[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for sent8:ACF68197.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dnsA.bssp"
#ERROR : Can't open dsspfile "3dnsB.bssp"
#ERROR : Can't open dsspfile "3eg7B.bssp"
#ERROR : Can't open dsspfile "3eg7F.bssp"
#ERROR : Can't open dsspfile "3eg7E.bssp"
#ERROR : Can't open dsspfile "3eg7A.bssp"
#ERROR : Can't open dsspfile "3eg7C.bssp"
#ERROR : Can't open dsspfile "2b3uA.bssp"
#ERROR : Can't open dsspfile "3bj7A.bssp"
#ERROR : Can't open dsspfile "2b3vA.bssp"
#ERROR : Can't open dsspfile "3dr8A.bssp"
#ERROR : Can't open dsspfile "3dr6A.bssp"
#ERROR : Can't open dsspfile "3dr8B.bssp"
#ERROR : Can't open dsspfile "2bueA.bssp"
#ERROR : Can't open dsspfile "3dr6C.bssp"
#ERROR : Can't open dsspfile "3c26A.bssp"
#ERROR : Can't open dsspfile "2a6aB.bssp"
#ERROR : Can't open dsspfile "3d8pB.bssp"
#ERROR : Can't open dsspfile "1cm0B.bssp"
#ERROR : Can't open dsspfile "2b5gB.bssp"
#ERROR : Can't open dsspfile "3bj8A.bssp"
#ERROR : Can't open dsspfile "1cm0A.bssp"
#ERROR : Can't open dsspfile "3d2pA.bssp"
#ERROR : Can't open dsspfile "2bl1A.bssp"
#ERROR : Can't open dsspfile "3bj8C.bssp"
#ERROR : Can't open dsspfile "2ae6A.bssp"
#ERROR : Can't open dsspfile "3d3sB.bssp"
#ERROR : Can't open dsspfile "3bj7B.bssp"
#ERROR : Can't open dsspfile "3dr6B.bssp"
#ERROR : Can't open dsspfile "2ae6C.bssp"
#ERROR : Can't open dsspfile "2beiB.bssp"
#ERROR : Can't open dsspfile "3bj8B.bssp"
#ERROR : Can't open dsspfile "3d3sA.bssp"
#ERROR : Can't open dsspfile "3d3sC.bssp"
#ERROR : Can't open dsspfile "3ec4A.bssp"
#ERROR : Can't open dsspfile "2cnmA.bssp"
#ERROR : Can't open dsspfile "1cjwA.bssp"
#ERROR : Can't open dsspfile "3d8pA.bssp"
#ERROR : Can't open dsspfile "2b3uB.bssp"
#ERROR : Can't open dsspfile "2b4dA.bssp"
#ERROR : Can't open dsspfile "2b4bA.bssp"
#ERROR : Can't open dsspfile "2b4bB.bssp"
#ERROR : Can't open dsspfile "2b4dB.bssp"
#ERROR : Can't open dsspfile "2ae6B.bssp"
#ERROR : Can't open dsspfile "2ae6D.bssp"
#ERROR : Can't open dsspfile "3efaA.bssp"
#ERROR : Can't open dsspfile "1bo4A.bssp"
#ERROR : Can't open dsspfile "3dsbA.bssp"
#ERROR : Can't open dsspfile "3e0kA.bssp"
#ERROR : Can't open dsspfile "2c27A.bssp"
#ERROR : Can't open dsspfile "1b6bB.bssp"
#ERROR : Can't open dsspfile "2beiA.bssp"
#ERROR : Can't open dsspfile "1b87A.bssp"
#ERROR : Can't open dsspfile "2d4oA.bssp"
#ERROR : Can't open dsspfile "1bo4B.bssp"
#ERROR : Can't open dsspfile "3d3sD.bssp"
#ERROR : Can't open dsspfile "2d4pA.bssp"
#ERROR : Can't open dsspfile "1bobA.bssp"
#ERROR : Can't open dsspfile "2atrA.bssp"
#ERROR : Can't open dsspfile "2aj6A.bssp"

## Summary of PDB Search
:179
    8e-19  13%  3dnsA  [x.x.x] RIBOSOMAL-PROTEIN-ALANINE ACETYLTRANSFERASE
    2e-18  13%  3dnsB  [x.x.x] RIBOSOMAL-PROTEIN-ALANINE ACETYLTRANSFERASE
    2e-14  17%  3eg7B  [x.x.x] SPERMIDINE N1-ACETYLTRANSFERASE
    6e-14  17%  3eg7F  [x.x.x] SPERMIDINE N1-ACETYLTRANSFERASE
    1e-13  17%  3eg7E  [x.x.x] SPERMIDINE N1-ACETYLTRANSFERASE
    2e-13  17%  3eg7A  [x.x.x] SPERMIDINE N1-ACETYLTRANSFERASE
    1e-12  17%  3eg7C  [x.x.x] SPERMIDINE N1-ACETYLTRANSFERASE
    1e-12  12%  2b3uA  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    3e-12  13%  3bj7A  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    3e-12  12%  2b3vA  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    4e-12  18%  3dr8A  [x.x.x] YNCA
    9e-12  17%  3dr6A  [x.x.x] YNCA
    2e-11  17%  3dr8B  [x.x.x] YNCA
    5e-11  10%  2bueA  [x.x.x] AAC(6')-IB
    6e-11  18%  3dr6C  [x.x.x] YNCA
    1e-10   9%  3c26A  [x.x.x] PUTATIVE ACETYLTRANSFERASE TA0821
    2e-10  10%  2a6aB  [x.x.x] HYPOTHETICAL PROTEIN TM0874
    2e-10  10%  3d8pB  [x.x.x] ACETYLTRANSFERASE OF GNAT FAMILY
    2e-10  14%  1cm0B  [d.108.1] P300/CBP ASSOCIATING FACTOR
    2e-10  15%  2b5gB  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    2e-10  15%  3bj8A  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    2e-10  14%  1cm0A  [d.108.1] P300/CBP ASSOCIATING FACTOR
    3e-10   8%  3d2pA  [x.x.x] PUTATIVE ACETYLGLUTAMATE SYNTHASE
    4e-10  18%  2bl1A  [x.x.x] PUTATIVE PHOSPHINOTHRICIN N-ACETYLTRANSFERASE
    4e-10  15%  3bj8C  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    4e-10  22%  2ae6A  [x.x.x] ACETYLTRANSFERASE, GNAT FAMILY
    5e-10  14%  3d3sB  [x.x.x] L-2,4-DIAMINOBUTYRIC ACID ACETYLTRANSFERASE
    5e-10  14%  3bj7B  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    5e-10  18%  3dr6B  [x.x.x] YNCA
    5e-10  21%  2ae6C  [x.x.x] ACETYLTRANSFERASE, GNAT FAMILY
    7e-10  12%  2beiB  [x.x.x] DIAMINE ACETYLTRANSFERASE 2
    1e-09  14%  3bj8B  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    1e-09  14%  3d3sA  [x.x.x] L-2,4-DIAMINOBUTYRIC ACID ACETYLTRANSFERASE
    2e-09  14%  3d3sC  [x.x.x] L-2,4-DIAMINOBUTYRIC ACID ACETYLTRANSFERASE
    2e-09  12%  3ec4A  [x.x.x] PUTATIVE ACETYLTRANSFERASE FROM THE GNAT FAMILY
    3e-09  16%  2cnmA  [x.x.x] MODIFICATION OF 30S RIBOSOMAL SUBUNIT PROTEIN
    3e-09  12%  1cjwA  [d.108.1] PROTEIN (SEROTONIN N-ACETYLTRANSFERASE)
    3e-09  11%  3d8pA  [x.x.x] ACETYLTRANSFERASE OF GNAT FAMILY
    7e-09  12%  2b3uB  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    9e-09  12%  2b4dA  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    1e-08  14%  2b4bA  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    2e-08  14%  2b4bB  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    2e-08  12%  2b4dB  [x.x.x] DIAMINE ACETYLTRANSFERASE 1
    4e-08  22%  2ae6B  [x.x.x] ACETYLTRANSFERASE, GNAT FAMILY
    5e-08  21%  2ae6D  [x.x.x] ACETYLTRANSFERASE, GNAT FAMILY
    7e-08  13%  3efaA  [x.x.x] PUTATIVE ACETYLTRANSFERASE
    8e-08  10%  1bo4A  [d.108.1] PROTEIN (SERRATIA MARCESCENS AMINOGLYCOSIDE-3-N-
    1e-07  10%  3dsbA  [x.x.x] PUTATIVE ACETYLTRANSFERASE
    1e-07  10%  3e0kA  [x.x.x] AMINO-ACID ACETYLTRANSFERASE
    1e-07  15%  2c27A  [x.x.x] MYCOTHIOL SYNTHASE
    2e-07  15%  1b6bB  [d.108.1] PROTEIN (ARYLALKYLAMINE N-ACETYLTRANSFERASE)
    2e-07  10%  2beiA  [x.x.x] DIAMINE ACETYLTRANSFERASE 2
    1e-06   5%  1b87A  [d.108.1] PROTEIN (AMINOGLYCOSIDE N6'-ACETYLTRANSFERASE
    2e-06  10%  2d4oA  [x.x.x] HYPOTHETICAL PROTEIN TTHA1254
    3e-06  12%  1bo4B  [d.108.1] PROTEIN (SERRATIA MARCESCENS AMINOGLYCOSIDE-3-N-
    3e-06  12%  3d3sD  [x.x.x] L-2,4-DIAMINOBUTYRIC ACID ACETYLTRANSFERASE
    9e-06  10%  2d4pA  [x.x.x] HYPOTHETICAL PROTEIN TTHA1254
    4e-05  11%  1bobA  [x.x.x] HISTONE ACETYLTRANSFERASE
    8e-05  14%  2atrA  [x.x.x] ACETYLTRANSFERASE, GNAT FAMILY
    9e-05  10%  2aj6A  [x.x.x] HYPOTHETICAL PROTEIN MW0638
:179

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxSTTLELRAADESHVPALHQLVLKNKAWLQQSLDWPQYVTSQEETRKHVQGNMLLHQRGYAKMY
3dnsA           -------------------------------------------------------------KVNGVEREY
3dnsB           -----------------------------------------------------------IEKVNGVEREY
3eg7B           ----------LTLRALERGDLRFIHNLNNNRNISYWFEEPYESFDELEELYNKH------IHDNAERRFV
3eg7F           ----------LTLRALERGDLRFIHNLNNNRNISYWFEEPYESFDELEELYNKH------IHDNAERRFV
3eg7E           -------NSQLTLRALERGDLRFIHNLNNNRNISYWFEEPYESFDELEELYNKH------IHDNAERRFV
3eg7A           -------NSQLTLRALERGDLRFIHNLNNNRNISYWFEEPYESFDELEELYNKH------IHDNAERRFV
3eg7C           -------NSQLTLRALERGDLRFIHNLNNNRNISYWFEEPYESFDELEELYNKH------IHDNAERRFV
2b3uA           ----------FVIRPATAADCSDILRLIKELAQVILTEKDLLEDGFGEHPFYHC-------LVAEVPKEH
3bj7A           ----------FKIRPATASDCSDILRLIKELAKYEYMEDQVILTE---KDLQEDGFGEHPFYHCLVAEVP
2b3vA           ----------FVIRPATAADCSDILRLIKELARYEYEEQVILTEKDLLEDGFGEHPFYHCLVAEVPK-EH
3dr8A           ---------SNTIRFADKADCAAITEIY--NHAVLHTAAIWNDRTVDTDNRLAWYEARQLLGYP----VL
3dr6A           ------------IRFADKADCAAITEIY--NHAVLHTAAIWNDRTVDTDNRLAWYEA----RQLLGYPVL
3dr8B           ----------ATIRFADKADCAAITEIY--NHAVLHTAAIWNDRTVDTDNRLAWYEA----RQLLGYPVL
2bueA           ---------SVTLRLMTEHDLAMLYEWL--NRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIA
3dr6C           ------------IRFADKADCAAITEIY--NHAVLHTAAIWNDRTVDTDNRLAWYEA----RQLLGYPVL
3c26A           ----------IVFDRGSPSDIDEIKTFT--SNTWKVGYYTDLYSKLADTGTDDYVD----KVIERWVNDG
2a6aB           ---------------------------------------------------------SPYDIPVAPLNSF
3d8pB           ----------INIIEYNRSYKEELIEFILSIQKNEFNIKIDRDDQPDLENIEHN------YLNSGGQFWL
1cm0B           ----------IEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVF-------DPKHKTL
2b5gB           ----------FVIRPATAADCSDILRLIKEL---------AYEYEEQVILTEKDLLEDGFFYHCLVAEVP
3bj8A           ----------FKIRPATASDCSDILRLIKELAKYEYMEDQVILTEKDLQEDGFGEHPFYHCLVAEVPKEH
1cm0A           ----------IEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVF-------DPKHKTL
3d2pA           --------------------------------SIRQAHSGDIPHIAALIRPLILLHRSREYLENHISEFS
2bl1A           ------------IRDAGVADLPGILAIY--NDAVGNTTAIWNETPVDLANRQAWFDARA---RQGYPILV
3bj8C           ----------FKIRPATASDCSDILRL---IKELAKYEYMEDQVILTEKDLQEDGFGEHPFYHCLVA--E
2ae6A           -------STSLTIRLVAEADWPALHALD--QIISLAAYQEKK-----------------------DETIF
3d3sB           ----------YHLRPPRRNDGAAIHQLV--SECPPLDLNSLYAYL-------------LLCEHHAHTCVV
3bj7B           ----------FKIRPATASDCSDILRLIKELAKYEYMEDQVILTEKDLQEDGFGEHPFYHCLVAEVPKEH
3dr6B           ------------IRFADKADCAAITEIY--NHAVLHTAAIWNDRTVDTDNRLAWYEA----RQLLGYPVL
2ae6C           ---------SLTIRLVAEADWPALHALD--QIISLAAYQEKKDET-----------------------IF
2beiB           ---------SVRIREAKEGDCGDILRLIRELAEFEKLSDQVKISEEALRA----------DGFGDNPFYH
3bj8B           ----------FKIRPATASDCSDILRLIKELAKYEYMEDQVILTEKDLQEDGFGEHPFYHCLVAEVPKEH
3d3sA           ----------YHLRPPRRNDGAAIHQLV--SECPPLDLNSLYAYL-------------LLCEHHAHTCVV
3d3sC           ---------RYHLRPPRRNDGAAIHQLV--SECPPLDLNSLYAYL-------------LLCEHHAHTCVV
3ec4A           ---------QIADGPVPSFDDPGIVAL-------------GETDVPETALALATEPGPWASGTWRYGQFY
2cnmA           -----------TISILSTTDLPAAWQI-EQRAHAFPWSEKT-----------------FFGNQGERYLNL
1cjwA           --------PANEFRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTLCPELSLGWFVEGRLVAFI
3d8pA           ----------INIIEYNRSYKEELIEFILSIQKNEFNIKIDRDDQPDLENIEHN------YLNSGGQFWL
2b3uB           ----------FVIRPATAADCSDILRLIKELARYEY----EEQVILTEKDLLEDGFPFYHCLVAEVPKEH
2b4dA           ---------KFVIRPATAADCSDILRLIKELAKYEYEEQVILTEKDLLEDGFGEHPFYHCLVAEVPK-EH
2b4bA           ----------FVIRPATAADCSDILRL-IKELARYEYEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEH
2b4bB           ---------KFVIRPATAADCSDILRL-IKELARYEYEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEH
2b4dB           ----------FVIRPATAADCSDILRLI--KELAYEYEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEH
2ae6B           -------STSLTIRLVAEADWPALHAL---DQIILAAYQE-----------------------KKDETIF
2ae6D           ----------LTIRLVAEADWPALHALD--QIISLAAYQEKK-----------------------DETIF
3efaA           ------------------------------------------QAVFVEERGISADVEFDVKDTDQCEYAV
1bo4A           ----------IRTCRLGPDQVKSMRAALDLFGREFGDVATYSQHQPDSDYLGNLLR-------SKTFIAL
3dsbA           ---------LIEIREARD-DLDTIAK-------FNYNLAKETEGKELDDVLTKGVK--ALLLDERKGKYH
3e0kA           ----------------------------------------------EEQGILRRSREQL---EQEIGKFT
2c27A           ----------------------------------------------------------------------
1b6bB           -----------EFRCLTPEDAAGVFEIEREAFDEVQHFLTLCPELSLGWFVEGRLVAFIIGS--------
2beiA           ---------SVRIREAKEGDCGDILRLIRELAEFEKLKISEEALR------------ADGFGDNPFYHCL
1b87A           ----------MIISEFDRNNPVLKDQLSDLLRLTWPEEYGDSSA-------------EEVEEMMNPERIA
2d4oA           -----------RFRPFTEEDLDRLNRLAGKSLGALRFFARTGHSF------------------------L
1bo4B           ----------IRTCRLGPDQVKSMRAALDLFGREFGDVATYSQHQPDSDYLGNLLR-------SKTFIAL
3d3sD           ----------YHLRPPRRNDGAAIHQLV--SECPPLDLNSLYAYL-------------LLCEHHAHTCVV
2d4pA           ----------MRFRPFTEEDLDRLNRL-------------AGKRPVSLGALRFFARTGHSF---------
1bobA           --------------------------------VDDFARRMHRRVQIFSLLFIEAANYIDETDPSWQIYWL
2atrA           ----------ITIKKQEIVKLEDVLHLY--------QAVGWTNE--------------LEQALSHSLVIY
2aj6A           ------------LNKDEHNYIKQIANIHETLLSQVESNYKCTK---LSIALRYEICSRL---EHTNDKIY


                         .         .         *         .         .         .         .:140
query           LIFCQNEMAGVLSFNAIEPVNKAAYIGYWLDESLQGQGIMSQSLQALMTHYARRGDIRRFVIKCRVDNQA
3dnsA           LITDKYITIGRIFIVDLNKDNRFCFRKIYKQG--KSINTYIKEILSVFEFLFKSNDINKVN--IIVDEEV
3dnsB           LITDKYITIGRIFIVDLNKDNRFCFRKIYKQG--KSINTYIKEILSVFEFLFKSNDINKVN--IIVDEEV
3eg7B           VEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPK
3eg7F           VEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPK
3eg7E           VEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPK
3eg7A           VEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPK
3eg7C           VEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPK
2b3uA           WTPEGHSIVGFAYYFTYDPWIGKLLYEDFFVSDYRGFGIGSEILKNLSQVARCRCSSHFLVA---EWNEP
3bj7A           PEGHSIVGFAMYYFTYDPWIGKLLYLEDFVMSDYRGFGIGSEILKNLS-QVAMKCRCSSMHFLVAEWNEP
2b3vA           WTPEGHSIVGFAYYFTYDPWIGKLLYLDFFVSDYRGFGIGSEILKNLSQVARCRCSSHFLVA---EWNEP
3dr8A           VSEENGVVTGYASFGDWRSFRYTVEHSVYVHPAHQGKGLGRKLLSRLIDE--ARRCGKHVVAGIESQNAA
3dr6A           VSEENGVVTGYASFGDWRSFDGTVEHSVYVHPAHQGKGLGRKLLSRLIDEARRCG--KHVVAGIESQNAA
3dr8B           VSEENGVVTGYASFGDWRGFRYTVEHSVYVHPAHQGKGLGRKLLSRLIDEARRCG--KHVVAGIESQNAA
2bueA           MAQSYVALGSGDGWWEEETDPGVRGIDQLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLR
3dr6C           VSEENGVVTGYASFGDWRSFDGFRYHSVYVHPAHQGKGLGRKLLSRLIDEARRCG--KHVVAGIESQNAA
3c26A           SVYVLRVSGRPVATIHEKLPDGSVLGGLRVHPEYRGSRLGSIQETIQFLRGKTER-LRSAV---YSWNEP
2a6aB           ETAKSCPADGVVLVARRARKGYHYCAVYLKDKGLNPLKEPSVVSDEEL-EEITKEFSPKIVLKDDLLISP
3d8pB           AINNHQNIVG---TIGLIRLDNNSALKKFVDKGYRNLKIGKKLLDKVITCKEQNI--DGIYLGTIDKFIS
1cm0B           ALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLK-EYHIKHDILNFLT---YADEY
2b5gB           WTPEGHSIVGFAYYFTYDPWIGLLYLEDFFVSDYRGFGIGSEILKNLSQVARCRCSSHFLVA---EWNEP
3bj8A           WTPEGHSIVGFYYFTYDPWIGKLLYLEDFVMSDYRGFGIGSEILKNLS-QVAMKCRCSSMHFLVAEWNEP
1cm0A           ALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLK-EYHIKHDILNFLT---YADEY
3d2pA           ILEHDGNLYGCAALKTFAEADCGEIACLAVSPQAQDGGYGERLLAHIIDKARGIG-----ISRLFALSTN
2bl1A           ASDAAGEVLGYYGDWRPFEGFRGTVEHSYVRDDQRGKGLGVQLLQALIERARAQG--LHVVAAIESGNAA
3bj8C           VPPEGHSIVGFAMYYFTPWIGKLLYLEDFVMSDYRGFGIGSEILKNLS-QVAMKCRCSSMHFLVAEWNEP
2ae6A           VAISGQQLAGFIEVHPPTSLAAHQKLSIGVSPDFQDQGIGGSLLSYIKDAEISGIHKLSLRV---ATNQE
3d3sB           AESPGGRIDGFVSAYLLPTRPDVLFVWQVAVHSRARGHRLGRALGHILERQECRH-VRHLETTVGPDNQA
3bj7B           WTPEGHSIVGFAYFTYDPWIGKLLYLEDFVMSDYRGFGIGSEILKNLS-QVAMKCRCSSMHFLVAEWNEP
3dr6B           VSEENGVVTGYASFGDWRSFDGFRYTVVYVHPAHQGKGLGRKLLSRLIDEARRCG--KHVVAGIESQNAA
2ae6C           VAISGQQLAGFIEVHPPTSLAAHQKLSIGVSPDFQDQGIGGSLLSYIKDAEISGIHKLSLRVAT---NQE
2beiB           CLVAEICVVGYYYFIYSTWKGRTIYLEDIYVPEYRGQGIGSKIIKKVA-EVALDKGCSQFRLAVLDWNQR
3bj8B           WTPEGHSIVGFAMYYFTPWIGKLLYLEDFVMSDYRGFGIGSEILKNLS-QVAMKCRCSSMHFLVAEWNEP
3d3sA           AESPGGRIDGFVSAYLLPTRPDVLFVWQVAVHSRARGHRLGRALGHILERQECRH-VRHLETTVGPDNQA
3d3sC           AESPGGRIDGFVSAYLLPTRPDVLFVWQVAVHSRARGHRLGRALGHILERQECRH-VRHLETTVGPDNQA
3ec4A           GVRIDGRLAA---AGERRPAPNLAEVSGVTWPEYRGRGLAARLIRKVIAGAARGEVPY---LHSYASNAS
2cnmA           KLTADDRMAAFAITQVVL--DEATLFNIAVDPDFQRRGLGRMLLEHLIDELETRGV-VTLWLEVRASNAA
1cjwA           IGSLWDEERTQESLALHRPRGHSAHLHALVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRA---VLMCEDA
3d8pA           AINNHQNIVG---TIGLIRLDNNSALKKFVDKGYRNLKIGKKLLDKVI-TCKEQN-IDGIYLGTIDKFIS
2b3uB           WTPEGHSIVGFAYYFTYDPWIGKLLYLEDFVSDYRGFGIGSEILKNLSQVARCRCSSH---FLVAEWNEP
2b4dA           WTPEGHSIVGFAYYFTYDPWIGKLLYEDFFVSDYRGFGIGSEILKNLSQVARCRCSSHFLVA---EWNEP
2b4bA           WTPEGHSIVGFAYYFTYDPWIGKLLYEDFFVSDYRGFGIGSEILKNLSQVARCRCSSHFLVA---EWNEP
2b4bB           WTPEGHSIVGFAYYFTYDPWIGKLLYEDFFVSDYRGFGIGSEILKNLSQVARCRCSSHFLVA---EWNEP
2b4dB           WTPEGHSIVGFAYYFTYDPWIGKLLYLEDFVSDYRGFGIGSEILKNLSQVARCRCSSHFLVA---EWNEP
2ae6B           VAISGQQLAGFIEVHPPTSLAAHQKLSIGVSPDFQDQGIGGSLLSYIKDAEISGIHKLSLRVAT---NQE
2ae6D           VAISGQQLAGFIEVHPPTSLAAHQKLSIGVSPDFQDQGIGGSLLSYIKDAEISGIHKLSLR---VATNQE
3efaA           LYLQPDLPITTLRLE---PQADHVRFGRCTRKAYRGHGWGRQLLTAAE-EWATQRGFTHGEIHG---ELT
1bo4A           AAFDQEAVVGALAAYVLPKFEQIYIYDLAVSGEHRRQGIATALINLLK-HEANALGAYVIYVQADYGDDP
3dsbA           VYTVFDKVVAQIYTYEWSDWRNGNFQSVYVDKEYRRKGIFNYLFNYIK-NICDKDENIVGRLYVEKENIN
3e0kA           IIEKDGLIIGCAALYPYSE--ERKAEACAIHPDYRDGNRGLLLLNYKHRSKSENI------NQIFVLTTH
2c27A           ------RLLGFHWTKVHPDHPGLGEVYVGVDPAAQRRGLGQMLTSIGIVSLARRLVEPAVLLYVESDNVA
1b6bB           --LWDEERLTQESLALHRPRGHSAHLHAAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAV---LMCEDA
2beiA           VAEILGPCVVGYGIYYFTWKGRTIYLEDIYVPEYRGQGIGSKIIKKVA-EVALDKGCSQFRLAVLDWNQR
1b87A           VAAVDQDELVGFIGAIPQYGITGWELPLVVESSRRKNQIGTRLVNYLE-KEVASRGGITIYLGTDDLDHG
2d4oA           AEEGEEPGFALAQAVWQG------EATTVVTREGRSVEALRGLLRAVV-KSAYDAGVYEVALHLDPERKE
1bo4B           AAFDQEAVVGAYVLPKFEQPRSEIYIYLAVSGEHRRQGIATALINLLK-HEANALGAYVIYVQADYGDDP
3d3sD           AESPGGRIDGFVSAYLLPTRPDVLFVWQVAVHSRARGHRLGRALGHILERQECRH-VRHLETTVQASRRT
2d4pA           LAEEGEEPMGLAQAVWQGEATTVLVTRIEGRSVEALRGLLRAVVKSAYDA-----GVYEVALHLDPERKE
1bobA           LNKKTKELIGFVTTWHYIDKKFRAKISQFLFPPYQNKGHGSCLYEAIIQSWLEDKSITEIT--VEDPNEA
2atrA           LALDGDAVVGLIRLVGDGF--SSVFVQDIVLPSYQRQGIGSSLKEALGNFKEAYQ------VQLATEETE
2aj6A           IYENEGQLIAFIWGHFSNE--KSVNIELYVEPQFRKLGIATQLKIALEKWAKTNA---------------


                         +         .         .         .         .         *         .:210
query           SNAVARRNHFTLEGCMKQAEYLNGDYHDVNMYARIIDAx
3dnsA           STQPFVELGFAFEGIINKSIIEKNVLKDEFLFGDYKN--
3dnsB           STQPFVELGFAFEGIINKSIIEKNVLKDEFLFGDYKN--
3eg7B           AVHLYEECGFVEEGHLVEEFFINGRYQDVKRYILQSK--
3eg7F           AVHLYEECGFVEEGHLVEEFFINGRYQDVKRYILQSK--
3eg7E           AVHLYEECGFVEEGHLVEEFFINGRYQDVKRYILQSK--
3eg7A           AVHLYEECGFVEEGHLVEEFFINGRYQDVKRYILQSK--
3eg7C           AVHLYEECGFVEEGHLVEEFFINGRYQDVKRYILQSK--
2b3uA           SINFYKRRGASDLSSEEGWRLFKIDKEYLLKAT------
3bj7A           SINFYKRRGASDLSSEEGWRLFKIDKEYLLKMA------
2b3vA           SINFYKRRGASDLSSEEGWRLFKIDKEYLLKAT------
3dr8A           SIRLHHSLGFTVTA-QPQVGVKFGRWLDLTFQLQLDE--
3dr6A           SIRLHHSLGFTVTAQPQVG-VKFGRWLDLTFQLQLDE--
3dr8B           SIRLHHSLGFTVTAQPQVG-VKFGRWLDLTFQLQLDE--
2bueA           AIRCYEKAGFERQG------TVTTPDGPAVYMVQ-----
3dr6C           SIRLHHSLGFTVTAQPQVG-VKFGRWLDLTFQLQLDE--
3c26A           SLRLVHRLGFHQVEEYPIYTFQGGSALKPVNERYAGR--
2a6aB           AVLVEESERLFREKKTI----------------------
3d8pB           AQYFYSNNGFREIKRGDLPSSFPKLDVDNRFYYR-----
1cm0B           AIGYFKKQGFSKEIKIPKTKYVIKDYEGATLMGCELN--
2b5gB           SINFYKRRGASDLSSEEGWRLFKIDKEYLLKAT------
3bj8A           SINFYKRRGASDLGWRL--FKIDKEYLL--KMA------
1cm0A           AIGYFKKQGFSKEIKIPKTKYVIKDYEGATLMGCELN--
3d2pA           TGEWFAERGFQTASEDELPETRRKDYRNSHILVRRLH--
2bl1A           SIGLHRRLGFEISGQPQVG-QKFGRWLDLTFQLNLDP--
3bj8C           SINFYKRRGASDLGWRL--FKIDKEYLLKMA--------
2ae6A           AIRFYEKHGFVQEAHFKEEFYINGHYCDDYQYAYFI---
3d3sB           SRRTFAGLAGERGAHVSEQPFFDRQAFDELLRIGP----
3bj7B           SINFYKRRGASDLGWRL--FKIDKEYLL-----------
3dr6B           SIRLHHSLGFTVTAQPQVG-VKFGRWLDLTFQLQLDE--
2ae6C           AIRFYEKHGFVQEAHFKEEFYINGHYCDDYQYAYFI---
2beiB           A-DLYKALGAQDLTEAEGWHFFCFQGEATRKLA------
3bj8B           SINFYKRRGASDLGWRL--FKIDKEYLL--KMA------
3d3sA           SRRTFAGLAGERGAHVSEQPFFDRQAFGGADH-------
3d3sC           SRRTFAGLAGERGAHVSEQPFFDELLRI-----------
3ec4A           AIRLYESLGFRARRATAT---------------------
2cnmA           AIALYESLGFNEATIRRNYYPTAQGHEDAIIMALPIS--
1cjwA           LVPFYQRFGFHPAGPCA--IVVGSLTFTEMHCS------
3d8pA           AQYFYSNNGFREIKRGD--LPSSFPKLDNRFYYR-----
2b3uB           SINFYKRRGASDLSSEEGWRLIDKEY-------------
2b4dA           SINFYKRRGASDLSSEEGWRLIDKEYLL-----------
2b4bA           SINFYKRRGASDLSSEEGWRLIDKEYLL-----------
2b4bB           SINFYKRRGASDLSSEEGWRLIDKEYLL-----------
2b4dB           SINFYKRRGASDLSSEEGWRLIDKEYLL-----------
2ae6B           AIRFYEKHGFVQEAHFKEEFYINGHYCDDYQYAYFI---
2ae6D           AIRFYEKHGFVQEAHFKEEFYINGHYCDDYQYAYFI---
3efaA           AQRFYELCGYRVTA-----GPYDEDGAPVVIHKQLL---
1bo4A           AVALYTK--------------------------------
3dsbA           AKATYESLNYECDYNYEY-EVIH----------------
3e0kA           SLHWFREQGFYEVGVDYLPGAKQGLYNFRKSK-------
2c27A           AVRTYQSLGFTTYSVDTA---------------------
1b6bB           LVPFYQRFGFHPAGPCA--IVVGSLTF-TEMHCSL----
2beiA           A-DLYKALGAQDLTEAEGWHFFCFQGEATRKLA------
1b87A           TTLSQTDLYEHTFDKVASIQNLREHPYEF----------
2d4oA           LEEALKAEGFALGPLVLAV-RVLG---------------
1bo4B           AVALYTK--------------------------------
3d3sD           FAGLAGERGAHVSEQPFDELLRIGPF-------------
2d4pA           LEEALKAEGFALGPLVLAV-RVLG---------------
1bobA           FDDLRDRNDIQRLRKLG--YDAVFQKHSDLSDEFLESS-
2atrA           KNVGFYRSGFEILSTYDCTGIWIN---------------
2aj6A           ---------------------------------------