[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for sent8:ACF68527.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3e4bC.bssp"
#ERROR : Can't open dsspfile "3e4bD.bssp"
#ERROR : Can't open dsspfile "3e4bB.bssp"
#ERROR : Can't open dsspfile "3e4bA.bssp"
#ERROR : Can't open dsspfile "2cg3A.bssp"
#ERROR : Can't open dsspfile "3ec5A.bssp"
#ERROR : Can't open dsspfile "2c0mA.bssp"
#ERROR : Can't open dsspfile "1dceA.bssp"
#ERROR : Can't open dsspfile "2cg2A.bssp"
#ERROR : Can't open dsspfile "2c1nA.bssp"

## Summary of PDB Search
:722
    2e-30  23%  3e4bC  [x.x.x] ALGK
    4e-28  24%  3e4bD  [x.x.x] ALGK
    6e-15  19%  3e4bB  [x.x.x] ALGK
    1e-08  15%  3e4bA  [x.x.x] ALGK
    6e-06  12%  2cg3A  [x.x.x] SDSA1
    2e-05  18%  3ec5A  [x.x.x] OUTER SURFACE PROTEIN A
    3e-04   9%  2c0mA  [x.x.x] PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
    4e-04  10%  1dceA  [a.118.6 - b.7.4 - c.10.2] PROTEIN (RAB
    5e-04  11%  2cg2A  [x.x.x] SDSA1
    7e-04  20%  2c1nA  [x.x.x] 14-3-3 PROTEIN ZETA/DELTA
:722

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3e4bC           ----------------------------------------------------------------------
3e4bD           ----------------------------------------------------------------------
3e4bB           ----------------------------------------------------------------------
3e4bA           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
1dceA           ----------------------------------------------------------------------
2cg2A           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3e4bC           ----------------------------------------------------------------------
3e4bD           ----------------------------------------------------------------------
3e4bB           ----------------------------------------------------------------------
3e4bA           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
1dceA           ----------------------------------------------------------------------
2cg2A           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3e4bC           ----------------------------------------------------------------------
3e4bD           ----------------------------------------------------------------------
3e4bB           ----------------------------------------------------------------------
3e4bA           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
1dceA           ----------------------------------------------------------------------
2cg2A           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3e4bC           ----------------------------------------------------------------------
3e4bD           ----------------------------------------------------------------------
3e4bB           ----------------------------------------------------------------------
3e4bA           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
1dceA           ----------------------------------------------------------------------
2cg2A           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3e4bC           ----------------------------------------------------------------------
3e4bD           ----------------------------------------------------------------------
3e4bB           ----------------------------------------------------------------------
3e4bA           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------
2c0mA           ----------------------------------------------------------------------
1dceA           ----------------------------------------------------------------------
2cg2A           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDSEGRKHGAVKEWFSNGKPASS
3e4bC           ----------------------------------------------------------------------
3e4bD           ----------------------------------------------------------------------
3e4bB           ----------------------------------------------------------------------
3e4bA           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
3ec5A           ------------------------------------------------LPGSMKVLVSKSSNADGKYDLI
2c0mA           ----------------------------------------------------------------------
1dceA           ----------------------------------------------------------------------
2cg2A           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           KMYKHDVLDGDFEKWYENGHRESVYPYKNGMLNGDAKHWNEQGKLTYTTEYKDxxxxxxxxxxxxxxxxx
3e4bC           ----------------------------------------------------------------------
3e4bD           ----------------------------------------------------------------------
3e4bB           ----------------------------------------------------------------------
3e4bA           ----------------------------------------------------------------------
2cg3A           ----------------------------------------------------------------------
3ec5A           ATVDALELSGTSDKNNGSGVLEG---VKADASKVKLTISDDLGQTTLEVFKSD-----------------
2c0mA           ----------------------------------------------------------------------
1dceA           ----------------------------------------------------------------------
2cg2A           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYDEDGIKYIRCYHNDEELSELYAPTDVT
3e4bC           ----------------------------------------------------------------------
3e4bD           ----------------------------------------------------------------------
3e4bB           ----------------------------------------------------------------------
3e4bA           ----------------------------------------------------------------------
2cg3A           ------------------------------------------GVTIGQVHNRLRLPPSLDQEWYDRGYHG
3ec5A           ----------------------------------------------------------------------
2c0mA           --------------------------------------------DVQCGLGVLFNLSGEYDKAVDCFTAA
1dceA           ----------------------------------------------------------------------
2cg2A           ----------------------------------------------------------------------
2c1nA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           NKAKQGDSTAQYHLGKYEFECTNYDAAMKWLTQSAEQNHPGALLFLAYAYNDGDGVAQDSKKYLSYLFKA
3e4bC           -KIAPGYPASWVSLAQYDFELGDVEQMMKYLDNGRAADQPRAELLLGKLYYEGKWVPADAKAAEAHFEKA
3e4bD           -KIAPGYPASWVSLAQYDFELGDVEQMMKYLDNGRAADQPRAELLLGKLYYEGKWVPADAKAAEAHFEKA
3e4bB           --RAADQPRAELLLGKEGKWVPADAKAAEAHFEKAVGREVAADYYLGQIYRRGYLGKVYPQKALDHLLTA
3e4bA           -----------KLYYEGKWVPADAKAAEAHFEKAVGREVA-ADYYLGQIYRRGYLGKVYPQKALDHLLTA
2cg3A           SVSHNARAVLNRYLGYYDGNPATLDPLSPEDSAGRYVEGAERLLEQARASYA----RGEYRWVVEVVNRL
3ec5A           ----------------------------------------------------------------------
2c0mA           LSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQYIRSRYNLGISCIN----LGAHREAVEHFLEA
1dceA           -----------HGRLKVKTSEEQAEAKRLEREQKLKLYATQAVFQKRQAGELDESVLELTSQILGANPDF
2cg2A           -----------YLGYYDGNPATLDPLSPEDSAGRYVEYMAERLLEQARASYA----RGEYRWVVEVVNRL
2c1nA           ------DKNELVQKAKLAEQAERYDACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQK


                         .         +         .         .         .         .         *:700
query           AELGESDAQLEVGYLNLIGEGMPKNLPEAYKWIKKSADQGNAQAHYNLGLMYRNGDGVEKDLNKAKLHLT
3e4bC           VG-REVAADYYLGQIYRRGYLGKVYPQKALDHLLTAARNGQNSADFAIAQLFSQGKGTKPDPLNAYVFSQ
3e4bD           VG-REVAADYYLGQIYRRGYLGKVYPQKALDHLLTAARNGQNSADFAIAQLFSQGKGTKPDPLNAYVFSQ
3e4bB           ARNGQNSADFAIAQLFSQGKGTKPDPLNAYVFSQLAKAQPEANDLATQLEAPLTPAQRAEGQRLVQQELT
3e4bA           ARNGQNSADFAIAQLFSQGKGTKPDPLNAYVFSQLAKAQDTPEANDLATQLEAPLT--PAQRAEGQRLVQ
2cg3A           VFAEPDNRAARELLEQL------GYQAENAGWRNSSAAYELRHGVPRDQGSADA----------------
3ec5A           ----------------------------------------------------------------------
2c0mA           LNMQRKSRGPRGEGGAMSEN-IWSTLRLALSMLGQAYGAADARDLSTLLTMFGLP---------------
1dceA           ATLWNCRREVLQHLETEKSALVKAELGFLESCLRVNPKSYGTWHHRCWLLSRPNWARELELCARF-----
2cg2A           VFAEPDNRAA----RELQADALEQYQAENAGWRNSSAAYELRHGVPRDGSADAL----------------
2c1nA           TEGAEKKQQMAREYREKIETELRDICNEKFLIPNASQAESKVFYLKMKGDYYRY----------------


                         .         .         .         .         +         .         .:770
query           AAVKGGVKPALAALKELTPQxx
3e4bC           LAKAQDTPEANDLATQL-----
3e4bD           LAKATPEANDLATEAPLTPA--
3e4bB           LQ--------------------
3e4bA           QELA------------------
2cg3A           ----------------------
3ec5A           ----------------------
2c0mA           ----------------------
1dceA           ----------------------
2cg2A           ----------------------
2c1nA           ----------------------