[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for sent8:ACF68745.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dciA.bssp"
#ERROR : Can't open dsspfile "1deoA.bssp"
#ERROR : Can't open dsspfile "3c1uA.bssp"
#ERROR : Can't open dsspfile "3dc7A.bssp"
#ERROR : Can't open dsspfile "3bzwA.bssp"
#ERROR : Can't open dsspfile "3bzwB.bssp"
#ERROR : Can't open dsspfile "3dc7B.bssp"
#ERROR : Can't open dsspfile "3bzwF.bssp"
#ERROR : Can't open dsspfile "3dc7C.bssp"

## Summary of PDB Search
:408
    2e-13  19%  3dciA  [x.x.x] ARYLESTERASE
    9e-12  19%  1deoA  [c.23.10] RHAMNOGALACTURONAN ACETYLESTERASE
    3e-11  16%  3c1uA  [x.x.x] RHAMNOGALACTURONAN ACETYLESTERASE
    5e-08  15%  3dc7A  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN LP_3323
    6e-08  15%  3bzwA  [x.x.x] PUTATIVE LIPASE
    4e-07  14%  3bzwB  [x.x.x] PUTATIVE LIPASE
    5e-07  18%  3dc7B  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN LP_3323
    8e-06  17%  3bzwF  [x.x.x] PUTATIVE LIPASE
    4e-05  17%  3dc7C  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN LP_3323
:408

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dciA           ----------------------------------------------------------------------
1deoA           ----------------------------------------------------------------------
3c1uA           ----------------------------------------------------------------------
3dc7A           ----------------------------------------------------------------------
3bzwA           ----------------------------------------------------------------------
3bzwB           ----------------------------------------------------------------------
3dc7B           ----------------------------------------------------------------------
3bzwF           ----------------------------------------------------------------------
3dc7C           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHPKPKNISLG
3dciA           ----------------------------------------------------------------------
1deoA           ----------------------------------------------------------------------
3c1uA           ----------------------------------------------------------------------
3dc7A           ------------------------------------------------------------HVSFK-----
3bzwA           ---------------------------------------------------------------------W
3bzwB           ---------------------------------------------------------------------W
3dc7B           ------------------------------------------------------------HVSFK-----
3bzwF           ----------------------------------------------------------------------
3dc7C           ------------------------------------------------------------HVSFKRP---


                         +         .         .         .         .         *         .:210
query           DITRLVFFGDSLSDSLGRMFEKTHHILPSYGQYFGGRFTNGFTWTEFLSSPHFLGKEMLNFAEGGSTSAS
3dciA           ---TVLAFGDSLTWG--------------ADPATGLRHPVEHRWPDVLEAELAGKAKVHPEGLGGRTTCY
1deoA           --TTVYLAGDSTMAKNG-----------------GGSGTNG--WGEYLA--SYLSATVVNDAVAGRSAR-
3c1uA           --TTVYLAGDSTMA-----------------KNGGGSGTNG--WGEYL--ASYLSATVVNDAVAGRSAR-
3dc7A           ---RPAWLGDSITA---------------------NNGLATVHYHDILAA-DWDVERSDNLGISGSTIG-
3bzwA           QGKKVGYIGDSIT-------------------DPNCYGDNIKKYWDFLK--EWLGITPFVYGISGRQWD-
3bzwB           QGKKVGYIGDSIT-------------------DPNCYGDNIKKYWDFL--KEWLGITPFVYGISG-----
3dc7B           ---RPAWLGDSITA---------------------NNGLATVHYHDILAA-DWDVERSDNLGISGSTIG-
3bzwF           ---KVGYIGDSITD---------------------PNNIKK--YWDFLKE--WLGITPFVYGISGRQWD-
3dc7C           -----AWLGDSITA---------------------NNGLATVHYHDILAA-DWDVERSDNLGISGSTIGS


                         .         .         .         +         .         .         .:280
query           YSCFNCIGDFVSNTDRQVASYTPSHQDLAIFLLGANDYMTLHKDNVIMVVEQQIDDIEKIISGGVNNVLV
3dciA           DDHA---GPACRNGARALEVALSCHPLDLVIILGTNDIKPVHGGRAEAAVRRLAQIVETFIYKPREALLI
1deoA           --------SYTREGRFENIADVVTAGDYVIVEFGHNDGGSLSTDNGRTDCSGTGAEVCYSVYDGVNETIL
3c1uA           --------SYTREGRFENIADVVTAGDYVIVEFGHNDGGSTDNGR-------------------------
3dc7A           --------SRYDAAVRYQAIPEDA--DFIAVFGGVNDYGRDQPLGQYCDTTFYGALLLTGLQTNWPTVPK
3bzwA           --------DVPRQAEKLKKEHGG--EVDAILVFGTNDYNSSVPIGEWVTQDTYRGRINIGITFPDKQIVL
3bzwB           ----RQWDDVPRQAEKLKKEHGG--EVDAILVFGTNDYNSSVPIGEWVTQDTYRGRINIGITQDKQIVLL
3dc7B           --------SRYDAAVRYQAIPE--DADFIAVFGGVNDYGRDQGDCDTTFYGALLLTGLQTNWPTVPKLF-
3bzwF           --------DVPRQAEKLKKEHGGE--VDAILVFGTNDYNVTRKKRTPVTQDTYRGRINIGITFPDKQIVL
3dc7C           R-YDAAVRYQAIPEDADFIAVFGGVND-----YGRDQPLGQYGDCDTTFYGALLLTGLQTNWPTV-PKLF


                         .         *         .         .         .         .         +:350
query           MGIPDLSLTPYGKHSDEKRKLKDESIAHNALLKTNVEELKEKYPQHKICYYETADAFKVIMEAASNIGYD
3dciA           VAPPPCVAGPGGEPAGGRDIEQS---RLAPLYRKLAAELGHHFDAGSVASASPVD---------------
1deoA           T--------------------------FPAYLENAAKLFTAKGAKVILSSQNSPTRFVEYAELAAE-VAG
3c1uA           ---TDCSGTGAEVCYSVYDGVNETILTFPAYLENAAKLFTAKGAKVILSSQTPNNPWETGTFVNSPTRFV
3dc7A           LFISAIHIGDFGGSFSAVTNGLGYRQSDYE-------AAIAQTADYGVPHLSLYRDA-------------
3bzwA           LTPLHRSLANFGDKNVQ--PDESYQNGCGEYIDAYVQAIKEAGNIWGIPV---IDFNAVTGNPVEEQLIY
3bzwB           TPLHRSLANFGDKNVQPDESYQNGCGEYIDAYVQAIKEAGN---IWGIPV---IDFNAVTGNPVEEQLIY
3dc7B           ISAIHIGSDFGGSFSAVTNGL-----------------------------GYRQSDYEAAIAQTADYGVP
3bzwF           LTPLHRSLANFGDKNVQPDESYQNGC--GEYIDAYVQAIKEAGNIWGIPVIDFNAVT-------------
3dc7C           ISAIHIGSDFGGSFSAVTNGLGYRQSDYEAAIAQ------------------------------------


                         .         .         .         .         *         .         .:420
query           TENPYTHHGYVHVPGAKDPQLDICPQYVFNDLVHPTQEVHHCFAIMLESFIAHHYxxx
3dciA           ----------------------------------------------------------
1deoA           VEYVDHWSYVDSIYETLGNATV--NSYFPIDHTHTSPAGAEVVAEAFLKAVVCTG---
3c1uA           EEVAGVEYVDHWSYVDSIYETLGNNSYFPINHTHTSPAGAEVVAEAFLKAVVCTG---
3dc7A           ----------------GTFAIPAQAAIYSVDTLHPNNAGHRVIARKLQSFL-------
3bzwA           ------------------------FYDAGYDRLHPDTKGQERARTLYQLLAL------
3bzwB           ------------------------FYDAGYDRLHPDTKGQERARTLYQLLA-------
3dc7B           HLSLYRDAGTFAIPAQ--------AAIYSVDTLHPNNAGHRVIARKLQSFLDSHF---
3bzwF           --------------GNPVEEQLIYFYDAGYDRLHPDTKGQERAR--------------
3dc7C           ----TADYGVPHLSLYRDAGTFAIAAIYSVDTLHPNNAGHRVIARKLQSFLDSHF---