEMELWKKIVYEVHLNISPGS
1e5eB           LNIRMKAESENAMKVAEYLKSHPAVEKVYYPGFRMYGSMITFILKSGFEGAKKLLDNLKLITLAVSLGGC
2dgmA           VILGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPDPGYTLYDLSERLRLRGWQVPAFTL
1e5eA           LNIRMKAESENAMKVAEYLKSHPAVEKVYYPGFEDYGSMITFILKSGFEGAKKLLDNLKLITLAVSLGGC
3bn1D           GLAQLERVDEHLAARERVVGWYEQKPHVALTGRHVFWMYTVRLGEGLSTTRDQVIKDLDALGHLATDDLK
2ch1A           AQIAEEGLENQIKRRIECAQILYEGLGKMGLDIFVKDPRVTGIMIPKGVDWWKVQYAMNNFSLEVQGGLG
1bw0A           LNTPQEHLDQIVAKIEESAMYLYNHIGECIGLAPTMPRGDLEKYRDIKTDVEFFEKLLEEEN---VQVLP
3dr4A           GLAQLERVDEHLAARERVVGWYEQKLARALTGRHVFWMYTVRLGEGLSTTRDQVIKDLDALGIESRPVFH
2eh6A           DEV-----EKLLPHVREVGNYFKEKLKE----LGKGKVKGRGLMLGLERECKDYVLKALEKGLLI-----
1aiaA           VATIEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQGMFSFSGLTKEQVLRLREEFGVYAVASGR
3aatA           TILSNDALTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGTKEQVLRLREEFG---VYAVA
1arhA           TILSNDALTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGTKEQVLRLREEFGVYAVA---
1aamA           VAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGTKEQVLRLREEFG---VYAVA
1d7uA           DVVQRDGLVARANVMGDRLRRDCIGDVRGRGLLLGVIVKDRRTKEPADGLGAKITRECMNLGL---SMNI
1dtyA           AANASLESGDWQQQVADIEVQLREQLAPARDAEMVADGAIGVVETTHPVNMAALQKFFVEQGVW------
1c7nA           YKECGKWLDGCIKVIDKNQRIVKDFFEVNHPEIKEGTYLQWIDFRALKMDHKAMEEFMIHKAQIFFDEGY
3ei6B           LTPEGLEAHKVIGFYKENTNIIIDTFTSLGYDVYGGKNAPYVWVFPNQSSWDVFAEILEKTH---VVTTP
3cbfA           LKEGFSERLERREKAQAMLHALDREVPKEVRYTRPKGGMFVWMELPKGLSAEGLFRRALEENVAVPGGPF
3dxvA           TIDRDDLPAMAERKGRLLRDGLSELIRGRGLACGMELVCDRQSREPARAETAKLIYRAYQLG-----LVV
3ei9A           LTPEGLEAMHVIGFYKENTNIIIDTFTSLGYDVYGGKNAPYVWVFPNQSSWDVFAEILEKTH---VVTTP
3dr4C           GLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPHFWMYTVRLGEGLSTDQVIKDLDALGIESRPVFH
3bcbA           SGYRKEMFVYLSTQLKKLAEAHNERLLQTPHNPISLAMTLKTIDGHHDKAVTQLGSMLFTRQVSGARAVP
3e77B           WIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSFRIGNAKGDDALEKRFLDKALELNMLS
3ecdA           GEALTDDFKTYIDRVLANAQALGDVLKAGGVDLVTDNHLLLVDLRPKGLKGAQVEQALERAGITCNKNGI
1cl1A           LGVRLRQHHESSLKVAEWLAEHPQVFWKRDFTGSSGLFSFVLKKKLNNEELANYLDNFSLFSMAYSWGGY
3b46B           DALKIGYFEKMRQEYINKFKIFTSIFDELSKVKIPEDYPYPEEILNKGKDFRISHWLINELGVVAIPPTK
2egyD           GFSERLERVRRREKAQAMLHALDREVPKEVRYTRPKGGMFVWMELPKGLSAEGLFRRALEENVAVPGGPF
1ajsA           FHEWTGNVKTMADRILSMRSELRARLEALKTPGTWNHITDQGMFSFTGLNPKQVEYLINQKHIYLLPSGR
3eiaB           LTPEGLEAMHVIGFYKENTNIIIDTFTSLGYDVYGGKNAYVWVHFPNQSSWDVFAEILEKTHVV---TTP
2dgmC           LRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPDPGYTLYDLSERLRLRGWQVPAFTL
3ei6A           LTPEGLEAMHVIGFYKENTNIIIDTFTSLGYDVYGGKNAPYVVHFPNQSSWDVFAEILEKTH---VVTTP
1arsA           TILSNDALTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGTKEQVLRLREEFG---VYAVA
2dr1A           LRIIEKMGGKWLEMYEKRAKMVREGVREIGLDILAESPTITAVLTPPGIKGDEVYEAMRKRGF---ELAK
3dxvB           DRDDLPA--MAERKGRLLRDGLSELAKRHPLIGDIELVCDRQSREPARAETAKLIYRAYQLGLVV-----
1bqaA           ATILSNDALDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQGMFSFSGLTKEQVLRLREEFGVYAVASGR
3bc8A           SGYRKEMFVYLSTQLKKLAEAHNERLLQTPHNPISLAMTLKTIDGHHDKAVTQLGSMLFTRQVSGARAVP
1aheA           TILSNDALTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQGMFSFSGLTKEQVLRLREEFGVYAVASGR
3ei9B           LTPEGLEAMKVIGFYKENTNIIIDTFTSLGYDVYGGKNAPYVWVFPNQSSWDVFAEILEKTH---VVTTP
1ay4A           VLTTPELRADWMAELEAVRSGMLRLREQLAGELRDLSGSDRFGFVAEH-RGMFSRLGATPEQVKRIKEEF
3cq5A           HSADTL---GTVEKLSVERVRVAARLEELGYAVVPSESNF--VFFGDFSDQHAAWQAFLDRGVLIRDVGI
1ax4A           QGLEEGTEEEYLHYRIGQVKYLGDRLREAGIPIQYPTGGVPQIPGDQFPAQAVINALYLESGVRAVEITG
2egyC           LKEGFSERLERREKAQAMLHALDREVPKEVRYTRPKGGMFVWMELPKGLSAEGLFRRALEENVAVPGGPF
2ctzA           ----------------------------------------------------------------------
3bn1A           GLAQLERVDEHLAARERVVGWYEQKLARLGNRVTVFWMYTVRLGEGLSTTRDQVIKDLDALGIESRPVFH
1c0nA           EYVSALGLNNIAEYEQNLMHYALSQLESVPDLTLYQARLGVIAFNLGAHHAYDVGSFLDNYGIAVRTGHH
1cs1A           LVPRMELAQRNAQAIVKYLQTQPLSLPENQGHEIAFGAMLSFELDGDEQTLRRFLGGLSLFTLAESLGGV
1czcA           ATILGNDALDMRQRIQRMRQLFVNTLQEKGANRDFSFTIKQNGMFFFGGTKEQVLRLREEFG---VYAVA
3ecdB           GEALTDDFKTYIDRVLANAQALGDVLKAGGVDLVTGGHLLLVDLRPKGLKGAQVEQALERAGNKNGIPFD
2c44C           ERLYDGMNLDWLAYRIAQVQYLVDGLEEIGVVCVDAGKLLPHIPADQFPAQALACELYKVAGIRAVEITG
3e2fA           DIKRMDDPECYFNSLPKELEVKRDGGYFIIADVSSLGADLSDMNSDEPYDYKFVKWMTKHKKLTAIPVSC
3bv0B           -SVELLLGQDWRTRITELAAGLTAGLDTARVTDVRVCGAIGVIECDRPVDLAVATPAALDRGVW------
1akaA           LILNTPELRKEADRIISMRTQLVSNLKKEGSSHNWQHITDQGMFCFTGLKPEQVERLTKEFSIYMTRISV
3b8xA           VKSDDQFEESFKFVLPGYNVRPLEMSGAIGIEQLKKLPRFFIIKKDSGVIRKQLVENLNSAGIECRPIVT
2d5yA           TILSNDALTDMRQRIQRMRQLFVNTLQEKGANRDFSFTIKQNGMFFFGGTKEQVLRLREEFGVYAVRLNV
1b9iA           QIAVRDERWTLLSRLLGAIDGVVPQGGDVRADRNSHYMAMFRIPGLTEERRNALVDRLVEAGLPAFAAFR
1b4xA           TILSNDALTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQGMFSFSGLTKEQVLRLREEFG---VYAVA
1asbA           VAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGTKEQVLRLREEFGVYAVA---
3e9kA           EIFKQATMKALRKKSVLLTGYLEYLIKHNYGVVNHVEERGCQLTITFSVPNKDVFQELEKRGVVCDKRNP
3dr4B           GLAQLERVDEHLAARERVVGWYEQKLAVALTGRHVFWMYTVRLGEGLSTTRDQVIKDLDALGIESRPVFH
3bwnD           LKETCKSESESENFFKYGREMMKNRWEKLREVVGKSLESYPAFAWLGTKEETDLVSELRRHKVMSRAGER
3b46A           DALKIGYFEKMRQEYINKFKIFTSIFDELSKVKIPEDYPYPEEILNKGKDFRISHWLINELGVVAIPPTK
3bcaA           SGYRKEMFVYLSTQLKKLAEAHNERLLQTPHNPISLAMTLKTIDGHHDKAVTQLGSMLFTRQVSGARAVP
2bkwA           KEILEEGLHKRWDLHRESDWFKDSLVNGLQLTSVSRYPSAHGLTAVYVADPPDVIAFLKSHGVVIAGGIH
2a0yA           ----------------------------------------------------------------------
3d6kB           QFFGDVAGPKFERVLEILDSRLSEYGVAKWTSPTGGYFISVDVVPGTASRVVELAKEAGIALTGAGSSFP
2d66A           TILSNDALTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQGMFSFSGLTKEQVLRLREEFGVYAVRVNV
1bjoA           LVFKWLKANEMDKINQQKAELLYGVIDNSDFYRNDVAKRNVPFQLADSALDKLFLEESFAAGLHA-----
3bv0A           ELLLGQDWRTRITELAAGLT---AGLDTARVTDVRVCGAIGVIECDRPVDLAVATPAALDRGVW------
1bw0B           EALLQEHLDQIVAKIEESAMYLYNHIGECIGLAPTMPRGDLEKYRDIKTDVEFFEKLLEEEN---VQVLP
3b8xB           QFEELKKLPRFISVRRKNAEYFLDKFKDHPYLDVQWFGFSFIIKKDSGVIRKQLVENLNSAGIECRPIVT
2cy8A           EDDVCAKINDLGQFAREAMNHLFARKGLNYGRFSGFHLMPGLPPNTTDTGSITRAEVARPDVKMIAAMRM
2egyB           GFSERLERVRRREKAQAMLHALDREVPKEVRYTRPKGGMFVWMELPKGLSAEGLFRRALEENVAVPGGPF
3dr4D           EREHLAARERVVGWYEQKLARLGNKPHVALTGRHVFWMYTVRLGEGLSTTRDQVIKDLDALGIESRPVFH
3ecdC           GEALTDDFKTYIDRVLANAQALGDVLKAGGVDLVTGGHLLLVDLRPKGLKGAQVEQALERAGITNGIPFD
3d6kC           LKAHLKHAASLAPKFERVLEILDSRLSEYGVAKWTSPTGYFISVDVVPGTASRVVELAKEAGIALTGSFP
1b8gA           KLTK-NYIAENHKRLKQRQKKLVSGLQKSGIGLFCWVDMRHLLRSNTFEAEMELWKKIVYEVHLNISPGS
1agxA           ----------------------------------------------------------------------
2a7vA           KQACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDNHLVLVGLDGARAERVLELVSITANKNTCPG
3bigA           ----------------------------------------------------------------------
1b9hA           ----------------------------------------------------------------------
1bqdA           VAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQGMFSFSGLTKEQVLRLREEFGVYAVASGR
2cb1A           ----------------------------------------------------------------------
3d19E           ----------------------------------------------------------------------
3dc1A           LHEWGEEGFMAHDFYSNQKDAILAAADKWLTGLAEWHMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNA
2d64A           TILSNDALRAIRQRIQRMRQLFVNTLQEKGANRDFSFTIKQNGMFFGGLTKEQVLRLREEFGVYAVASGR
3cogB           RGLKTLHGMAVAQFLESNPWVEKVIYPGVKRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESGFES
2d61A           VATIEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSSGLTKEQVLRLREEFGVYAVASGR
3d6kA           LKAHLKHAASLAPKFERVLEILDSRLSEYGVAKWTSPTGYFISVDVVPGTASRVVELAKEAGIALTGSFP
1awiA           TVTKTDMGKEGVHGGLINKKCYEMA---------------------------------------------
3d6kD           LKAHLKHAASLAPKFERVLEILDSRLSEYGVAKWTSPTGYFISVDVVPGTASRVVELAKEAGIALTGSFP
3caiA           AGVVASIEYSADAYLNRVFDYLMVSLRSLPLVMLIEAQIPVVSFAVHKVPADRVVQRLADNGILAIANTG
3du4A           ENLALFESENIVEQVAEKSKKLHFLLQDLHAELVRSKETKEP-YPADRRIGYKVSLKMRELGML------
3bwnB           LKETCKSESESENFFKYGREMMKNRWEKAFCNYFGKSLESYPAFAWGTKEETDLVSELRRHKVMSRAGER
1ajrA           ARTLSDPELTMADRILSMRSELRARLEALKTPGTWNHITDQIGMFSFTGNPKQVEYLINQKHIYLLPSGR
7aatA           ASLWLVEVKGMADRIISMRTQLVSNLKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSIYMTRISV
3ecdD           GEALTDDFKTYIDRVLANAQALGDVLKAGGVDLVTGGTDNHLLLVPKGLKGAQVEQALERAGNKNGIPFD
2c44A           ERLYDGMNLDWLAYRIAQVQYLVDGLEEIGVVCQQAGGHAAFVDADQFPAQALACELYKVAGIRAVEIGG
3d19A           ----------------------------------------------------------------------
3e6gD           ----------------------------------------------------------------------
1eghA           ----------------------------------------------------------------------
3e6gB           ----------------------------------------------------------------------
3eh2A           ------------------------------FYMSNTTDVELAGLDGDKTVTVEFKHDNEESGALLQCALL
3dc1B           QLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTFLWIKVKGINDVKELIEEKAVKMGVLMLPGNA
2btwB           ----------------------------------------------------------------------
2c44B           VGLYDGMNLDWLAYRIAQVQYLVDGLEEIGVVCQQAGGHAAFVDAGQFPAQALACELYKVAGIRAVEITG
3dc1D           QLLHEWGEEGFMAHVDRVIDFYSNLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNA
3bwnA           LKETCKSESESENFFKYGREMMKPKYPEAFCNYFGKSLESYPAFAWLGTKETDLVSELRRHKVMSRAGER
3bwoA           KLREVVK---------ESDAFTLPKYPEAFCNYFGKSLESYPAFAWLTKEETDLVSELRRHKVMSRAGER
2btwA           ----------------------------------------------------------------------
1btcA           ----------------------------------------------------------------------
3cogD           ----------------------------------------------------------------------
1c8nA           ----------------------------------------------------------------------
1b93B           ----------------------------------------------------------------------
1bybA           ----------------------------------------------------------------------
3bh1C           ----------------------------------------------------------------------
3drdB           ----------------------------------------------------------------------
3dodB           ----------------------------------------------------------------------
3dodA           ----------------------------------------------------------------------
3bwnF           LKETCKSESESENFFKYGREMMKNRWEKLREVVFGKSLESYPAFAWGTKEETDLVSELRRHKVMSRAGER
2bhgA           ----------------------------------------------------------------------
3e6gA           ----------------------------------------------------------------------
2b34A           ----------------------------------------------------------------------
2dbnA           ALRA--QLGDVQQQLSDDIATRVAEINALKAQGDAVWPVLSYADIKAGHVTAEQREQIKRRGCAVIKGHF
3bh1A           ----------------------------------------------------------------------
3c01F           ----------------------------------------------------------------------
3c01E           ----------------------------------------------------------------------
3bmaD           ----------------------------------------------------------------------
2bu3A           ----------------------------------------------------------------------
3bh1D           ----------------------------------------------------------------------
3bwoC           LKETCKSESESENFFKYGREMMKNRWEAFCNYFGKSLESYPAFAWLGTKEETDLVSELRRHKVMSRAGER
1dy2A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           PTVPVGTARLRLTLTQAHEACDIDRLLEVLHGAGE
3a2bA           PAVPAEESLIRFSLMATHTYDQIDEAIEKMVKVFK
1bs0A           PTVPAGTARLRLTLTAAHEMQDIDRLLEVLHGNG-
1djeA           PTVPAGIARLRLTLTAAHEMQDIDRLLEVLHGNG-
2bwpB           PTVPRGTERLRFTPSPVHDLKQIDGLVHAMD----
2bwoD           PTVPRGTERLRFTPSPVHDLKQIDGLVHAM-----
2bwnD           PTVPRGTERLRFTPSPVHDLKQIDGLVHAM-----
2bwpA           PTVPRGTERLRFTPSPVHDLKQIDGLVHAM-----
2cdmA           -----------------------------------
2bwoB           PTVPRGTERLRFTPSPVHDLKQIDGLVHAMDLL--
2bwnB           PTVPRGTERLRFTPSPVHDLKQIDGLVHAMD----
2bwnA           PTVPRGTERLRFTPSPVHDLKQIDGLVHAM-----
2bwoA           PTVPRGTERLRFTPSPVHDLKQIDGLVHAM-----
2bwnE           PTVPRGTERLRFTPSPVHDLKQIDGLVHAM-----
1d2fB           TYGEEGRGFVRLNA--GCPRSKLEKGVAGL-----
1d2fA           TYGEEGRGFVRLNA--GCPRSKLEKGVAGLINAIR
1dfoB           PNDPFVTSGIRVGTPAITRRGFKEAEAKELAGW--
1djuA           AFGKAGEGYVRISY--ATAYEKLEEAMERMERV--
1ecxA           DAMGIAQGAIRISLCKYNTEEEVDYFLKKIEEILS
1b5pA           GTDFAAFGHVRLSYATSEE--NLRKALERFARV--
2c7tA           PPYLPVHKNPLFCPWTKNRYLKSVRKTEAYWRGLH
2douB           GFGPGGKGFVRIAL--VRPLEELLEAAKRIREA--
1bjwA           GTDFAAFGHVRLSYATSEE--NLRKALERFARV--
2bhxB           GHRSVGGCRASIYNAVPID--ACIALRELMIQF--
1eg5B           LDAGVDRRIIRISLCKYNTEEEVDYFLKKIEEILS
2bieB           GHRSVGGCRASIYNAVPID--ACIALRELMIQF--
1ecxB           LDAMGVDRRIRISLCKYNTEEEVDYFLKKIEEILS
1eg5A           DDRRIAQGAIRISLCKYNTEEEVDYFLKKI-----
1dfoA           PNDPFVTSGIRVGTPAITRRGFKEAEAKELAGW--
3e77A           LKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLE
2dgmB           GGEATDIVVMRIMCRRGFEMDFAELLLEDYKASLK
2byjA           -AKPTHGDIIRFAPPLVIKEDELRESIEII-----
1djuB           AFGKAGEGYVRISYATAYE--KLEEAMERMERV--
2cfbA           GIYLAPSQFEAGFTSLAHTEADIERTIAAARTV--
2douA           GRGPGGKGFVRIALVRPLE--ELLEAAKRIREA--
2c81A           PPYLPVHKNPLFCPWTKNRYLKSVRKTEAYWRGL-
2dkjA           PFDPRVTSGIRIGTPAITTRGFTPEEMPLVAEL--
3bb8A           GNLTRQPY---FHDVKYRVVGELTNTDRIMNQT--
1ay4B           GIYMVGDSRINIA---GLNDNTIPILARAII----
3dzzB           GYRGNGHEFVRINL--ACPKELVIDGQRLKQGV--
1bkgA           GTDFAAFGHVRLSYATSEE--NLRKALERFARV--
5bj4A           GTDFAAFGHVRLSY--ATSEENLRKALERFARV--
3dydA           ATCFEYPNFIRVVITVPEV--MMLEACSRIQEF--
3dzzA           GYRGNGHEFVRINLCPKELVIDGQRLKQGVL----
3dydB           ATCFEYPNFIRVVITVPEV--MMLEACSRIQEF--
3cq6A           A------GHLRTTI---GVPEENDAFLDAAAEIIK
1bjnA           GHRVVGGMRASIYNAMPLE--GVKALTDFMVEF--
3e77C           LKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLE
1b5oA           GTDFAAFGHVRLSYATSEE--NLRKALERF-----
1ay5B           ----VGDSRINIA---GLNDNTIPILARAII----
3cq4B           A------GHLRTTI---GVPEENDAFLDAAAEI--
2dgmE           GGEATDIVVMRIMCRRGFEMDFAELLLEDYKASLK
3cq4A           AGH------LRTTI---GVPEENDAFLDAA-----
1ejiA           DKSALRPSGLRLGTPALTSRGLLEEDFQKVAHFIH
3bcxA           GNLTRQPYF---HDVKYRVVGELTNTDRIMNQT--
3bn1C           PMHICGVDGLNLPTHAGLTEADIDRVIAALDQV--
2cstA           NMCGLTTKNLDYVAKSIHEAVT-------------
5bj3A           GTDFAAFGHVRLSY--ATSEENLRKALERFARV--
2c0rA           LKGHRSVGGLRASIYNAVPYESCEALVQFM-----
2aevA           AGMPGASKSLRIDLSRDAERIDDNYIIKAIVES--
3cq5B           AGH------LRTTI---GVPEENDAFLDAAAEI--
2e7jA           HGIKPGLTRYFKLSTYGLSDEEVDYVLNAFKEI--
2aeuA           AGMPGASKSLRIDLTSDAERIDDNYIIKAIV----
1asfA           ------SGRVNVA---GMTPDNMAPLCEAIV----
3eiaA           GSGPGGEGFVRVSA--FGHRENILEACRRFKQL--
3bs8A           GVFLPPSQFEGLFLSTAHTDEDIENTIQAAEKVFA
1ariA           A---------------GMTPDNMAPLCEAIV----
1cl1B           ESLIFSGTLIRLHIGLEDVDDLIADLDAGFA----
3ei7B           GSGPGGEGFVRVSA--FGHRENILEACRRFK----
3e2yA           KSKPHFEKLVRFCF--IKKDSTLDAAEEIF-----
2bylA           -AKPTHGDIIRFAPPLVIKEDELRESIEIINKT--
1c7gA           ENHRPKLETVRLTIRRVYTYAHMDVVADGIIKLYQ
1c4kA           NQYYVDPNKFMLTTPGINPETGDYEDFGVPATI--
2bieA           GHRSVGGCRASIYNAVPID--ACIALRELMIQF--
3bcxB           GNLTRQPY---FHDVKYRVVGELTNTDRIMNQTFW
3ei7A           GSGPGGEGFVRVSA--FGHRENILEACRRFKQL--
3ei8A           GSGPGGEGFVRVSA--FGHRENILEACRRFKQL--
2dgkC           GGEATDIVVMRIMCRRGFEMDFAELLLEDYKASLK
1bj4A           DRSALRPSGLRLGTPALTSRGLLEKDFQKVAHFIH
1cj0A           DKSALRPSGLRLGTSRGLLEKDFQKVAHFIHRG--
1dgdA           VQLPGMGGVFRIAPPLTVSEDEIDLGLSLLGQA--
2dgkA           GGEATDIVVMRIMCRRGFEMDFAELLLEDYKASLK
2ch2A           PTFGKAWRVGIMGECSTVQ--KIQFYLYGF-----
2aatA           VNVA------------GMTPDNMAPLCEAIV----
3dr7B           PMHICGVDGLNLPTHAGLTEADIDRVIAALDQV--
2e54A           -VVPAGNNTIRFLPPLTVEYGEIDLAVETLKKV--
3drdA           MLTRPLGDVIAFLPPLASTAEELSEMVAIMKQA--
1cj0B           DKSALRPSGLRLGTSRGLLEKDFQKVAHFIHRG--
2cinA           -VLPAGADTVRFRPPLTVSTAEIDAAIAAVRSA--
2e7uA           -WPPSNFEAAFLSV--AHREEDVEKTLEAL-----
2dr1B           GYGSVKEKTFRIGHMGYMKFEDIQEMLDNL-----
1b8gB           SCHCTEPGWFRVCFA-NLPERTLDLAMQRL-----
1e5eB           ESLIQHPASIRLSVGIEDADELIADFKQGLDAL--
2dgmA           GGEATDIVVMRIMCRRGFEMDFAELLLEDYKASLK
1e5eA           ESLIQHPASIRLSVGIEDADELIADFKQGLDAL--
3bn1D           IAEACGVDGLNLPTHAGLTEADIDRVIAALDQV--
2ch1A           PTFGKAWRVGIMGE--CSTVQKIQFYLYGF-----
1bw0A           GTIFHAPGFTRLTT--TRPVEVYREAVERIKAFCQ
3dr4A           PMHICGVDGLNLPTHAGLTEADIDRVIAALDQV--
2eh6A           --NCTAGKVLRFLPPLIIQKEHIDRAISVL-----
1aiaA           VNVAGMTPD------------NMAPLCEAIV----
3aatA           S------GFVNVA---GMTPDNMAPLCEAIV----
1arhA           ------SGAVNVA---GMTPDNMAPLCEAIV----
1aamA           ------SGRVNVA---GMTPDNMAPLCEAIV----
1d7uA           VQLPGMGGVFRIAPPLTVSEDEIDLGLSLLGQA--
1dtyA           --IRPFGKLIYLMPPYIILPQQLQRLTAAVNRA--
1c7nA           IFGDGGIGFERINL--AAPSSVIQESLERLNKA--
3ei6B           GSGPGGEGFVRVSA--FGHRENILEACRRFKQL--
3cbfA           FANGGGENTLRLSYATLDRE-GIAE----------
3dxvA           YYVGMNGNVLEFTPPLTITETDIHKALDLL-----
3ei9A           GSGPGGEGFVRVSA--FGHRENILEACRRFKQL--
3dr4C           PMHICGVDGLNLPTHAGLTEADIDRVIAALD----
3bcbA           LGNVYPCAYLNAAAAIGMKMQDVDLFIKRLDKCLN
3e77B           LKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLE
3ecdA           PEKPTITSGIRLGTPAGTTRGFGAAEFREV-----
1cl1A           ESLIFSGTLIRLHIGLEDVDDLIADLDAGFARI--
3b46B           EHEKAAENLLRFAV--CKDDAYLENAVERLKLLKD
2egyD           FANGGGENTLRLSYATLDRE-GIAE----------
1ajsA           IN-MCGLTTKNLDYVATSIHEAVTKI---------
3eiaB           GSGPGGEGFVRVSA--FGHRENILEACRRFKQL--
2dgmC           GGEATDIVVMRIMCRRGFEMDFAELLLEDYKASLK
3ei6A           GSGPGGEGFVRVSA--FGHRENILEACRRFK----
1arsA           ------SGRVNVA---GMTPDNMAPLCEAIV----
2dr1A           GYGSVKEKTFRIGHMGYMKFEDIQEMLDNL-----
3dxvB           YYVGMNGNVLEFTPPLTITETDIHKALDLLDRA--
1bqaA           VNVA------------GMTPDNMAPLCEAIV----
3bc8A           LGNVYPCAYLNAAAAIGMKMQDVDLFIKRLDKCLN
1aheA           VNVA------------GMTPDNMAPLCEAIV----
3ei9B           GSGPGGEGFVRVSA--FGHRENILEACRRFKQL--
1ay4A           GIYMVGDSRINIA---GLNDNTIPILARAII----
3cq5A           AGH------LRTTI---GVPEENDAFLDAA-----
1ax4A           EQKHADMEFMRLTIRRVYTNDHMDYIADALIGLKE
2egyC           FANGGGENTLRLSYATLDRE-GIA-----------
2ctzA           -----------------------------------
3bn1A           PMHICGVDGLNLPTHAGLTEADIDRVIAALD----
1c0nA           CAMPLMAYYCRASLAMYNTHEEVDRLVTGLQRIHR
1cs1A           ESLISHAATLRISTGIEDGEDLIADLENGFRAANK
1czcA           ------SGRLNVA---GMTPDNLAPLCEAIV----
3ecdB           PEKPTITSGIRLGTPAGTTRGFGAAEFREV-----
2c44C           KQLPCPAELLRLTIRATYTQTHMDFIIEAFKHVKE
3e2fA           DSKSKPHFEKLVRFCFIKKDSTLDAAEEIF-----
3bv0B           --LRPFRNLVYAMPPYICTPAEITQITSAMVEV--
1akaA           A---------------GVASSNVGYLAHAIH----
3b8xA           GNFLKNTDVLKYFDYTVHN--NVDNAEYLDKNG--
2d5yA           A---------------GMTPDNLAPLCEAIV----
1b9iA           AITDAFWELGAPDESVDAIARRCPNTDAISSDC--
1b4xA           ------SGRVNVA---GMTPDNMAPLCEAIV----
1asbA           ------SGRVNVA---GMTPDNMAPLCEAIVAV--
3e9kA           NGIRVAPVPLYNSFH------DVYKFTNLLTSI--
3dr4B           PMHICGVDGLNLPTHAGLTEADIDRVIAALDQV--
3bwnD           CGSDKKHVRVSMLSRED----VFNVFLERLA----
3b46A           EHEKAAENLLRFAV--CKDDAYLENAVERLKLLKD
3bcaA           LGNVYPCAYLNAAAAIGMKMQDVDLFIKRLDKCLN
2bkwA           KDIGPKYIRIGHGVTACNKNLPYKNCFDLIKLA--
2a0yA           -----------------------------------
3d6kB           LHNDPNNENIRLAPSLPPVAELADGFATCVLAALE
2d66A           A---------------GMTPDNMAPLCEAIV----
1bjoA           LKGHRVVGGMRASIYNAMPLEGVKALTDFM-----
3bv0A           --LRPFRNLVYAMPPYICTPAEITQITSAMVEVAR
1bw0B           GTIFHAPGFTRLTTTRPVE--VYREAVERIKAFCQ
3b8xB           GNFLKNTDVLK--YFDYTVHNNVDNAEYLDKNG--
2cy8A           ALILEGGGRGSVFLSAQHEREHVEHLVTTF-----
2egyB           FANGGGENTLRLSYATLDRE-GIAE----------
3dr4D           PMHICGVDGLNLPTHAGLTEADIDRVIAALDQV--
3ecdC           PEKPTITSGIRLGTPAGTTRGFGAAEFREV-----
3d6kC           LHNDPNNENIRLAPSLPPV--AELEVADGFATC--
1b8gA           SCHCTEPGWFRVCFANLPER-TLDLAMQRL-----
1agxA           -----------------------------------
2a7vA           DRSAITPGGLRLGAPALTSRQFREDDFRRVVDFID
3bigA           -----------------------------------
1b9hA           -----------------------------------
1bqdA           VNVA------------GMTPDNMAPLCEAIVAV--
2cb1A           -----------------------------------
3d19E           -----------------------------------
3dc1A           VDSSAPSPYLRASFS-SASPEQMDVAFQVLAQL--
2d64A           LNVA------------GMTPDNLAPLCEAIV----
3cogB           LAELPSDTLIRLSVGLEDEEDLLEDLDQALKAAHP
2d61A           VNVAGMTPD------------NMAPLCEAIVAV--
3d6kA           LHNDPNNENIRLAPSLPPV--AELEVADGFATC--
1awiA           -----------------------------------
3d6kD           LHNDPNNENIRLAPSLPPVAELADGFATCVLAALE
3caiA           SRVDVGGA-VTVGLAHYSTMAEVDQLVRAL-----
3du4A           --TRPLGDVIAFLPPLASTAEELSEMVAIMKQA--
3bwnB           CGSDKKHVRVSMLSRED----VFNVFLERL-----
1ajrA           INMCGLTKNLDYVATSIHEAVT-------------
7aatA           A---------------GVASSNVGYLAHAIHQV--
3ecdD           PEKPTITSGIRLGTPAGTTRGFGAAEFREV-----
2c44A           KQLPCPAELLRLTIRATYTQTHMDFIIEAFKHVKE
3d19A           -----------------------------------
3e6gD           -----------------------------------
1eghA           -----------------------------------
3e6gB           -----------------------------------
3eh2A           YTSCAGQRRLRIHNLALNCCTQLADLYRNCE----
3dc1B           VDSSAPSPYLRASFS-SASPEQMDVAFQVLAQL--
2btwB           -----------------------------------
2c44B           KQLPCPAELLRLTIRATYTQTHMDFIIEAFKHVKE
3dc1D           VDSSAPSPYLRASFS-SASPEQMDVAFQVLAQL--
3bwnA           CGSDKKHVRVSMLSRED----VFNVFLERL-----
3bwoA           CGSDKKHVRVSMLSRED----VFNVFLERLA----
2btwA           -----------------------------------
1btcA           -----------------------------------
3cogD           -----------------------------------
1c8nA           -----------------------------------
1b93B           -----------------------------------
1bybA           -----------------------------------
3bh1C           -----------------------------------
3drdB           -----------------------------------
3dodB           -----------------------------------
3dodA           -----------------------------------
3bwnF           CGSDKKHVRVSMLSRED----VFNVFLERLA----
2bhgA           -----------------------------------
3e6gA           -----------------------------------
2b34A           -----------------------------------
2dbnA           P----------------------------------
3bh1A           -----------------------------------
3c01F           -----------------------------------
3c01E           -----------------------------------
3bmaD           -----------------------------------
2bu3A           -----------------------------------
3bh1D           -----------------------------------
3bwoC           CGSDKKHVRVSMLSRED----VFNVFLERL-----
1dy2A           -----------------------------------