[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for sent8:ACF68451.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2detA.bssp"
#ERROR : Can't open dsspfile "2derB.bssp"
#ERROR : Can't open dsspfile "2derA.bssp"
#ERROR : Can't open dsspfile "2deuA.bssp"
#ERROR : Can't open dsspfile "3dlaC.bssp"
#ERROR : Can't open dsspfile "3dlaD.bssp"
#ERROR : Can't open dsspfile "1ebfA.bssp"
#ERROR : Can't open dsspfile "3dlaB.bssp"
#ERROR : Can't open dsspfile "2dplA.bssp"
#ERROR : Can't open dsspfile "2e89D.bssp"
#ERROR : Can't open dsspfile "2dplB.bssp"
#ERROR : Can't open dsspfile "3a4iA.bssp"
#ERROR : Can't open dsspfile "2e21B.bssp"
#ERROR : Can't open dsspfile "2e21A.bssp"
#ERROR : Can't open dsspfile "2c5sA.bssp"
#ERROR : Can't open dsspfile "1bsuB.bssp"
#ERROR : Can't open dsspfile "3dpiA.bssp"
#ERROR : Can't open dsspfile "2e18A.bssp"
#ERROR : Can't open dsspfile "3bl5E.bssp"
#ERROR : Can't open dsspfile "3b9xC.bssp"
#ERROR : Can't open dsspfile "1ee1B.bssp"
#ERROR : Can't open dsspfile "3dlaA.bssp"
#ERROR : Can't open dsspfile "2d13C.bssp"
#ERROR : Can't open dsspfile "1bgbB.bssp"
#ERROR : Can't open dsspfile "3bl5A.bssp"
#ERROR : Can't open dsspfile "2d13A.bssp"
#ERROR : Can't open dsspfile "3b9xA.bssp"
#ERROR : Can't open dsspfile "3dpiB.bssp"
#ERROR : Can't open dsspfile "2d13B.bssp"
#ERROR : Can't open dsspfile "3b9xD.bssp"
#ERROR : Can't open dsspfile "1b97A.bssp"
#ERROR : Can't open dsspfile "2d13D.bssp"

## Summary of PDB Search
:368
    e-121  89%  2detA  [x.x.x] TRNA-SPECIFIC 2-THIOURIDYLASE MNMA
    e-115  88%  2derB  [x.x.x] TRNA-SPECIFIC 2-THIOURIDYLASE MNMA
    7e-86  91%  2derA  [x.x.x] TRNA-SPECIFIC 2-THIOURIDYLASE MNMA
    3e-84  93%  2deuA  [x.x.x] TRNA-SPECIFIC 2-THIOURIDYLASE MNMA
    6e-36  10%  3dlaC  [x.x.x] GLUTAMINE-DEPENDENT NAD(+) SYNTHETASE
    1e-33  10%  3dlaD  [x.x.x] GLUTAMINE-DEPENDENT NAD(+) SYNTHETASE
    1e-32  16%  1ebfA  [c.2.1 - d.81.1] HOMOSERINE DEHYDROGENASE
    8e-31   9%  3dlaB  [x.x.x] GLUTAMINE-DEPENDENT NAD(+) SYNTHETASE
    4e-28  17%  2dplA  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B
    5e-28  10%  2e89D  [x.x.x] TRNA(ILE)-LYSIDINE SYNTHASE
    1e-27  16%  2dplB  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B
    1e-27  16%  3a4iA  [x.x.x] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT B
    2e-27  11%  2e21B  [x.x.x] TRNA(ILE)-LYSIDINE SYNTHASE
    7e-27  11%  2e21A  [x.x.x] TRNA(ILE)-LYSIDINE SYNTHASE
    8e-27  16%  2c5sA  [x.x.x] PROBABLE THIAMINE BIOSYNTHESIS PROTEIN THII
    5e-25   8%  1bsuB  [c.52.1] ENDONUCLEASE ECORV (3.1.21.4)
    4e-23  14%  3dpiA  [x.x.x] NAD+ SYNTHETASE
    5e-21  24%  2e18A  [x.x.x] NH(3)-DEPENDENT NAD(+) SYNTHETASE
    5e-20  16%  3bl5E  [x.x.x] QUEUOSINE BIOSYNTHESIS PROTEIN QUEC
    6e-20   9%  3b9xC  [x.x.x] PYRIMIDINE-SPECIFIC RIBONUCLEOSIDE HYDROLASE
    2e-19  10%  1ee1B  [c.26.2] NH(3)-DEPENDENT NAD(+) SYNTHETASE
    6e-16   8%  3dlaA  [x.x.x] GLUTAMINE-DEPENDENT NAD(+) SYNTHETASE
    6e-16  14%  2d13C  [x.x.x] HYPOTHETICAL PROTEIN PH1257
    3e-15   9%  1bgbB  [c.52.1] ECORV ENDONUCLEASE
    3e-15  16%  3bl5A  [x.x.x] QUEUOSINE BIOSYNTHESIS PROTEIN QUEC
    7e-13  14%  2d13A  [x.x.x] HYPOTHETICAL PROTEIN PH1257
    1e-12  10%  3b9xA  [x.x.x] PYRIMIDINE-SPECIFIC RIBONUCLEOSIDE HYDROLASE
    2e-12  17%  3dpiB  [x.x.x] NAD+ SYNTHETASE
    6e-12  19%  2d13B  [x.x.x] HYPOTHETICAL PROTEIN PH1257
    9e-11  11%  3b9xD  [x.x.x] PYRIMIDINE-SPECIFIC RIBONUCLEOSIDE HYDROLASE
    1e-10  11%  1b97A  [c.52.1] RESTRICTION ENDONUCLEASE ECORV
    6e-08  15%  2d13D  [x.x.x] HYPOTHETICAL PROTEIN PH1257
:368

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxSPKKXXXXXXXXXXXXXXAWLLQQQGYQVEGLFMKNWEEDDGEEYCTXXXXXXXXXXVCDKLGIELH
2detA           ---TAKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIELH
2derB           ---TAKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIELH
2derA           ---------------------AWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIELH
2deuA           ---------------------AWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIELH
3dlaC           ---------------------LIVATHAMDREGRPRSDILAFALPGFK-------NNAIKLARALGVTFS
3dlaD           ---------------------LIVATHAMDREGRPRSDILAFALPG--------FNNAIKLARALGVTFS
1ebfA           ---------------------LISKDFSPLNVGS----DWKAALAASTTKTLPLDDLIAHLKTSPKPVIL
3dlaB           ---------------------LIVATHAMDREGRPRSDILAFALPGK--------NNAIKLARALGVTFS
2dplA           ---------------------AVLAHKAIGDRLHAVFVNTGFLRKGEPE------FVVKTFRDEFGMNLH
2e89D           ---------------------TDVLLKLKNYFSLKEVALAHFNHMLRESAERDEEFCKE-FAKERNMKIF
2dplB           ---------------------AVLAHKAIGDRLHAVFVNTGFLRKGEP------EFVVKTFRDEFGMNLH
3a4iA           ---------------------VLAHKAIGDRLHAVFVNTGFLRKGEPE-------FVVKTFRDEFGMNLH
2e21B           ---------------------TDVLLKLKNYFSLKEVALAHFNHMLRESAERDEEFCKE-FAKERNMKIF
2e21A           ---------------------TDVLLKLKNYFSLKEVALAHFNHMLRESAERDEEFCKE-FAKERNMKIF
2c5sA           ---------------------AYLTMKRGVSVEAVHFHSPPFTSERAK-------QKVIDLAQELTKYCK
1bsuB           ---------------------SDLINALYDDVCGIISAEGKIYPLGS------DTKVLSTIFELFSRPII
3dpiA           ---------------------GRLAQLAVERLRASGYDARFVAMR---LPYGAEADARRALAFVRADETL
2e18A           ---------------------AYLATKAKEKVLGLIMPYFENKDVED----------AKLVAEKLGIGYK
3bl5E           ---------------------LLWALKEFEEVETVTFHYNQRHSQEV--------EVAKSIAEKLGVKNH
3b9xC           ---------------------MMAAKHPAIDLLGITIVAGNQTLDKTL-------INGLNVCQKLEINVP
1ee1B           ---------------------GRLAQLAVESIREEGGDAQF-IAVRLPHGEDDAQLALKFIKPDKSWKFD
3dlaA           ---------------------LIVATHAMDREGRPRSDILAFALPGH------TKNNAIKLARALGVTFS
2d13C           ---------------------LYWALKSGLRVRYLVSMVSEELTSL--------------QARALGIPII
1bgbB           ---------------------VCGIISAEGKIYPLGS--------DTKVLSTIFELFSRPIINKIAEKHG
3bl5A           ---------------------LLWALKEFEEVETVTFHYNQRHSQEVEV--------AKSIAEKLGVKNH
2d13A           ---------------------LYWALKSGLRVRYLVSMVSENNVELTSLQARALGIPIIKGFTEKEKDLK
3b9xA           ---------------------MMAAKHPAIDLLGITIVAGNQTLDKTL-------INGLNVCQKLEINVP
3dpiB           ---------------------GRLAQLAVERLRASGYDAR--FVAMRLPYGAQEADARRALAFVRADETL
2d13B           ---------------------LYWALKSGLRVRYLVSMVSENVE------------LTSLQARALGIPII
3b9xD           ---------------------MMAAKHPAIDLLGITIVAGNQTLDKTLI-------NGLNVCQKLEINVP
1b97A           ---------------------LGSDTKVLSTIFELFSRPIINKIAE--------------KHGYIVEEPK
2d13D           ---------------------LYWALKSGLRVRYLVSMVSLTSL----------------QARALGIPII


                         .         .         *         .         .         .         .:140
query           TVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVNGKSR
2detA           TVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSR
2derB           TVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSR
2derA           TVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSR
2deuA           TVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVDGKSR
3dlaC           EIDIG-DTARLMLHTIGHPYSVGEKVYDVTFENVQAGLRTDLFRIANQRGGIVLGTGD------------
3dlaD           EIDIG-DTARLMLHTIGHPYSVGEKVYDVTFENAGLRTDYLFRIANQ-RGGIVLGTGDWSTYGVGDQMSH
1ebfA           VDNTSSAYIAGFYTKFVENGISIATPNKKAFSSDLATWKALFS-NKPTNGFVYHEATVGLREIIQTGDEV
3dlaB           EID-----IGDTARLMLHTIGHVTFEN----VQAGLRTDYLFRIANQ-RGGIVLGTGD------------
2dplA           YVDA--------QDRFFSALKGVTDPEEKRKIIGRVFIEVFEEVAKK-IGAEYLIQGTIAP----LNLKL
2e89D           VGKEDVRAFA------------KENRMSLEEAGRFLRYKFLKEILES-EGFDCIATAHHLNDLLETSLLF
2dplB           YVDAQDR--------FFSALKGVTDPEEKRKIIGRVFIEVFEEVAK-KIGAEYLIQGTILK----LIEPL
3a4iA           YVDA--------QDRFFSALKGVTDPEEKRKIIGRVFIEVFEEVAKK-IGAEYLIQGTIAP--NLKLIEP
2e21B           VGKEDVRAF------------AKENRMSLEEAGRFLRYKFLKEILES-EGFDCIATAHHLNDLLETSLLF
2e21A           VGKEDVRAFA------------KENRMSLEEAGRFLRYKFLKE-ILESEGFDCIATAHHLNDLLETSLLF
2c5sA           RVTLHLVPFTEVQK----TINKEIPSSYSMTVMRRMMMR-ITERIAEERNALAITTGES-----------
1bsuB           NKIAEKHGYIVEEPKQQNHYPDFTLYKPSENKKIAIDIKTTYTNIFTLGGYTSFIRNNTKNIV-------
3dpiA           TVDV-----KPAADAMLAALAAGGLAQQDFVLGARERMIAQYAVAGA-RNGVVIGTDHA-----------
2e18A           VIN-----IKPIVDSFVENLEL--NLDRKGLGNIMSRTRMIMLYAANSLGRIVLGTSNR-----------
3bl5E           LLDMS----------LLNQLAPNALTSTFVPGRNLVFLSFASILAYQ-IGARHIITGVCETDFSGYP---
3b9xC           VYAGMPIMRQQIVATGLDGPVFEPLTRQAESTHAVKYIIDTLM--ASDGDITLVPVGPL---SNIAVAMR
1ee1B           IKSTVSAFSDQYQQET------GDQLTDFNKGNVKARTRMAQYAIGGQEGLLVLGTDHA-----------
3dlaA           EIDI-----GDTARLMLHTIGHDVTFEN---VQAGLRTDYLFRIANQ-RGGIVLGTGD------------
2d13C           KGFTKKEVEDLKNVLE---GLKVDGIVAGALASR-YQKERIENVARE-LGLKVYTPAWE--KDPYQYMLE
1bgbB           YIVE-----EPKQQNHYPDFTLYKPSEPNKKIAIDIKTTYT--------NKIKFTLGGYTSFI-------
3bl5A           LLDMSLLNQ----------LAPNALTSTFVPGRNLVFLSFASILAYQ-IGARHIITGVCEGYPDCR----
2d13A           NVLEGLKVDGIVAGALASRYQKERIENVARELGLKVYTPAWEKDP-YQYMLEIIKLGFKVVFVAVSAYGE
3b9xA           VYPIMRQQIVADNIHGDTGLDGPVFEPLTRQAESTHAVKYIIDTLMASDGITLVPVGPLSNIA------V
3dpiB           TVDV-----KPAADAMLAALAAGGLAQQDFLGNIKARERMIAQYAAGARNGVVIGTDHA-----------
2d13B           KGFTEVEDLKNVLEGLKVALQKERIENVARELGLKVYTPAW-EKDPYQYMLEIIKLGFKVVFVAVSAYG-
3b9xD           VYAGMQPIMRQQIVAIHGDTGLDGPVFEPLTAESTHAVKYIIDTLASDGDITLVPVGPL-----------
1b97A           QLNHYPDFT--LYKPSEPNKKIAIDIKTTYTNKENEKIKFTLGGYNNTKNIVYPFDQYIA----------
2d13D           KGFTVEDLKNVLEGLLASRYQKERIENVARELGLKVYTPAWEK-DPYQYMLEIIKLGFKVV---------


                         +         .         .         .         .         *         .:210
query           LLRGLDGNKDQSYFLYTLGHEQIAQSLFPVGELEKPQVRKIAEDLGLVTAKKKDSTGICFIGERKFRDFL
2detA           LLRGLDSNKDQSYFLYTLSHEQIAQSLFPVGELEKPQVRKIAEDLGLVTAKKKDSTGICFIGERKFREFL
2derB           LLRGLDSNKDQSYFLYTLSHEQIAQSLFPVGELEKPQVRKIAEDLGL------VTTGICFIGERKFREFL
2derA           LLRGLDSNKDQSYFLYTLSHEQIAQSLFPVGELEKPQVRKIA----------------EDLGLVKFREFL
2deuA           LLRGLDSNKDQSYFLYTLSHEQIAQSLFPVGELEKPQVRKIAEDLGLVTAKKKDSTGICFIGERKFREFL
3dlaC           -------LSELALGWSTYGVGDQMSHYNVNAGVPKTLIQHLIRWVISAGEFGEKVGEVLQSVLDTEAKVG
3dlaD           YNVNAGVPKTLIQHLVISAGEFGEKVGEVLQSVLDTEEAKVGPFLFQVLRYGFRPSKIAFLAWHAWNDAE
1ebfA           EKIEGIFSGTLSYIFNEFSTSQANDVKFSDVKLGYTEPDPRDDLNGLVARKVTIVGRISGVEVESPTSFP
3dlaB           -------LSELALGWSTYGVGDQMSHYNVNAGVPKTLIQHLIRWVISAGEFGEKVGEVL-------QSVL
2dplA           IEPLRDLYKDEVRELLGLPEKIYNRMPFPGPGLAVRVIGEVTPEKI----RIVREANAIVEEEVERAGLR
2e89D           FTRGTGLDGLIGFL------PKEEVIRRPLYYVKRSEIEEYAKFKGLRWVEDETNYEVSIPRNRIRHRVI
2dplB           RDLYKDEVRELAKFL-GLPEKIYNRMPFPGPGLAVRVIGEVTPEKIRIVREANAIVEVERAGLRPWQAFA
3a4iA           LDLYKDEVRELAKFLGL-PEKIYNRMPFPGPGLAVRVIGEVTPEKIR----IVREANAIVEEEVERAGLR
2e21B           FTRGTGLDGLIGFLPKEEVI------RRPLYYVKRSEIEEYAKFKGLRWVEDETNYEVSIPRNRIRHRVI
2e21A           FTRGTGLDGLIGFLPKEEVI------RRPLYYVKRSEIEEYAKFKGLRWVEDETNYEVSIPRNRIRHRVI
2c5sA           ----LGQVASQTLDSMHTINEVTYPVIRPLITMDKLEIIKIAEEIGTYDISIRPYKPKREKANRDFTPLI
1bsuB           YPFDQYIAHWIIGY------------VYTRVSLKTYNINELNEIPKPYLQDKWVIAGDLA----------
3dpiA           ---------AESVMGFFTKFGDGGADVLPLAGLTKRRVRALARMLGADLVLKTPTADLETLRPQRPHAYG
2e18A           ---------SEFLTGYFTKWGDGASDYAPIINLYKTEVWEIAKRIGVRIVKKKPSAGLWEISYNLLDEIL
3bl5E           --DCRDEFVKSCNVTVNLAMEKPFVIHTPLMWLNKAETWKLADELGALDFVKNNTLPACHLRSKGYEEYM
3b9xC           MQPAILPKIREIVLMGGAYGTGNFTPSAEFNIFADPEAARVVFTSGPLVMMGLDLTNQTVCTPGPAGELF
1ee1B           ---------AEAVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAP----ERLYLISYDEIDDYLEGK
3dlaA           -------LSELALGWSTYGVGDQMSHYNVNAGVPKTLIQHLIRWVISAGEFGEKVGEVL-------QSVL
2d13C           IIKLGFKVVFVAVSAYGLNESWLGRELHIAGEGGEFETFVLDMKIVIDDAEKFWDGLSGKF---------
1bgbB           ----RNNTKNIVYPFDQYIAHWIIGYVYTRVSLKTYNINELNEIPKP-----------------------
3bl5A           -----DEFVKSCNVTVNLAMEKPFVIHTPLMWLNKAETWKLADELGALDFVKNNTLPACHLRSKGYEEYM
2d13A           SWLGRELNYKNLEELKKLSEKYGIHIAGEGGEFETFVL--------------------------------
3b9xA           AMRMQPAILPKIREIVLMGGAYGTGNFTPSAEFADPEAARVVFTSGV-----------------------
3dpiB           -------AESVMGADV-----------LPLAGLTKRRVRALARMLGADEPAYGITYEQIDD---------
2d13B           LNESWLG-RELNY-----------KNLEELKKLSEKYGIHIAGEGGE-----------------------
3b9xD           ------SNIAVAMRMQPAILPKIREIVLMGGAYGTGNFTPSAE---------------------------
1b97A           -------HWIIGYVYTRV--------ATRKSSLKTYNINELNEIPKPYKGVKVF----------------
2d13D           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKDGSEDPWYVVDKDVENNVLIVAQGHEHP
2detA           GRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKEGTEEPWYVVDKDVENNILVVAQGHEHP
2derB           GRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKEGTEEPWYVVDKDVENNILVVAQGHEHP
2derA           GRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKEGTEEPWYVVDKDVENNILVVAQGHEHP
2deuA           GRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKEGTEEPWYVVDKDVENNILVVAQGHEHP
3dlaC           PFALQDFSLFQVLRYGFRPSKIAFLAWHAWNDAERGNWPPGFPKSERPSYSLAEIRHWLQIFVQRFYSFS
3dlaD           RGNWPPGFPKSERPSYSHWLQIFVQRFYSFSQFKRSALPN---GPKVSHGGALSPRGDWRAPSDMSARIW
1ebfA           VQSLIPKPLESVK-SADEFLEKLSDYDKDLTQLKKEAAT----ENKVLRFIGKVDVATKSVSVKYDYSHP
3dlaB           DTEITSEA------KVGPFALQDFSLFQVL--RYGFRPSKI----AFLAWHAWNDAERGNWPPGFPKSER
2dplA           PWQAFAVLLGVKTV---GVQGDIRAYKETIAVRIVESIDGTANAMNVPWEVLQRIAFRITSEIPEVGRVL
2e89D           PELKRINEVKVLRAEREFLEEEAQKLYKEVKKGNCLDVKKLK-----EKPLALQRRVIRKFIGEKDYEKV
2dplB           VLLGVKTVGVQ---------GDIRAYKETIAVRIVESI----DGMTANAMNVPWEVLQRIAFRITSEIPE
3a4iA           PWQAFAVLLGVKTV---GVQGDIRAYKETIAVRIVESIDGTANAMNVPWEVLQRIAFRITSEIPEVGRVL
2e21B           PELKRINEVKVLRAEREFLEEEAQKLYKEVKKGNCLDVKKLK-----EKPLALQRRVIRKFIGEKDYEKV
2e21A           PELKRINEVKVLRAEREFLEEEAQKLYKEVKKGNCLDVKKLK-----EKPLALQRRVIRKFIGEKDYEKV
2c5sA           DEAVAKETMVLQTVE-------------------------------------------------------
1bsuB           ----------------------------------------------------------------------
3dpiA           ITYQIDDFLEGKPMDDAVAETVLRFYDATRHKRA------------------------------------
2e18A           WRMIDIGKEEIAKIPLSLVERVEELIKKSEHKRR------------------------------------
3bl5E           ----------------------------------------------------------------------
3b9xC           SDPVHDATCIGYLINPDGIKTQEMYVEVDVNSGPCYG---------------------------------
1ee1B           EVSAKVSEALEKRYSMTEHRQVPASMFDDWWK--------------------------------------
3dlaA           DTEITAKVGPFALQDFSLFQVLRYGFRPSKIAFLAWHAWNDAERGNWPPGFPKSERP-------------
2d13C           ----------------------------------------------------------------------
1bgbB           ----------------------------------------------------------------------
3bl5A           ----------------------------------------------------------------------
2d13A           ----------------------------------------------------------------------
3b9xA           ----------------------------------------------------------------------
3dpiB           ----------------------------------------------------------------------
2d13B           ----------------------------------------------------------------------
3b9xD           ----------------------------------------------------------------------
1b97A           ----------------------------------------------------------------------
2d13D           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RLMSVGLIAQQLHWVDREPFTGTLRCTVKTRYRQTDIPCTINALDDDRIEVIFDEPVAAVTPGQSAVFYS
2detA           RLMSVGLIAQQLHWVDREPFTGTMRCTVKTRYRQTDIPCTVKALDDDRIEVIFDEPVAAVTPGQSAVFYN
2derB           RLMSVGLIAQQLHWVDREPFTGTMRCTVKTRYRQTDIPCTVKALDDDRIEVIFDEPVAAVTPGQSAVFYN
2derA           RLMSVGLIAQQLHWVDREPFTGTMRCTVKTRYRQTDIPCTVKALDDDRIEVIFDEPVAAVTPGQSAVFYN
2deuA           RLMSVGLIAQQLHWVDREPFTGTMRCTVKTRYRQTDIPCTVKALDDDRIEVIFDEPVAAVTPGQSAVFYN
3dlaC           QFKRSALNGPKVSHGGALSPRGDWRAPSDMSARI------------------------------------
3dlaD           ----------------------------------------------------------------------
1ebfA           ----------------------------------------------------------------------
3dlaB           PSYSLAEIRHWLQIFV-----QRFYSFSQFKRSALPNGPKVSHGGALSPRGDWRAPSD------------
2dplA           YDITNKPPA-------------------------------------------------------------
2e89D           LLEKGGEVNLGKGKVLK-----------------------------------------------------
2dplB           VGRVL-------YDITNKP-PATIEF--------------------------------------------
3a4iA           YDITNKPPA-------------------------------------------------------------
2e21B           ELVRSLLEKG------------------------------------------------------------
2e21A           ELVRSLLEK---GGEVNLGK----GKVLKRKERW------------------------------------
2c5sA           ----------------------------------------------------------------------
1bsuB           ----------------------------------------------------------------------
3dpiA           ----------------------------------------------------------------------
2e18A           ----------------------------------------------------------------------
3bl5E           ----------------------------------------------------------------------
3b9xC           ----------------------------------------------------------------------
1ee1B           ----------------------------------------------------------------------
3dlaA           ----------------------------------------------------------------------
2d13C           ----------------------------------------------------------------------
1bgbB           ----------------------------------------------------------------------
3bl5A           ----------------------------------------------------------------------
2d13A           ----------------------------------------------------------------------
3b9xA           ----------------------------------------------------------------------
3dpiB           ----------------------------------------------------------------------
2d13B           ----------------------------------------------------------------------
3b9xD           ----------------------------------------------------------------------
1b97A           ----------------------------------------------------------------------
2d13D           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GEVCLGGGIIEQRLPLTV
2detA           GEVCLGGGIIEQRLPLPV
2derB           GEVCLGGGIIEQRLPLPV
2derA           GEVCLGGGIIEQRLPLPV
2deuA           GEVCLGGGIIEQRLPLPV
3dlaC           ------------------
3dlaD           ------------------
1ebfA           ------------------
3dlaB           ------------------
2dplA           ------------------
2e89D           ------------------
2dplB           ------------------
3a4iA           ------------------
2e21B           ------------------
2e21A           ------------------
2c5sA           ------------------
1bsuB           ------------------
3dpiA           ------------------
2e18A           ------------------
3bl5E           ------------------
3b9xC           ------------------
1ee1B           ------------------
3dlaA           ------------------
2d13C           ------------------
1bgbB           ------------------
3bl5A           ------------------
2d13A           ------------------
3b9xA           ------------------
3dpiB           ------------------
2d13B           ------------------
3b9xD           ------------------
1b97A           ------------------
2d13D           ------------------