[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for sent8:ACF68510.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3b8pB.bssp"
#ERROR : Can't open dsspfile "3b8pC.bssp"
#ERROR : Can't open dsspfile "3b8pD.bssp"
#ERROR : Can't open dsspfile "2e3sA.bssp"
#ERROR : Can't open dsspfile "2cfoA.bssp"
#ERROR : Can't open dsspfile "3b8pA.bssp"
#ERROR : Can't open dsspfile "2d5bA.bssp"
#ERROR : Can't open dsspfile "2cfoB.bssp"
#ERROR : Can't open dsspfile "2d54A.bssp"
#ERROR : Can't open dsspfile "2choB.bssp"
#ERROR : Can't open dsspfile "1a8hA.bssp"
#ERROR : Can't open dsspfile "2bteA.bssp"
#ERROR : Can't open dsspfile "2ct8A.bssp"
#ERROR : Can't open dsspfile "1bs2A.bssp"
#ERROR : Can't open dsspfile "1d2rA.bssp"
#ERROR : Can't open dsspfile "3b8pE.bssp"
#ERROR : Can't open dsspfile "2ag6A.bssp"
#ERROR : Can't open dsspfile "2csxA.bssp"
#ERROR : Can't open dsspfile "3c8zA.bssp"
#ERROR : Can't open dsspfile "3c8zB.bssp"
#ERROR : Can't open dsspfile "2azxA.bssp"
#ERROR : Can't open dsspfile "3blxP.bssp"
#ERROR : Can't open dsspfile "2dlcX.bssp"
#ERROR : Can't open dsspfile "3dpjF.bssp"
#ERROR : Can't open dsspfile "2akeA.bssp"
#ERROR : Can't open dsspfile "3dpjB.bssp"
#ERROR : Can't open dsspfile "3dpjE.bssp"
#ERROR : Can't open dsspfile "2cycA.bssp"
#ERROR : Can't open dsspfile "3d6uA.bssp"
#ERROR : Can't open dsspfile "3dpjA.bssp"
#ERROR : Can't open dsspfile "2cyaA.bssp"

## Summary of PDB Search
:555
    1e-48   7%  3b8pB  [x.x.x] CHAIN LENGTH DETERMINANT PROTEIN
    2e-44   8%  3b8pC  [x.x.x] CHAIN LENGTH DETERMINANT PROTEIN
    2e-44  10%  3b8pD  [x.x.x] CHAIN LENGTH DETERMINANT PROTEIN
    3e-44  10%  2e3sA  [x.x.x] LIPID-TRANSFER PROTEIN CERT
    1e-43  20%  2cfoA  [x.x.x] GLUTAMYL-TRNA SYNTHETASE
    1e-43   8%  3b8pA  [x.x.x] CHAIN LENGTH DETERMINANT PROTEIN
    2e-43  12%  2d5bA  [x.x.x] METHIONYL-TRNA SYNTHETASE
    2e-43  20%  2cfoB  [x.x.x] GLUTAMYL-TRNA SYNTHETASE
    2e-40  13%  2d54A  [x.x.x] METHIONYL-TRNA SYNTHETASE
    1e-39  10%  2choB  [x.x.x] GLUCOSAMINIDASE
    2e-39  13%  1a8hA  [x.x.x] METHIONYL-TRNA SYNTHETASE
    3e-36  17%  2bteA  [x.x.x] LEUCYL-TRNA SYNTHETASE
    6e-35  11%  2ct8A  [x.x.x] METHIONYL-TRNA SYNTHETASE
    3e-34  10%  1bs2A  [d.67.2 - c.26.1 - a.27.1] PROTEIN (ARGINYL-TRNA SYNTHETASE)
    2e-33  11%  1d2rA  [c.26.1] PROTEIN (TRYPTOPHANYL TRNA SYNTHETASE)
    4e-33  10%  3b8pE  [x.x.x] CHAIN LENGTH DETERMINANT PROTEIN
    4e-33  13%  2ag6A  [x.x.x] TYROSYL-TRNA SYNTHETASE
    1e-32  13%  2csxA  [x.x.x] METHIONYL-TRNA SYNTHETASE
    3e-30   9%  3c8zA  [x.x.x] CYSTEINYL-TRNA SYNTHETASE
    4e-29  10%  3c8zB  [x.x.x] CYSTEINYL-TRNA SYNTHETASE
    2e-28   9%  2azxA  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    7e-24  15%  3blxP  [x.x.x] ISOCITRATE DEHYDROGENASE [NAD] SUBUNIT 2
    2e-19   7%  2dlcX  [x.x.x] TYROSYL-TRNA SYNTHETASE, CYTOPLASMIC
    6e-15  11%  3dpjF  [x.x.x] TRANSCRIPTION REGULATOR, TETR FAMILY
    4e-13  12%  2akeA  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    1e-07  11%  3dpjB  [x.x.x] TRANSCRIPTION REGULATOR, TETR FAMILY
    2e-06  11%  3dpjE  [x.x.x] TRANSCRIPTION REGULATOR, TETR FAMILY
    3e-06  13%  2cycA  [x.x.x] TYROSYL-TRNA SYNTHETASE
    4e-05  19%  3d6uA  [x.x.x] TYROSYL-TRNA SYNTHETASE
    6e-04  13%  3dpjA  [x.x.x] TRANSCRIPTION REGULATOR, TETR FAMILY
    0.001  19%  2cyaA  [x.x.x] TYROSYL-TRNA SYNTHETASE
:555

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxNFIRQIIDEDLASGKHTTVHTRFPPEPNGYLHIGHAKSICLNFGIAQDYQGQCNLRFDDTN
3b8pB           ----------------------------------------------------------------------
3b8pC           ----------------------------------------------------------------------
3b8pD           ----------------------------------------------------------------------
2e3sA           ----------------------------------------------------------------------
2cfoA           --------------------------TVRVRLAPSPTGNLHIGTARTAVFNWLYARHRGGKFILRIEDTD
3b8pA           ----------------------------------------------------------------------
2d5bA           -----------------------EKVFYVTTPIYYVNAEPHLGHAYTTVVADFLAHRLDGYRTFFTDEHG
2cfoB           --------------------------TVRVRLAPSPTGNLHIGTARTAVFNWLYARHRGGKFILRIEDTD
2d54A           -----------------------EKVFYVTTPIYYVNAEPHLGHAYTTVVADFLAHRLDGYRTFFLTGTD
2choB           ---------GDKLNPSIQIMWTGDRVISDITRDGISWINERIKRPAYIWWNFPVSDYVRDHLLLGPVYGN
1a8hA           -----------------------EKVFYVTTPIYYVNAEPHLGHAYTTVVADFLAHRLDGYRTFFAAGED
2bteA           -----------------KDLPGGRGKQYVLVMFPYPSGDLHMGHLKNYTMGDVLARRMQGYEVLHWDAFG
2ct8A           ---------------------TLMKKFYVTTPIYYVNDVPHLGHAYTTIAADTIAYRLRDYDVFFTDEHG
1bs2A           ----------------------ENKKVIIEFSSPNIAKPFHAGHLRSTIIGGFLAYEKLGWEVIRMNYLG
1d2rA           -----------------------------IFSGIQPSGVITIGNYIGALRQFVELQHEYNCYFCIVDQHQ
3b8pE           ----------------------------------------------------------------------
2ag6A           ----------ISEEELREVLKKDE---KSALIGFEPSGKIHLGHYLQIKKMIDLQNAGFDIIILLADLHG
2csxA           ---------------------TLMKKFYVTTPIYYVNDVPHLGHAYTTIAADTIAYRLRDYDVFFTDEHS
3c8zA           ----------FDSADRQVRPVTPGPTATMYVCGITPYDATHLGHAATYLTFDLVHTDVDDPLFERAERDG
3c8zB           ----------------------PGPTATMYVCGITPYDATHLGHAATYLTFDLVHRDVDDPLFERAERDG
2azxA           ---------GIFFSHRDNQVAYENKKPFYLYTGRGPSSEAHVGHLIPFIFTKWLQDVFNVPLVIQTDDEL
3blxP           ------------------------------------------------------------------DGIG
2dlcX           -----------------------QKRHLKLYWGTAPTGRPHCGYFVPMTKLADFLKAGCEVTVLLADLHA
3dpjF           ----------------------------------------------------------------------
2akeA           ---------GIFFSHRDMNYENKKPFYLYTGR--GPSSAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDE
3dpjB           ----------------------------------------------------------------------
3dpjE           ----------------------------------------------------------------------
2cycA           -------------ENLRHLFEIGAPLQHYI--GFEISGYIHLGTGLMAGAKIADFQKAGIKTRVFLADWH
3d6uA           -----------TSEIISEEVLKKDEKSAIIGF--EPSGKIHLGHYLQIKKMI-DLQNAGFDIIIYLNQKG
3dpjA           ----------------------------------------------------------------------
2cyaA           -----------TVEIVTEELASGARIKGYIGY--EPSGVAHIGWLVWM-YKVKDLVEAGVDFSVLEATND


                         .         .         *         .         .         .         .:140
query           PVKEDIEYVDSIKNDVEWLGFHWSGDIRYSSDYFDQLHAYAVELINKGLAYVDELTPEQIREYRGTLTAP
3b8pB           ----------------------------------------------------------------------
3b8pC           ----------------------------------------------------------------------
3b8pD           ----------------------------------------------------------------------
2e3sA           ----------------------------------------------------------------------
2cfoA           RERSRPEYTENILEGLQWLGLTWDEGPYFQSDRLDLYRQAIQTLLDKGLAYYCYCTPEELEALRAEQKAK
3b8pA           ----------------------------------------------------------------------
2d5bA           ETVYRARVSGRFKRAWDLLGIAYDFIRTTEERHKKVVQLVLKKVYEAGDIYYGEYEGLYCVSCERFYTEK
2cfoB           RERSRPEYTENILEGLQWLGLTWDEGPYFQSDRLDLYRQAIQTLLDKGLAYYCYCTPEELEALRAEQKAK
2d54A           EHGETVYVSGRFKRAWDLLGIAYDDFITTEERHKKVVQLVLKKVYEAGDIYYEGLYCVSCERFYTEKELV
2choB           DTTIAKEMSGFVTNPMEHAESSKIAIYSVASYAWNPAKYDTWQTWKDAIRTILPSAAEELECFAMHNSDL
1a8hA           PKAFVDRVSGRFKRAWDLLGIAYDDFIRTTEERHKKVVQLVLKVYEAGDIYYGEYEGLYCVSCERFYTEK
2bteA           LPAENAANIRQAKESLRLMGILYDWDREVTTEYYRWNQWIFLKMWEKGLAYRAKGLVNWCPKCQTVLANE
2ct8A           LKIQVDRNAERFKKLWEFLKIEYTKFIRTDPYHVKFVQKVFEECYKRGDIYLGEYEKEPSYFFRLSKYQD
1bs2A           DWG---KQFGLLAVGFERYGNEEALVKDPIHHLFDVYVRINKDIEEEGDSIPLEQSTNGKAREY------
1d2rA           DPHELRQNIRRLAALYLAVGIDPTQATLFIQSEVPAHAQAAWMLQCIVYIGELERMTQFKEKSAGAAAAY
3b8pE           ----------------------------------------------------------------------
2ag6A           ELDEIRKIGDYNKKVFEAMGLKAKYVYGSSFQLDKDYTLNVYRLALKTTLKRARRSMELIAREDENPKVA
2csxA           PKELVDRNAERFKKLWEFLKIEYTKFIRTDPYHVKFVQKVFEECYKRGDIYLGEYKEPSYFFRLSKYQDK
3c8zA           IDWRTDRETQLFREDMAALRVLPPHDYVAATDAIAEVVEMVEKLLASGAAYIVEDAEYPDVYFRADA---
3c8zB           IDWRTLRETQLFREDMAALRVLPPHDYVAATDAIAEVVEMVEKLLASGAAYIVEDAEYPDVYFRADA---
2azxA           TLDQAYGDAVENAKDIIACGFDINKTFIFSDLDYGSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCI---
3blxP           P-----EISKSVKKIFSAANVPIEWESCDVSPIF----------VNGLTTIPDP-AVQSITKNLVALKGP
2dlcX           FLDNMKAPLEVVNYRAKYYELTIKAILRSINVPIEKLKFVVGSSYQLTPDYTMDIFRLSNIVSQNDAKRA
3dpjF           ----------------------------------------------------------------------
2akeA           KYLWKYSYAVENAKDIIACGFDINKTIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDS-----
3dpjB           ----------------------------------------------------------------------
3dpjE           ----------------------------------------------------------------------
2cycA           SWINDKLGGDLEVIQEVALKYFKVGMEKSIEVMGGDPKKV------------------------------
3d6uA           ELDEIRKIGDYNKKVFEAMGLKAK-YVYGSSFMLDKDYTNVYRLALKTTLKRARRSMELIAREDENPKVA
3dpjA           ----------------------------------------------------------------------
2cyaA           KLGGDMDLIEAAGVPVERVRFVDAEELASDKDYWGLV---------------------------------


                         +         .         .         .         .         *         .:210
query           GKNSPFRDRSVEENLALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYP
3b8pB           ----------------------------------------------------------------------
3b8pC           ----------------------------------------------------------------------
3b8pD           ----------------------------------------------------------------------
2e3sA           --------------------VQKVEEMVQNHMTYSLQDVGGDVVEEGEMKVYRREVEENGIVLDPLKATH
2cfoA           GQAPRYDNRHRHLT---PEEQAAFEAAGRTPVIRFKIED-DRQIEWQDLVRGRVSWQGADLGGDMVIAYP
3b8pA           ----------------------------------------------------------------------
2d5bA           ELVEGLCPIHGRPVERRKEGNYFFRMEKYRPWLQEYIQENPDLIRPEGYEPIGDLSISRPKSRVPWGIPL
2cfoB           GQAPRYDNR----HRHLTPEEQAAFEAAGRTPVIRFKIEDDRQIEWQDLVRGRVSWQGADLGGDMVIGYP
2d54A           EGLCPIHGRPVERRKEGNYFFRMEKYRPWLQEYIQENPDLIRPEGYRNEVLAMLASISRPKSRVPWGIPL
2choB           GPNGHGYRREESMDIQPAAERFLKAFKEGKNYDKADFETLQYTFERMKESADILLMNTENKPLIVEITPW
1a8hA           ELVEGLCPIHGRPVERRKEGNYFFRMEKYRPWLQEYIQENPDLILAMLAEPIGDLSISRPKSRVPWGIPL
2bteA           QVVWRHEDTPVEKRELEQWYLRITAYAERLLKDLEGLNWPEKVKAMQRAWIGRSEGAEILFPVEGKEVRI
2ct8A           KLLELYEKNPEFIQPDYRRNEIISFVKQGLKDLSVTRPRSRVKWGIPVPFDPEHTIYFDALFNYISALED
1bs2A           FKRMEDGDEEALKIWKRFREFSIEKYIDTYARLNIKYDVYSGESESMLKAIDLFKEKGLTHEDKGAVLID
1d2rA           NTDIVPVGEDQKQHIELLAERFNKRYGELFTIPEARIPKVGARIMSLVDPTKKMS---KSDPNPKAYITL
3b8pE           ----------------------------------------------------------------------
2ag6A           EVIYPIMQV--------NPLHYEGVDVAVGGMEQRKIHMLARELLPKKVVCIHNPVLTGLDGEGKSSSKG
2csxA           LLENPEFIQPDYRRNEIISFVKQGLKDLSVTRPRSRVKWGIPVPFDPEHTIYVWFDALFNYISALEDKVE
3c8zA           -TAQFGYESGYDRDTMLTLFAERGGDPDRPGKSDQLDALLWRAERPGEPSWPSPFGRGRPGWHVECSAIA
3c8zB           -TAQFGYESGYDRDTMLTLFAERGGDPDRPGKSDQLDALLWRAERPGEPSWPSPFGRGRPGWHVECSAIA
2azxA           ----GKISFPAIQAAPSFSNSFPQIFRD-----RTDIQCLIPCAIDQDPYFRTRDVAPRIGYGAQTKSAS
3blxP           -LATRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEG-----EYSGIEHIVCPGVVQSI
2dlcX           G------ADVVKQVANPLLSGLIYPLMQALDEQFLDVDC--QFGGVDQRKIFVLAEENLPSLGYKKRAHL
3dpjF           ----------------------------------------------------------------------
2akeA           ----------------------------------------------------------------------
3dpjB           ----------------------------------------------------------------------
3dpjE           ----------------------------------------------------------------------
2cycA           ----------------------------------------------------------------------
3d6uA           EVIYPI----------------------------------------------------------------
3dpjA           ----------------------------------------------------------------------
2cyaA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           MYDFTHCISDALEGITHSLCTLEFQDNRRLYDWVLDNITIPVHPRQYEFSRLNLEYTVMSKRKLNLLVTD
3b8pB           ----------------------------------------------------------------------
3b8pC           ----------------------------------------------------------------------
3b8pD           ----------------------------------------------------------------------
2e3sA           AVKGVHEVCNYFWNVDVETTIENFHVVETLADNIIYQTHKRVSQRYLSVIRKIPALTENDPETW--IVCN
2cfoA           LYNLVVVVDDIAMGITDVIRGEDHIGNTPKQILLYEALGATPPNFAHTPLILNSTGQKLSKRDGVTSISD
3b8pA           ----------------------------------------------------------------------
2d5bA           PWDENHVTFVWFDALLNYVSALDYPEGEAYRTFWPHAWHLIGKDILKPHAVFWTMLKAAGIPMYRHLNVG
2cfoB           LYNLVVVVDDIAMGITDVIRGEDHIGNTPKQILLYEALGATPPNFAHTPLILNSTGQKLSKRDGVTSISD
2d54A           PWDENHVTAVWFDALLNYVSALDYPEGEAYRTFWPHAWHLIGKDILKPHAVFPTMLKAAGIPMYRHLNVG
2choB           VHQF-KLTAEMGEEVLKMVEGRNESYFLRKYNHVKALQQQ-MFYIDQTSNQNPYQPGVTATRVIKPLIDR
1a8hA           PWDENHVTYVWFDALLNYVSALDYPEGEAYRTFWPHAWHLIGKDILPHAVFWPTMLKAAGIPMYRHLNVG
2bteA           PVFTTRP--DTLFGATFLVLAPEHPLTLELAAP--EKREEVLAYVEAAKRKTEIERQAEGREKTGVFLGA
2ct8A           KVEIYWPADLHLVGKDILRFHTVYWPAFLMSLG-------YELPKKVFAHGWWTVEGKKMSKTLGNVVDP
1bs2A           LTKFNKKLGKAIVQKSDGTTLYLTRDVGAAMDRYEKMIYVIASQQDLHAAQFFEILKQMGFEWAKDLQHV
1d2rA           LDDAKTIEKKIKSAVTDSEGTIRYDKEAKPGISNLL--NIYSTLSGQSIEELERQYEGKGYGVFKADLAQ
3b8pE           ----------------------------------------------------------------------
2ag6A           NFIAVDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYF-LEYPLTIKRPEKFGGDLTVNSYEELESLFKN
2csxA           IYWPADLHLVGKDILRFHTVYWPAF----------------LMSLGYELPKKVFAHGWWTVEGKKMSKTL
3c8zA           LTRIGTGLDIQGGGSDLIFPHHEYS---AAHAESVTG-ERRFARHYVHTGMIGVLVSQLRAQGVDPSAIR
3c8zB           LTRIGTGLDIQGGGSDLIFPHHEYSAAHAESVT----GERRFARHYVHTGMIGVLVSQLRAQGVDPSAIR
2azxA           DPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFYLTFFLEDDDKLEQIRKDY----
3blxP           KLITRDAS----ERVIRYAFEYARAIGRPRV-IVVHKSTI------------------------------
2dlcX           MNPMVPGLANSKIDLLEEPKQVKKKINSAFCSPGNVELKFGTNHFEFFIDRPEKFGGPITYKSFEEMKLA
3dpjF           ----------------------------------------------------------------------
2akeA           ----------------------------------------------------------------------
3dpjB           ----------------------------------------------------------------------
3dpjE           ----------------------------------------------------------------------
2cycA           ----------------------------------------------------------------------
3d6uA           ----------------------------------------------------------------------
3dpjA           ----------------------------------------------------------------------
2cyaA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVTKQDNTIEMASLESCIREDLNENAPRAMAVIDPV
3b8pB           -------------------------------------------------------------TSTAIITQP
3b8pC           ---------------------------------------------------------EKWTS-TAIITQP
3b8pD           ---------------------------------------------------------EKWT-STAIITQP
2e3sA           FSVDHDSAPLNNCVRAKINVAMICQTLVSISRDNILCKITYVANVNPGGWAPASVLRAVAKRYPKFLKRF
2cfoA           FRAMGYLAPALANYMTLLGWSFTLDLAAKHFSFERINKAGARFDWDKLNWLNRQEPEEFLAELIPLWQGA
3b8pA           ---------------------------------------------------------EKWTSTAIITQPD
2d5bA           GFLLGPDGRKMSKTLGALLEKYGRDALRYYLLREIPYGQDTPVSEEALRTRYEADL---ADDLGNLVQRT
2cfoB           FRAMGYLAPALANYMTLLGWSPPEGVGELFTLDLAAKKAGARFDWDKLNWLNRQEPEEFLAELIPLWQGA
2d54A           GFLLGPDGRKMSKTLGALLEKYGRDALRYYLLREIPYGQDTPVSEEALRTRYEADL---ADDLGNLVQRT
2choB           TFVVKFFNQKFNAH-LDATTDYMPHKMNLPLKANRVLISPVEIELDAIYPGENIQINFRLSAGLQKAPVK
1a8hA           GFLLGPDGRKMSKTLGALLEKYGRDALRYYLLREIPYGQDTPVSEEALRTRYEADL---ADDLGNLVQRT
2bteA           YALNPATGERIPIWTA------------------------------------------------------
2ct8A           YEVVQEYGLDEVRYFLLREVPFGQDGDFSKKAILNRINGELANEIGNLYSRVVNMAHKFLGGEV------
1bs2A           NFGMVSTRKGTVVFLDNILEETKEKMHEVMKKNENKYAQIEHPEDLVGISAVMIQDMQGKRINNYEFKWE
1d2rA           VTLRPIQERYH-----------------------------------------------------------
3b8pE           -------------------------------------------------------------TSTAIITQP
2ag6A           KELHPMDLKN------------------------------------------------------------
2csxA           GNVVDPYE---------VVQEYGLDEVRYFLLREVPFGQDGDFSKKAILNRIGELANEIGNLYSRVVNMA
3c8zA           LGLFSWSNEVLDEANARLARWRSATDATDVIARVRQYLADDLDTPKALAAL--DGWCTDALSYGGHDTES
3c8zB           LGLFSWSNEVLDEANARLARWRSATAATDVIARVRQYLADDLDTPKALAAL--DGWCTDALSYGGHDTES
2azxA           TSGALTGE----------LKKALIEVLQPLIAEHQARRKEVTDEIVKEFT--------------------
3blxP           ----------------------------------------------------------------------
2dlcX           FKEEKLSP--------------------------------------------------------------
3dpjF           ----------------FYRQGFAQTSFVDISAAVGISRGNFYYHFKTKDEILAEVIRLRLARTAQLADWQ
2akeA           ----------------------------------------------------------------------
3dpjB           ----------------FYRQGFAQTSFVDISAAVGISRGNFYYHFKTKDEILAEVIRLRLARTAQLADWQ
3dpjE           ----------------FYRQGFAQTSFVDISAAVGISRGNFYYHFKTKDEILAEVIRLRLARTAQLADWQ
2cycA           ----------------------------------------------------------------------
3d6uA           ----------------------------------------------------------------------
3dpjA           ----------------FYRQGFAQTSFVDISAAVGISRGNFYYHFKTKDEILAEVIRLRLARTAQLAD--
2cyaA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           KLVIENYPQGESEMVTMPNHPNKPEMGSREVPFSGEIWIDRADFREEANKQYKRLVMGKEVRLRNAYVIK
3b8pB           DAAQVATY---TNALNVLYGGNAPKISEVQANFISRFSSAFSALSEDNQKEREKLTIEQSVKGQALLSVS
3b8pC           DAAQVATYT---NALNVLYGGNAPKISEVQANFISRFSSAFSALSLDNQKEREKLTIEQSVKGQALLSVS
3b8pD           DAAQVATYT---NALNVLYGGNAPKISEVQANFISRFSSAFSALSLDNQKEREKLTIEQSVKGQALLSVS
2e3sA           TSYVQEKTAGK-----------------------------------------------------------
2cfoA           GYAFDEERDRPWLFDLAQLLQPGLNTLREAIDQGAVFFIPSVTFDSEAMAQLGATILAYLLEHLPAEPLT
3b8pA           AAQVATYTNALNV----LYGGNAPKISEVQANFISRFSSAFSALSEDNQKEREKLTIEQSVKGQALLSVS
2d5bA           RAMLFRFAEGRIP---------------------------------------------------------
2cfoB           GYAFDEERDRPWLFDLAQLLQPGLNTLREAIDQGAVFFIPSVTFDSEAMAQLGQPQS-------------
2d54A           RAMLFRFAEGRIP---------------------------------------------------------
2choB           FVRFFVLTIEK-----------------------------------------------------------
1a8hA           RAMLFRFAEGRIP---------------------------------------------------------
2bteA           ----------------------------------------------------------------------
2ct8A           ----------------------------------------------------------------------
1bs2A           RMLSFEGDTGPYLQYAHSRLRSVERNASGITQEKWINADFSLLKEPAAKLLIRLLGQYPDV---------
1d2rA           ----------------------------------------------------------------------
3b8pE           DAAQVATY---TNALNVLYGGNAPKISEVQANFISRFSSAFSALSEDNQKEREKLTIEQSVKGALPLSVS
2ag6A           ----------------------------------------------------------------------
2csxA           HKFLGGEVSGARDE--------------------------------------------------------
3c8zA           PRLVATT---------------------------------------------------------------
3c8zB           PRLVATT---------------------------------------------------------------
2azxA           ----------------------------------------------------------------------
3blxP           ----------------------------------------------------------------------
2dlcX           ----------------------------------------------------------------------
3dpjF           -GTGDSPRARIASFIDLINRAKITRYGCPVGSLCTELSKLDHAAQGQANGLFTLFRDWLQRQFAEA----
2akeA           ----------------------------------------------------------------------
3dpjB           -GTGDSPRARIASFIDLINRAKITRYGCPVGSLCTELSKLDHAAQGQANGLFTLFR--------------
3dpjE           -GTGDSPRARIASFIDLINRAKITRYGCPVGSLCTELSKLDHAAQGQANGLFTLFR--------------
2cycA           ----------------------------------------------------------------------
3d6uA           ----------------------------------------------------------------------
3dpjA           ----------------------------------------------------------------------
2cyaA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           AERVEKDAEGNITTIFCTYDADTLSKDPADGRKVKGVIHWVSAAHALPIEIRLYDRLFSVPNPGAAEDFL
3b8pB           YVSTTAEGAQRRLAEYIQQVDEE------VAKELEVDLKDN-----ITLQTKTLQESLETQESPAYYTKQ
3b8pC           YVSTTAEGAQRRLAEYIQQVDEEVAKEL--EVDLKDNITLQTKTLQETQEVVAQEQKDLFSPA-YYQTKQ
3b8pD           YVSTTAEGAQRRLAEYIQQVDEEVAKELEVDLKDNITLQTKTLQESLETEVVAQEQKDLRSPATLLDIKN
2e3sA           ----------------------------------------------------------------------
2cfoA           VAMGQQ----------------------------------------------------------------
3b8pA           YVSTTAEGAQRRLAEYIQQVDEEVAK-----ELEVDLKDNITLQTKTLQESLETQEVVAQEQKD------
2d5bA           ----------------------------------------------------------------------
2cfoB           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
2choB           ----------------------------------------------------------------------
1a8hA           ----------------------------------------------------------------------
2bteA           ----------------------------------------------------------------------
2ct8A           ----------------------------------------------------------------------
1bs2A           ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
3b8pE           YVSTTAEGAQRRLAEYIQQVDEEVAKE--LEVDLKDNITLQTKTL--QESLETQEVVAQEQKD----LRI
2ag6A           ----------------------------------------------------------------------
2csxA           ----------------------------------------------------------------------
3c8zA           ----------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
2azxA           ----------------------------------------------------------------------
3blxP           ----------------------------------------------------------------------
2dlcX           ----------------------------------------------------------------------
3dpjF           ----------------------------------------------------------------------
2akeA           ----------------------------------------------------------------------
3dpjB           ----------------------------------------------------------------------
3dpjE           ----------------------------------------------------------------------
2cycA           ----------------------------------------------------------------------
3d6uA           ----------------------------------------------------------------------
3dpjA           ----------------------------------------------------------------------
2cyaA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           SVINPESLVIKQGYGEPSLKAAVAGKAFQFEREGYFCLDSRYATADKLVFxxxxxxxxxxxxxxx
3b8pB           TLLDIKNLKV---TADTVHVYRYVKPTLPVRRD--------------------------------
3b8pC           TLLDIKNLKVTADTVHVYRYVKPTLPVRR------------------------------------
3b8pD           LKVTADTVHV-YRYVKPTLP---------------------------------------------
2e3sA           -----------------------------------------------------------------
2cfoA           -----------------------------------------------------------------
3b8pA           --LRIKQIEEALRYADEAKITQPLVFSPAYYQTKQTLLDIKNLKVTADTV---------------
2d5bA           -----------------------------------------------------------------
2cfoB           -----------------------------------------------------------------
2d54A           -----------------------------------------------------------------
2choB           -----------------------------------------------------------------
1a8hA           -----------------------------------------------------------------
2bteA           -----------------------------------------------------------------
2ct8A           -----------------------------------------------------------------
1bs2A           -----------------------------------------------------------------
1d2rA           -----------------------------------------------------------------
3b8pE           KQIEEAYYQTKQTLLDIKNLKVTAD-TVHVYR---------------------------------
2ag6A           -----------------------------------------------------------------
2csxA           -----------------------------------------------------------------
3c8zA           -----------------------------------------------------------------
3c8zB           -----------------------------------------------------------------
2azxA           -----------------------------------------------------------------
3blxP           -----------------------------------------------------------------
2dlcX           -----------------------------------------------------------------
3dpjF           -----------------------------------------------------------------
2akeA           -----------------------------------------------------------------
3dpjB           -----------------------------------------------------------------
3dpjE           -----------------------------------------------------------------
2cycA           -----------------------------------------------------------------
3d6uA           -----------------------------------------------------------------
3dpjA           -----------------------------------------------------------------
2cyaA           -----------------------------------------------------------------