[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for sent8:ACF68340.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bwuF.bssp"
#ERROR : Can't open dsspfile "3bfqG.bssp"

## Summary of PDB Search
:172
    7e-25  39%  3bwuF  [x.x.x] PROTEIN FIMF
    6e-23  32%  3bfqG  [x.x.x] PROTEIN FIMG
:172

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNTCSLSPGSENINVAMGAVSQRQFYRAGDGSAWQPFA
3bwuF           ------------------------------------------------GCSVAAESTNFIGATTPVVPFR
3bfqG           ---------------------------------KPCTVSTT--NATVDLGDLYSFSLMSAGAASAWHDVA


                         .         .         *         .         .         .         .:140
query           IDLQNCGSTASGVTVSFSGAADSRNTDLLALTAGESDASGIGIALYDQNKTLIPLGQESDVVTLSPGQAS
3bwuF           ILLSPCGNAVSAVKVGFTGVADSHNANLLALENTVSAASGLGIQLLNEQQNQIPLNAPSSALSWTTPGKP
3bfqG           LELTNCPVGTSRVTASFSGAADSTGYYKNQ-----GTAQNIQLELQDDSGNTLNTGATK-TVQVDDSSQS


                         +         .         .         .         .         *         .:210
query           AHLQFYARYLADGGAVTPGDANASATFILAYE
3bwuF           NTLNFYARLMATQVPVTAGHINATATFTLEYQ
3bfqG           AHFPLQVRALTVNGGATQGTIQAVISITYTY-