[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for sent8:ACF68874.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1e3dA.bssp"
#ERROR : Can't open dsspfile "1cc1S.bssp"
#ERROR : Can't open dsspfile "3ehkA.bssp"
#ERROR : Can't open dsspfile "2b5hA.bssp"
#ERROR : Can't open dsspfile "2atfA.bssp"
#ERROR : Can't open dsspfile "3cewA.bssp"
#ERROR : Can't open dsspfile "3cjxC.bssp"
#ERROR : Can't open dsspfile "3cjxF.bssp"
#ERROR : Can't open dsspfile "2d5hB.bssp"
#ERROR : Can't open dsspfile "3cjxA.bssp"
#ERROR : Can't open dsspfile "3bcwA.bssp"
#ERROR : Can't open dsspfile "2d5hF.bssp"
#ERROR : Can't open dsspfile "3cjxE.bssp"
#ERROR : Can't open dsspfile "3balA.bssp"
#ERROR : Can't open dsspfile "3bcwB.bssp"
#ERROR : Can't open dsspfile "3cjxD.bssp"

## Summary of PDB Search
:286
    6e-25  14%  1e3dA  [e.19.1] [NIFE] HYDROGENASE SMALL SUBUNIT
    5e-16  12%  1cc1S  [e.19.1] HYDROGENASE (SMALL SUBUNIT)
    7e-14  12%  3ehkA  [x.x.x] PRUNIN
    3e-12   8%  2b5hA  [x.x.x] CYSTEINE DIOXYGENASE TYPE I
    9e-12   9%  2atfA  [x.x.x] CYSTEINE DIOXYGENASE TYPE I
    1e-08  14%  3cewA  [x.x.x] UNCHARACTERIZED CUPIN PROTEIN
    3e-08  13%  3cjxC  [x.x.x] PROTEIN OF UNKNOWN FUNCTION WITH A CUPIN-LIKE
    2e-07  11%  3cjxF  [x.x.x] PROTEIN OF UNKNOWN FUNCTION WITH A CUPIN-LIKE
    3e-07  12%  2d5hB  [x.x.x] GLYCININ A3B4 SUBUNIT
    4e-07  14%  3cjxA  [x.x.x] PROTEIN OF UNKNOWN FUNCTION WITH A CUPIN-LIKE
    4e-07  12%  3bcwA  [x.x.x] UNCHARACTERIZED PROTEIN
    9e-07  12%  2d5hF  [x.x.x] GLYCININ A3B4 SUBUNIT
    9e-07  12%  3cjxE  [x.x.x] PROTEIN OF UNKNOWN FUNCTION WITH A CUPIN-LIKE
    1e-06  10%  3balA  [x.x.x] ACETYLACETONE-CLEAVING ENZYME
    7e-06  12%  3bcwB  [x.x.x] UNCHARACTERIZED PROTEIN
    2e-04  13%  3cjxD  [x.x.x] PROTEIN OF UNKNOWN FUNCTION WITH A CUPIN-LIKE
:286

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKQITGVYTAPRPHWVGDGFPVRSLFSYQSHAQQLSPFLLLDYAGPHTFTPGNEKRGVGEHPHRGFETVT
1e3dA           ---------SIGTCACYGGIQAAK--------PNPTAAKGINDCYADLGVKAINVPGCPPNPLNMVGTLV
1cc1S           ---------------------IPAAEGNVTGSKSVRDFFADEKIEK----LLVNVPGCPPHPDWMVGTLV
3ehkA           ---------ERADIFSPRAGRISTLNSHNLPILR-FLRLSAERGFFYRNG------IYSPHWNVNAHSVV
2b5hA           ---VEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCEGH---GSSIHDHTDSHCFL
2atfA           VQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQ--GNGKFNLIL---CWGEGH---GSSIHDHTDSHCFL
3cewA           ------------------------------ARVELHDSLALTGAEVSINHLPAGAGVPFVHSHKQNEEIY
3cjxC           --------------------------------------------------------GLTLPLHFHTGTVH
3cjxF           ------------------------------KALGGHEGTDIFPLFDPYNGLVRASFAPGLPLHFHTGTVH
2d5hB           --------------------------------------------------------IYSPHWNLNANSVI
3cjxA           --------TAHPFLKALGGHEGTDIFPLFDPYNGLVRASF--------------APGLTLPLHFHTGTVH
3bcwA           ------PVAGKPSRPIAGDASFRTVTAFEGGQGKVESGVW-------ESTSG----SFQSNTTGYIEYC-
2d5hF           ----------------------------------------------------------SPHWNLNANSVI
3cjxE           --------------------------------------------------------GLTLPLHFHTGTVH
3balA           EEYVKISDNNYVPFEAFSDGGITWQLLHSSPETSSWTAIF-------NCPAGS---SFASHIHAGPGEYF
3bcwB           ------PVAGKPSRPIAGDASFRTVTAFEGGQGKVESGVW-------ESTSG----SFQSNTTGYIEYC-
3cjxD           ------------------------------------------------------APGLTLPLHFHTGTVH


                         .         .         *         .         .         .         .:140
query           IVYSGEVEHRDSTGRGGVIGPGDVQWMTAGAGILHEEFHSDAFTRRGGELEMVQLWVNLPMKDKMTPPGY
1e3dA           AFLKGQKIELDEVGR----------PVMFFGQSVHDLCERRKHFDAGE----FAPSFNSEEARKGWCLYD
1cc1S           AAWSHVLNPTE--HPLPELDDDGRPLLFFGDNIHENCPYLDKY-DNSEFAETFTKPGCKAELGCKGPSTY
3ehkA           YVIRGNVQVVNENGDAIEVQQGQLFIVPQNHG------VIQQAGNQGFEYFAFKTEENAFINTLAGRTSF
2b5hA           KLLQGNLKNEMIKKSERTLRENQCAYINDSIGLHRVENVSH-----TEPAVSLHLYSPPFDTCHAFDQRT
2atfA           KLLQGNLKETLFDWPDKTLRENQCAYINDSIGLHRVENVSH-----TEPAVSLHLYSPPFDTCHAFDQRT
3cewA           GILSGKGFITID-GEKIELQAGDWLRIA--PDGKRQISAAS-----DSPIGFLCIQVKAGSLEGYTTDGV
3cjxC           YTISGCWYYT--EYPGQKQTAGCYLYEP--GGSIH-------QFNTPRDNEGQTEVIFLSGCNVNFTQDG
3cjxF           YTISGCWYYTE--YPGQKQTAGCYLYEPGGSI------HQ---FNTPRDNEGQTEVIFLSGCNVNFTQDG
2d5hB           YVGKGRVRVVNQGNAVFDGELRRGQLLVVPQNFVV------AEQGGEQGLEYVVFKTHHNAVSSYIKDVF
3cjxA           YTISGCWYYT--EYPGQKQTAGCYLYEPGGSIH---------QFNTPRDNEGQTEVIFLSGCNVNFTQDG
3bcwA           HIIEGEARLVDPDGTVHAVKAGDAFIP---EGYTGRW-------EVDRHVKKIYFVTHL-----------
2d5hF           YVTRGRVRVVNQGNAVFDGELRRGQLLVVPQNFVV------AEQGGEQGLEYVVFKTHHNAVSSYIKDVF
3cjxE           YTISGCWYYT--EYPGQKQTAGCYLYEPGGSI---------HQFNTPRDNEGQTEVIFLSGCNVNFTQDG
3balA           LTKGKMEVRGGEQEGGSTAYAPSYGFES--SGALH-------GKTFFPVESQFYMTFLGP----------
3bcwB           HIIEGEARLVDPDGTVHAVKAGDAFIP---EGYTGRW-------EVDRHVKKIYFVTHL-----------
3cjxD           YTISGCWYYT--EYPGQKQTAGCYLYEP--GGSIH-------QFNTPRDNEGQTEVIFLSGCNVNFTQDG


                         +         .         .         .         .         *         .:210
query           QSITHDVIPTVTLPDNAGVVRVIAGRYEETKGPAHTFSPLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1e3dA           VGCTYNNCPKV--LFNETNWPVAAGHCIGCSEPNFDMTPF------------------------------
1cc1S           ADCA-------KRRWNNGINWCVENDFPDGKSP-------------------------------------
3ehkA           LRALPDEVLANAYQISREQARQLKYNRQET----------------------------------------
2b5hA           GHKNKVTMT-------------------------------------------------------------
2atfA           GHK-------------------------------------------------------------------
3cewA           VQL-------------------------------------------------------------------
3cjxC           TYLGLSDAGVIKNWVDRAIREQDNGL--------------------------------------------
3cjxF           TYLGLSDAGVIKNWVDRAIREQDNGL--------------------------------------------
2d5hB           RAIPSEVLSNSYNLGQSQVRQLKYQGNSGPLVN-------------------------------------
3cjxA           TYLGLSDAG-------------------------------------------------------------
3bcwA           ----------------------------------------------------------------------
2d5hF           RAIPSEVLSNSYNLGQSQVRQLKYQGNSG-----------------------------------------
3cjxE           TYLGLSDAGVIKNWVDRAIREQDNGL--------------------------------------------
3balA           ----------------------------------------------------------------------
3bcwB           ----------------------------------------------------------------------
3cjxD           TYLGLSDAGVIKNWVDRAIREQDNGL--------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1e3dA           ----------------------------------------------------------------------
1cc1S           ----------------------------------------------------------------------
3ehkA           ----------------------------------------------------------------------
2b5hA           ----------------------------------------------------------------------
2atfA           ----------------------------------------------------------------------
3cewA           ----------------------------------------------------------------------
3cjxC           ----------------------------------------------------------------------
3cjxF           ----------------------------------------------------------------------
2d5hB           ----------------------------------------------------------------------
3cjxA           ----------------------------------------------------------------------
3bcwA           ----------------------------------------------------------------------
2d5hF           ----------------------------------------------------------------------
3cjxE           ----------------------------------------------------------------------
3balA           ----------------------------------------------------------------------
3bcwB           ----------------------------------------------------------------------
3cjxD           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxx
1e3dA           ------
1cc1S           ------
3ehkA           ------
2b5hA           ------
2atfA           ------
3cewA           ------
3cjxC           ------
3cjxF           ------
2d5hB           ------
3cjxA           ------
3bcwA           ------
2d5hF           ------
3cjxE           ------
3balA           ------
3bcwB           ------
3cjxD           ------