[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for sent8:ACF69088.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cmvG.bssp"
#ERROR : Can't open dsspfile "3cmvA.bssp"
#ERROR : Can't open dsspfile "3czpB.bssp"
#ERROR : Can't open dsspfile "3cmvC.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "3dmdC.bssp"
#ERROR : Can't open dsspfile "2dwoA.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "3dm5A.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "1d1cA.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "2bifA.bssp"
#ERROR : Can't open dsspfile "2akaA.bssp"
#ERROR : Can't open dsspfile "3cmvH.bssp"
#ERROR : Can't open dsspfile "3c95A.bssp"
#ERROR : Can't open dsspfile "1aroP.bssp"
#ERROR : Can't open dsspfile "2c04A.bssp"
#ERROR : Can't open dsspfile "3eiuA.bssp"
#ERROR : Can't open dsspfile "2dwpA.bssp"
#ERROR : Can't open dsspfile "3czpA.bssp"
#ERROR : Can't open dsspfile "1bifA.bssp"
#ERROR : Can't open dsspfile "3b2qA.bssp"
#ERROR : Can't open dsspfile "2c03A.bssp"
#ERROR : Can't open dsspfile "3dmdB.bssp"
#ERROR : Can't open dsspfile "2c61B.bssp"
#ERROR : Can't open dsspfile "1e9sF.bssp"
#ERROR : Can't open dsspfile "1bg0A.bssp"
#ERROR : Can't open dsspfile "2czvA.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "3b85A.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "2bc9A.bssp"
#ERROR : Can't open dsspfile "3bo6B.bssp"
#ERROR : Can't open dsspfile "2a5gA.bssp"
#ERROR : Can't open dsspfile "2ccgB.bssp"
#ERROR : Can't open dsspfile "2akaB.bssp"
#ERROR : Can't open dsspfile "2ctsA.bssp"
#ERROR : Can't open dsspfile "3bgwD.bssp"
#ERROR : Can't open dsspfile "3eiuB.bssp"
#ERROR : Can't open dsspfile "2ccgA.bssp"
#ERROR : Can't open dsspfile "2dr3A.bssp"
#ERROR : Can't open dsspfile "1e9sG.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "2b8wA.bssp"
#ERROR : Can't open dsspfile "3a1wA.bssp"
#ERROR : Can't open dsspfile "1e0jA.bssp"
#ERROR : Can't open dsspfile "2c61A.bssp"
#ERROR : Can't open dsspfile "3da4A.bssp"
#ERROR : Can't open dsspfile "1e0jB.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "3b2qB.bssp"
#ERROR : Can't open dsspfile "2bkiA.bssp"
#ERROR : Can't open dsspfile "3cr7A.bssp"
#ERROR : Can't open dsspfile "2bdtA.bssp"
#ERROR : Can't open dsspfile "2axzC.bssp"
#ERROR : Can't open dsspfile "3dt2A.bssp"
#ERROR : Can't open dsspfile "2d4hA.bssp"
#ERROR : Can't open dsspfile "1cr4A.bssp"
#ERROR : Can't open dsspfile "2bkhA.bssp"
#ERROR : Can't open dsspfile "2c9oC.bssp"
#ERROR : Can't open dsspfile "4dcgA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "2ccjB.bssp"
#ERROR : Can't open dsspfile "3d3kA.bssp"
#ERROR : Can't open dsspfile "1dkiA.bssp"
#ERROR : Can't open dsspfile "3d7wA.bssp"
#ERROR : Can't open dsspfile "3dtbB.bssp"
#ERROR : Can't open dsspfile "2a2zD.bssp"
#ERROR : Can't open dsspfile "1e9sD.bssp"
#ERROR : Can't open dsspfile "3dt4A.bssp"
#ERROR : Can't open dsspfile "2a5jA.bssp"
#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "3cr7D.bssp"
#ERROR : Can't open dsspfile "3cr7C.bssp"
#ERROR : Can't open dsspfile "2c9gA.bssp"
#ERROR : Can't open dsspfile "2axpA.bssp"
#ERROR : Can't open dsspfile "2a2zA.bssp"
#ERROR : Can't open dsspfile "2d4uA.bssp"
#ERROR : Can't open dsspfile "1cr2A.bssp"
#ERROR : Can't open dsspfile "421pA.bssp"
#ERROR : Can't open dsspfile "1e9fA.bssp"
#ERROR : Can't open dsspfile "1e9cA.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"
#ERROR : Can't open dsspfile "1dg3A.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "3bh0A.bssp"
#ERROR : Can't open dsspfile "2dftA.bssp"
#ERROR : Can't open dsspfile "3dt4C.bssp"
#ERROR : Can't open dsspfile "2cgtH.bssp"
#ERROR : Can't open dsspfile "1e9rE.bssp"
#ERROR : Can't open dsspfile "2b8tA.bssp"
#ERROR : Can't open dsspfile "2cjwB.bssp"
#ERROR : Can't open dsspfile "2b8tB.bssp"
#ERROR : Can't open dsspfile "1d6jB.bssp"
#ERROR : Can't open dsspfile "3adkA.bssp"
#ERROR : Can't open dsspfile "2ahwD.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"
#ERROR : Can't open dsspfile "3bgwA.bssp"
#ERROR : Can't open dsspfile "1e98A.bssp"
#ERROR : Can't open dsspfile "2ahvA.bssp"
#ERROR : Can't open dsspfile "3cmxA.bssp"
#ERROR : Can't open dsspfile "3di4A.bssp"
#ERROR : Can't open dsspfile "2a30D.bssp"
#ERROR : Can't open dsspfile "1cfrA.bssp"
#ERROR : Can't open dsspfile "2dr3E.bssp"
#ERROR : Can't open dsspfile "2b8tC.bssp"
#ERROR : Can't open dsspfile "2dr3B.bssp"
#ERROR : Can't open dsspfile "1e2fA.bssp"
#ERROR : Can't open dsspfile "3cddF.bssp"
#ERROR : Can't open dsspfile "3cddC.bssp"
#ERROR : Can't open dsspfile "2eg5G.bssp"
#ERROR : Can't open dsspfile "2c9yA.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "3clvA.bssp"
#ERROR : Can't open dsspfile "1dhjA.bssp"
#ERROR : Can't open dsspfile "3ch4B.bssp"
#ERROR : Can't open dsspfile "1eilA.bssp"
#ERROR : Can't open dsspfile "2a2zB.bssp"
#ERROR : Can't open dsspfile "3bb1B.bssp"
#ERROR : Can't open dsspfile "2a30B.bssp"
#ERROR : Can't open dsspfile "2b92B.bssp"
#ERROR : Can't open dsspfile "2dftC.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "2ausC.bssp"
#ERROR : Can't open dsspfile "2cvfA.bssp"
#ERROR : Can't open dsspfile "1av6A.bssp"
#ERROR : Can't open dsspfile "3dt7A.bssp"
#ERROR : Can't open dsspfile "2a30A.bssp"
#ERROR : Can't open dsspfile "3cnlA.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "3bczC.bssp"
#ERROR : Can't open dsspfile "1accA.bssp"
#ERROR : Can't open dsspfile "3cddD.bssp"
#ERROR : Can't open dsspfile "2ancF.bssp"
#ERROR : Can't open dsspfile "2aunB.bssp"
#ERROR : Can't open dsspfile "3bb1E.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "3cueF.bssp"
#ERROR : Can't open dsspfile "3cr7B.bssp"
#ERROR : Can't open dsspfile "1bglA.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "3cioD.bssp"
#ERROR : Can't open dsspfile "3czjA.bssp"
#ERROR : Can't open dsspfile "3dlbB.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "1e4yA.bssp"
#ERROR : Can't open dsspfile "2d0kA.bssp"
#ERROR : Can't open dsspfile "1e9rD.bssp"
#ERROR : Can't open dsspfile "1e9sJ.bssp"
#ERROR : Can't open dsspfile "3bb1A.bssp"
#ERROR : Can't open dsspfile "1e3aB.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "3dfnA.bssp"
#ERROR : Can't open dsspfile "3bpbA.bssp"
#ERROR : Can't open dsspfile "2c4rL.bssp"
#ERROR : Can't open dsspfile "3d3qA.bssp"
#ERROR : Can't open dsspfile "2c0bL.bssp"
#ERROR : Can't open dsspfile "1e9sB.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "3dfqA.bssp"
#ERROR : Can't open dsspfile "2c7cH.bssp"
#ERROR : Can't open dsspfile "1aldA.bssp"
#ERROR : Can't open dsspfile "3dfqD.bssp"
#ERROR : Can't open dsspfile "1e9dA.bssp"
#ERROR : Can't open dsspfile "1e9sI.bssp"
#ERROR : Can't open dsspfile "1cjaA.bssp"
#ERROR : Can't open dsspfile "3b9qA.bssp"
#ERROR : Can't open dsspfile "6aldA.bssp"
#ERROR : Can't open dsspfile "2d7vA.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "1cr1A.bssp"
#ERROR : Can't open dsspfile "3dyoA.bssp"
#ERROR : Can't open dsspfile "1dekB.bssp"
#ERROR : Can't open dsspfile "1ai4B.bssp"
#ERROR : Can't open dsspfile "2bhvD.bssp"
#ERROR : Can't open dsspfile "1dhiA.bssp"
#ERROR : Can't open dsspfile "1e3mB.bssp"
#ERROR : Can't open dsspfile "2bwjA.bssp"
#ERROR : Can't open dsspfile "1e2hB.bssp"
#ERROR : Can't open dsspfile "2d7vB.bssp"
#ERROR : Can't open dsspfile "3dfoD.bssp"
#ERROR : Can't open dsspfile "3dfpD.bssp"
#ERROR : Can't open dsspfile "3bb1F.bssp"
#ERROR : Can't open dsspfile "3cmwC.bssp"
#ERROR : Can't open dsspfile "2ck3C.bssp"
#ERROR : Can't open dsspfile "3c8uA.bssp"
#ERROR : Can't open dsspfile "3cbnA.bssp"
#ERROR : Can't open dsspfile "3dftC.bssp"
#ERROR : Can't open dsspfile "2d4hB.bssp"
#ERROR : Can't open dsspfile "3dftD.bssp"
#ERROR : Can't open dsspfile "2dr3F.bssp"
#ERROR : Can't open dsspfile "1dvrA.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "3a00A.bssp"
#ERROR : Can't open dsspfile "1e2kA.bssp"
#ERROR : Can't open dsspfile "2bkeA.bssp"
#ERROR : Can't open dsspfile "3cmtD.bssp"
#ERROR : Can't open dsspfile "1dp0A.bssp"
#ERROR : Can't open dsspfile "1draA.bssp"
#ERROR : Can't open dsspfile "2b8wB.bssp"
#ERROR : Can't open dsspfile "2boeX.bssp"
#ERROR : Can't open dsspfile "2bx2L.bssp"
#ERROR : Can't open dsspfile "2aumB.bssp"
#ERROR : Can't open dsspfile "2bofX.bssp"
#ERROR : Can't open dsspfile "2bhjA.bssp"
#ERROR : Can't open dsspfile "3dfpC.bssp"
#ERROR : Can't open dsspfile "1e9sH.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "3dfnC.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "3ed8A.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "3bb1C.bssp"
#ERROR : Can't open dsspfile "1e9rF.bssp"
#ERROR : Can't open dsspfile "3be4A.bssp"
#ERROR : Can't open dsspfile "2a1fF.bssp"
#ERROR : Can't open dsspfile "2bv7A.bssp"
#ERROR : Can't open dsspfile "3bwdD.bssp"
#ERROR : Can't open dsspfile "2dr3D.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "2drcA.bssp"
#ERROR : Can't open dsspfile "3cmvE.bssp"
#ERROR : Can't open dsspfile "2dr3C.bssp"
#ERROR : Can't open dsspfile "2bhvA.bssp"
#ERROR : Can't open dsspfile "3cnnA.bssp"
#ERROR : Can't open dsspfile "3dfnD.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "3cm0A.bssp"
#ERROR : Can't open dsspfile "1bmfC.bssp"
#ERROR : Can't open dsspfile "1akeA.bssp"
#ERROR : Can't open dsspfile "1culC.bssp"
#ERROR : Can't open dsspfile "1d2zD.bssp"
#ERROR : Can't open dsspfile "1e2gA.bssp"
#ERROR : Can't open dsspfile "3bjdB.bssp"
#ERROR : Can't open dsspfile "3b85B.bssp"
#ERROR : Can't open dsspfile "1e9sL.bssp"
#ERROR : Can't open dsspfile "3dm9B.bssp"
#ERROR : Can't open dsspfile "1cs4C.bssp"
#ERROR : Can't open dsspfile "3bb1G.bssp"
#ERROR : Can't open dsspfile "2dpyB.bssp"
#ERROR : Can't open dsspfile "2dflA.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "1ak2A.bssp"
#ERROR : Can't open dsspfile "1e59A.bssp"
#ERROR : Can't open dsspfile "1cjtC.bssp"
#ERROR : Can't open dsspfile "1c9kC.bssp"
#ERROR : Can't open dsspfile "2c9oA.bssp"
#ERROR : Can't open dsspfile "3crmA.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1e2mB.bssp"
#ERROR : Can't open dsspfile "1e9rG.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "3cqcA.bssp"
#ERROR : Can't open dsspfile "1e2lB.bssp"
#ERROR : Can't open dsspfile "3b55A.bssp"
#ERROR : Can't open dsspfile "2e85B.bssp"
#ERROR : Can't open dsspfile "3cmvB.bssp"
#ERROR : Can't open dsspfile "1e9sM.bssp"
#ERROR : Can't open dsspfile "2cdnA.bssp"
#ERROR : Can't open dsspfile "2a1fD.bssp"
#ERROR : Can't open dsspfile "3dmdA.bssp"
#ERROR : Can't open dsspfile "1e2iA.bssp"
#ERROR : Can't open dsspfile "3dymA.bssp"
#ERROR : Can't open dsspfile "3dfqC.bssp"
#ERROR : Can't open dsspfile "1e3mA.bssp"
#ERROR : Can't open dsspfile "2czvB.bssp"
#ERROR : Can't open dsspfile "3dm5B.bssp"
#ERROR : Can't open dsspfile "2dpyA.bssp"
#ERROR : Can't open dsspfile "2a78A.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "1e9sA.bssp"
#ERROR : Can't open dsspfile "2d4uB.bssp"
#ERROR : Can't open dsspfile "2bjbA.bssp"
#ERROR : Can't open dsspfile "2aexA.bssp"
#ERROR : Can't open dsspfile "3d3qB.bssp"
#ERROR : Can't open dsspfile "5dfrA.bssp"
#ERROR : Can't open dsspfile "3e70C.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"
#ERROR : Can't open dsspfile "3dffA.bssp"
#ERROR : Can't open dsspfile "3do6A.bssp"
#ERROR : Can't open dsspfile "3e8aC.bssp"
#ERROR : Can't open dsspfile "3ec1A.bssp"
#ERROR : Can't open dsspfile "3dauA.bssp"
#ERROR : Can't open dsspfile "1e2iB.bssp"
#ERROR : Can't open dsspfile "3c14C.bssp"
#ERROR : Can't open dsspfile "3cd9A.bssp"
#ERROR : Can't open dsspfile "1e4vA.bssp"
#ERROR : Can't open dsspfile "3a00B.bssp"
#ERROR : Can't open dsspfile "3dfoC.bssp"
#ERROR : Can't open dsspfile "3cphA.bssp"
#ERROR : Can't open dsspfile "3bb1H.bssp"
#ERROR : Can't open dsspfile "3c15C.bssp"
#ERROR : Can't open dsspfile "1e9sE.bssp"
#ERROR : Can't open dsspfile "2bwjB.bssp"
#ERROR : Can't open dsspfile "3bjqB.bssp"
#ERROR : Can't open dsspfile "2aumA.bssp"
#ERROR : Can't open dsspfile "1eamA.bssp"
#ERROR : Can't open dsspfile "1adoA.bssp"
#ERROR : Can't open dsspfile "1e1qB.bssp"
#ERROR : Can't open dsspfile "2b0lC.bssp"
#ERROR : Can't open dsspfile "1e9rB.bssp"
#ERROR : Can't open dsspfile "3bb1D.bssp"
#ERROR : Can't open dsspfile "1chdA.bssp"
#ERROR : Can't open dsspfile "3d1mA.bssp"
#ERROR : Can't open dsspfile "1ek0A.bssp"
#ERROR : Can't open dsspfile "3brwA.bssp"
#ERROR : Can't open dsspfile "1e2kB.bssp"
#ERROR : Can't open dsspfile "2a1fE.bssp"
#ERROR : Can't open dsspfile "3bv4A.bssp"
#ERROR : Can't open dsspfile "4dfrA.bssp"
#ERROR : Can't open dsspfile "1dyhA.bssp"
#ERROR : Can't open dsspfile "1e2nA.bssp"
#ERROR : Can't open dsspfile "2ancD.bssp"
#ERROR : Can't open dsspfile "2aunA.bssp"
#ERROR : Can't open dsspfile "1agpA.bssp"
#ERROR : Can't open dsspfile "3c7kA.bssp"
#ERROR : Can't open dsspfile "2b8tD.bssp"
#ERROR : Can't open dsspfile "2anbA.bssp"
#ERROR : Can't open dsspfile "1cjuC.bssp"
#ERROR : Can't open dsspfile "1azsC.bssp"
#ERROR : Can't open dsspfile "2ancB.bssp"
#ERROR : Can't open dsspfile "1e2nB.bssp"
#ERROR : Can't open dsspfile "2bhvC.bssp"
#ERROR : Can't open dsspfile "2bwjD.bssp"
#ERROR : Can't open dsspfile "2c5mD.bssp"
#ERROR : Can't open dsspfile "2a1fC.bssp"
#ERROR : Can't open dsspfile "1drbA.bssp"
#ERROR : Can't open dsspfile "1e2jA.bssp"
#ERROR : Can't open dsspfile "3dofB.bssp"
#ERROR : Can't open dsspfile "3dvlD.bssp"
#ERROR : Can't open dsspfile "1e2lA.bssp"
#ERROR : Can't open dsspfile "2axnA.bssp"
#ERROR : Can't open dsspfile "1cjvC.bssp"
#ERROR : Can't open dsspfile "3cmuA.bssp"
#ERROR : Can't open dsspfile "3dkvA.bssp"
#ERROR : Can't open dsspfile "2an9A.bssp"
#ERROR : Can't open dsspfile "2c1lA.bssp"
#ERROR : Can't open dsspfile "2dwuB.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "3dmdC.bssp"
#ERROR : Can't open dsspfile "2dwoA.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "3dm5A.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "2bifA.bssp"
#ERROR : Can't open dsspfile "3c95A.bssp"
#ERROR : Can't open dsspfile "2c04A.bssp"
#ERROR : Can't open dsspfile "2dwpA.bssp"
#ERROR : Can't open dsspfile "1bifA.bssp"
#ERROR : Can't open dsspfile "2c03A.bssp"
#ERROR : Can't open dsspfile "3dmdB.bssp"
#ERROR : Can't open dsspfile "2c61B.bssp"
#ERROR : Can't open dsspfile "1e9sF.bssp"
#ERROR : Can't open dsspfile "1bg0A.bssp"
#ERROR : Can't open dsspfile "2czvA.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "3b85A.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "2bc9A.bssp"
#ERROR : Can't open dsspfile "3bo6B.bssp"
#ERROR : Can't open dsspfile "2a5gA.bssp"
#ERROR : Can't open dsspfile "2ccgB.bssp"
#ERROR : Can't open dsspfile "2akaB.bssp"
#ERROR : Can't open dsspfile "2ctsA.bssp"
#ERROR : Can't open dsspfile "3eiuB.bssp"
#ERROR : Can't open dsspfile "2ccgA.bssp"
#ERROR : Can't open dsspfile "2dr3A.bssp"
#ERROR : Can't open dsspfile "1e9sG.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "2b8wA.bssp"
#ERROR : Can't open dsspfile "3a1wA.bssp"
#ERROR : Can't open dsspfile "1e0jA.bssp"
#ERROR : Can't open dsspfile "3da4A.bssp"
#ERROR : Can't open dsspfile "1e0jB.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "3cr7A.bssp"
#ERROR : Can't open dsspfile "2bdtA.bssp"
#ERROR : Can't open dsspfile "2axzC.bssp"
#ERROR : Can't open dsspfile "2d4hA.bssp"
#ERROR : Can't open dsspfile "1cr4A.bssp"
#ERROR : Can't open dsspfile "2bkhA.bssp"
#ERROR : Can't open dsspfile "2c9oC.bssp"
#ERROR : Can't open dsspfile "4dcgA.bssp"
#ERROR : Can't open dsspfile "2ccjB.bssp"
#ERROR : Can't open dsspfile "3d3kA.bssp"
#ERROR : Can't open dsspfile "1dkiA.bssp"
#ERROR : Can't open dsspfile "3d7wA.bssp"
#ERROR : Can't open dsspfile "2a2zD.bssp"
#ERROR : Can't open dsspfile "1e9sD.bssp"
#ERROR : Can't open dsspfile "3dt4A.bssp"
#ERROR : Can't open dsspfile "2a5jA.bssp"
#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "3cr7D.bssp"
#ERROR : Can't open dsspfile "3cr7C.bssp"
#ERROR : Can't open dsspfile "2axpA.bssp"
#ERROR : Can't open dsspfile "2a2zA.bssp"
#ERROR : Can't open dsspfile "2d4uA.bssp"
#ERROR : Can't open dsspfile "1cr2A.bssp"
#ERROR : Can't open dsspfile "421pA.bssp"
#ERROR : Can't open dsspfile "1e9fA.bssp"
#ERROR : Can't open dsspfile "1e9cA.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"
#ERROR : Can't open dsspfile "1dg3A.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "3bh0A.bssp"
#ERROR : Can't open dsspfile "2dftA.bssp"
#ERROR : Can't open dsspfile "2cgtH.bssp"
#ERROR : Can't open dsspfile "1e9rE.bssp"
#ERROR : Can't open dsspfile "2b8tA.bssp"
#ERROR : Can't open dsspfile "2cjwB.bssp"
#ERROR : Can't open dsspfile "2b8tB.bssp"
#ERROR : Can't open dsspfile "1d6jB.bssp"
#ERROR : Can't open dsspfile "3adkA.bssp"
#ERROR : Can't open dsspfile "2ahwD.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"
#ERROR : Can't open dsspfile "1e98A.bssp"
#ERROR : Can't open dsspfile "2ahvA.bssp"
#ERROR : Can't open dsspfile "3cmxA.bssp"
#ERROR : Can't open dsspfile "3di4A.bssp"
#ERROR : Can't open dsspfile "2a30D.bssp"
#ERROR : Can't open dsspfile "1cfrA.bssp"
#ERROR : Can't open dsspfile "2dr3E.bssp"
#ERROR : Can't open dsspfile "2b8tC.bssp"
#ERROR : Can't open dsspfile "2dr3B.bssp"
#ERROR : Can't open dsspfile "1e2fA.bssp"
#ERROR : Can't open dsspfile "3cddF.bssp"
#ERROR : Can't open dsspfile "3cddC.bssp"
#ERROR : Can't open dsspfile "2eg5G.bssp"
#ERROR : Can't open dsspfile "2c9yA.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "3clvA.bssp"
#ERROR : Can't open dsspfile "1dhjA.bssp"
#ERROR : Can't open dsspfile "3ch4B.bssp"
#ERROR : Can't open dsspfile "1eilA.bssp"
#ERROR : Can't open dsspfile "2a2zB.bssp"
#ERROR : Can't open dsspfile "3bb1B.bssp"
#ERROR : Can't open dsspfile "2a30B.bssp"
#ERROR : Can't open dsspfile "2b92B.bssp"
#ERROR : Can't open dsspfile "2dftC.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "2ausC.bssp"
#ERROR : Can't open dsspfile "2cvfA.bssp"
#ERROR : Can't open dsspfile "1av6A.bssp"
#ERROR : Can't open dsspfile "2a30A.bssp"
#ERROR : Can't open dsspfile "3cnlA.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "3bczC.bssp"
#ERROR : Can't open dsspfile "3cddD.bssp"
#ERROR : Can't open dsspfile "2ancF.bssp"
#ERROR : Can't open dsspfile "2aunB.bssp"
#ERROR : Can't open dsspfile "3bb1E.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "3cueF.bssp"
#ERROR : Can't open dsspfile "3cr7B.bssp"
#ERROR : Can't open dsspfile "1bglA.bssp"
#ERROR : Can't open dsspfile "3cioD.bssp"
#ERROR : Can't open dsspfile "3dlbB.bssp"
#ERROR : Can't open dsspfile "1e4yA.bssp"
#ERROR : Can't open dsspfile "2d0kA.bssp"
#ERROR : Can't open dsspfile "1e9sJ.bssp"
#ERROR : Can't open dsspfile "1e3aB.bssp"
#ERROR : Can't open dsspfile "3dfnA.bssp"
#ERROR : Can't open dsspfile "3bpbA.bssp"
#ERROR : Can't open dsspfile "2c4rL.bssp"
#ERROR : Can't open dsspfile "3d3qA.bssp"
#ERROR : Can't open dsspfile "1e9sB.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "3dfqA.bssp"
#ERROR : Can't open dsspfile "2c7cH.bssp"
#ERROR : Can't open dsspfile "1aldA.bssp"
#ERROR : Can't open dsspfile "3dfqD.bssp"
#ERROR : Can't open dsspfile "1e9dA.bssp"
#ERROR : Can't open dsspfile "1e9sI.bssp"
#ERROR : Can't open dsspfile "1cjaA.bssp"
#ERROR : Can't open dsspfile "6aldA.bssp"
#ERROR : Can't open dsspfile "2d7vA.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "1cr1A.bssp"
#ERROR : Can't open dsspfile "3dyoA.bssp"
#ERROR : Can't open dsspfile "1dekB.bssp"
#ERROR : Can't open dsspfile "2bhvD.bssp"
#ERROR : Can't open dsspfile "1dhiA.bssp"
#ERROR : Can't open dsspfile "1e3mB.bssp"
#ERROR : Can't open dsspfile "2bwjA.bssp"
#ERROR : Can't open dsspfile "2d7vB.bssp"
#ERROR : Can't open dsspfile "3dfoD.bssp"
#ERROR : Can't open dsspfile "3dfpD.bssp"
#ERROR : Can't open dsspfile "3cmwC.bssp"
#ERROR : Can't open dsspfile "2ck3C.bssp"
#ERROR : Can't open dsspfile "3c8uA.bssp"
#ERROR : Can't open dsspfile "3cbnA.bssp"
#ERROR : Can't open dsspfile "3dftC.bssp"
#ERROR : Can't open dsspfile "2d4hB.bssp"
#ERROR : Can't open dsspfile "3dftD.bssp"
#ERROR : Can't open dsspfile "1dvrA.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "3a00A.bssp"
#ERROR : Can't open dsspfile "1e2kA.bssp"
#ERROR : Can't open dsspfile "3cmtD.bssp"
#ERROR : Can't open dsspfile "1dp0A.bssp"
#ERROR : Can't open dsspfile "1draA.bssp"
#ERROR : Can't open dsspfile "2boeX.bssp"
#ERROR : Can't open dsspfile "2bx2L.bssp"
#ERROR : Can't open dsspfile "2aumB.bssp"
#ERROR : Can't open dsspfile "2bofX.bssp"
#ERROR : Can't open dsspfile "3dfpC.bssp"
#ERROR : Can't open dsspfile "1e9sH.bssp"
#ERROR : Can't open dsspfile "3dfnC.bssp"
#ERROR : Can't open dsspfile "3ed8A.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "1e9rF.bssp"
#ERROR : Can't open dsspfile "2a1fF.bssp"
#ERROR : Can't open dsspfile "2bv7A.bssp"
#ERROR : Can't open dsspfile "3bwdD.bssp"
#ERROR : Can't open dsspfile "2dr3D.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "2drcA.bssp"
#ERROR : Can't open dsspfile "3cmvE.bssp"
#ERROR : Can't open dsspfile "2dr3C.bssp"
#ERROR : Can't open dsspfile "2bhvA.bssp"
#ERROR : Can't open dsspfile "3cnnA.bssp"
#ERROR : Can't open dsspfile "3dfnD.bssp"
#ERROR : Can't open dsspfile "3cm0A.bssp"
#ERROR : Can't open dsspfile "1bmfC.bssp"
#ERROR : Can't open dsspfile "1akeA.bssp"
#ERROR : Can't open dsspfile "1culC.bssp"
#ERROR : Can't open dsspfile "1e2gA.bssp"
#ERROR : Can't open dsspfile "3bjdB.bssp"
#ERROR : Can't open dsspfile "1e9sL.bssp"
#ERROR : Can't open dsspfile "1cs4C.bssp"
#ERROR : Can't open dsspfile "2dpyB.bssp"
#ERROR : Can't open dsspfile "1ak2A.bssp"
#ERROR : Can't open dsspfile "1e59A.bssp"
#ERROR : Can't open dsspfile "1cjtC.bssp"
#ERROR : Can't open dsspfile "1c9kC.bssp"
#ERROR : Can't open dsspfile "3crmA.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1e9rG.bssp"
#ERROR : Can't open dsspfile "1e2lB.bssp"
#ERROR : Can't open dsspfile "3b55A.bssp"
#ERROR : Can't open dsspfile "2e85B.bssp"
#ERROR : Can't open dsspfile "1e9sM.bssp"
#ERROR : Can't open dsspfile "2cdnA.bssp"
#ERROR : Can't open dsspfile "2a1fD.bssp"
#ERROR : Can't open dsspfile "1e2iA.bssp"
#ERROR : Can't open dsspfile "1e3mA.bssp"
#ERROR : Can't open dsspfile "2czvB.bssp"
#ERROR : Can't open dsspfile "2dpyA.bssp"
#ERROR : Can't open dsspfile "1e9sA.bssp"
#ERROR : Can't open dsspfile "2bjbA.bssp"
#ERROR : Can't open dsspfile "2aexA.bssp"
#ERROR : Can't open dsspfile "3d3qB.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"
#ERROR : Can't open dsspfile "3dffA.bssp"
#ERROR : Can't open dsspfile "3e8aC.bssp"
#ERROR : Can't open dsspfile "1e2iB.bssp"
#ERROR : Can't open dsspfile "3c14C.bssp"
#ERROR : Can't open dsspfile "1e4vA.bssp"
#ERROR : Can't open dsspfile "3a00B.bssp"
#ERROR : Can't open dsspfile "3cphA.bssp"
#ERROR : Can't open dsspfile "3c15C.bssp"
#ERROR : Can't open dsspfile "2bwjB.bssp"
#ERROR : Can't open dsspfile "3bjqB.bssp"
#ERROR : Can't open dsspfile "2aumA.bssp"
#ERROR : Can't open dsspfile "1eamA.bssp"
#ERROR : Can't open dsspfile "1adoA.bssp"
#ERROR : Can't open dsspfile "1e1qB.bssp"
#ERROR : Can't open dsspfile "2b0lC.bssp"
#ERROR : Can't open dsspfile "1chdA.bssp"
#ERROR : Can't open dsspfile "3d1mA.bssp"
#ERROR : Can't open dsspfile "1ek0A.bssp"
#ERROR : Can't open dsspfile "2aunA.bssp"
#ERROR : Can't open dsspfile "1cjuC.bssp"
#ERROR : Can't open dsspfile "2bwjD.bssp"
#ERROR : Can't open dsspfile "1e2jA.bssp"
#ERROR : Can't open dsspfile "3cmuA.bssp"

## Summary of PDB Search
:491
    1e-37   9%  3cmvG  [x.x.x] PROTEIN RECA
    1e-25  12%  3cmvA  [x.x.x] PROTEIN RECA
    2e-25  10%  3czpB  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    6e-25  11%  3cmvC  [x.x.x] PROTEIN RECA
    8e-25  22%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-24   9%  3dmdC  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    1e-24   9%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    4e-24  14%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    8e-24   9%  3dm5A  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    2e-23  19%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    5e-23   8%  1d1cA  [c.37.1 - b.34.3] MYOSIN
    1e-22  20%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN
    2e-22   7%  2bifA  [c.37.1 - c.60.1] PROTEIN
    2e-22   6%  2akaA  [x.x.x] MYOSIN II HEAVY CHAIN
    2e-22  14%  3cmvH  [x.x.x] PROTEIN RECA
    3e-22  11%  3c95A  [x.x.x] EXODEOXYRIBONUCLEASE I
    4e-22   9%  1aroP  [e.8.1] T7 RNA POLYMERASE
    3e-21  13%  2c04A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    4e-21   8%  3eiuA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    9e-21   7%  2dwpA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    1e-20  10%  3czpA  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    3e-20   7%  1bifA  [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/
    4e-20   8%  3b2qA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    4e-20  14%  2c03A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    4e-20   9%  3dmdB  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    8e-20   7%  2c61B  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    8e-20  11%  1e9sF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    8e-20  10%  1bg0A  [a.83.1 - d.128.1 (1m15A)] ARGININE KINASE
    1e-19  10%  2czvA  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    2e-19  16%  1e69A  [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN
    2e-19  14%  3b85A  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    2e-19  16%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-19  12%  2bc9A  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-18   7%  3bo6B  [x.x.x] HYDROPHILIC PROTEIN, VIRA PROTEIN
    1e-18   7%  2a5gA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    2e-18  13%  2ccgB  [x.x.x] THYMIDYLATE KINASE
    3e-18  10%  2akaB  [x.x.x] DYNAMIN-1
    3e-18  11%  2ctsA  [x.x.x] CITRATE SYNTHASE
    4e-18   6%  3bgwD  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    6e-18   8%  3eiuB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    1e-17  12%  2ccgA  [x.x.x] THYMIDYLATE KINASE
    1e-17   7%  2dr3A  [x.x.x] UPF0273 PROTEIN PH0284
    1e-17  13%  1e9sG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-17  12%  1e9rA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-17  15%  2b8wA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    7e-17   8%  3a1wA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    7e-17   8%  1e0jA  [c.37.1] DNA HELICASE
    8e-17   8%  2c61A  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    8e-17  10%  3da4A  [x.x.x] COLICIN-M
    1e-16   9%  1e0jB  [c.37.1] DNA HELICASE
    1e-16  23%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    2e-16  24%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-16   7%  3b2qB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    3e-16   5%  2bkiA  [x.x.x] UNCONVENTIONAL MYOSIN
    3e-16  11%  3cr7A  [x.x.x] ADENYLYL-SULFATE KINASE
    5e-16  10%  2bdtA  [x.x.x] BH3686
    5e-16   8%  2axzC  [x.x.x] PRGX
    8e-16   7%  3dt2A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    8e-16  12%  2d4hA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    9e-16   9%  1cr4A  [c.37.1] DNA PRIMASE/HELICASE
    1e-15   5%  2bkhA  [x.x.x] UNCONVENTIONAL MYOSIN
    1e-15   9%  2c9oC  [x.x.x] RUVB-LIKE 1
    2e-15  12%  4dcgA  [x.x.x] VP39
    2e-15  23%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-15  15%  2ccjB  [x.x.x] THYMIDYLATE KINASE
    3e-15  10%  3d3kA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
    3e-15   8%  1dkiA  [d.3.1] PYROGENIC EXOTOXIN B ZYMOGEN
    3e-15  13%  3d7wA  [x.x.x] BETA-GALACTOSIDE-SPECIFIC LECTIN 1
    3e-15   8%  3dtbB  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    3e-15  10%  2a2zD  [x.x.x] DEOXYCYTIDINE KINASE
    4e-15  11%  1e9sD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-15   6%  3dt4A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    5e-15  12%  2a5jA  [x.x.x] RAS-RELATED PROTEIN RAB-2B
    6e-15   7%  1e2dA  [c.37.1] THYMIDYLATE KINASE
    8e-15  14%  3cr7D  [x.x.x] ADENYLYL-SULFATE KINASE
    8e-15  12%  3cr7C  [x.x.x] ADENYLYL-SULFATE KINASE
    2e-14   8%  2c9gA  [x.x.x] PENTON PROTEIN
    2e-14  13%  2axpA  [x.x.x] HYPOTHETICAL PROTEIN BSU20280
    2e-14   8%  2a2zA  [x.x.x] DEOXYCYTIDINE KINASE
    2e-14  10%  2d4uA  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    3e-14  13%  1cr2A  [c.37.1] DNA PRIMASE/HELICASE
    3e-14  13%  421pA  [x.x.x] H-RAS P21 PROTEIN
    3e-14  14%  1e9fA  [c.37.1] THYMIDYLATE KINASE
    3e-14  13%  1e9cA  [c.37.1] THYMIDYLATE KINASE
    4e-14  11%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-14  11%  2cckB  [x.x.x] THYMIDYLATE KINASE
    4e-14  12%  1dg3A  [c.37.1 - a.114.1] PROTEIN (INTERFERON-INDUCED
    5e-14  10%  1e6cA  [c.37.1] SHIKIMATE KINASE
    6e-14   6%  3bh0A  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    1e-13  12%  2dftA  [x.x.x] SHIKIMATE KINASE
    1e-13  10%  3dt4C  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    1e-13   7%  2cgtH  [x.x.x] 60 KDA GROEL
    1e-13  12%  1e9rE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-13  12%  2b8tA  [x.x.x] THYMIDINE KINASE
    2e-13  13%  2cjwB  [x.x.x] GTP-BINDING PROTEIN GEM
    3e-13  11%  2b8tB  [x.x.x] THYMIDINE KINASE
    4e-13  14%  1d6jB  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    4e-13  10%  3adkA  [x.x.x] ADENYLATE KINASE
    5e-13   7%  2ahwD  [x.x.x] PUTATIVE ENZYME YDIF
    6e-13  14%  2cckA  [x.x.x] THYMIDYLATE KINASE
    7e-13  10%  3bgwA  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    7e-13  11%  1e98A  [c.37.1] THYMIDYLATE KINASE
    9e-13   7%  2ahvA  [x.x.x] PUTATIVE ENZYME YDIF
    9e-13  13%  3cmxA  [x.x.x] PROTEIN RECA
    9e-13  10%  3di4A  [x.x.x] UNCHARACTERIZED PROTEIN DUF1989
    9e-13   9%  2a30D  [x.x.x] DEOXYCYTIDINE KINASE
    9e-13  10%  1cfrA  [x.x.x] RESTRICTION ENDONUCLEASE
    1e-12   7%  2dr3E  [x.x.x] UPF0273 PROTEIN PH0284
    2e-12   9%  2b8tC  [x.x.x] THYMIDINE KINASE
    2e-12   9%  2dr3B  [x.x.x] UPF0273 PROTEIN PH0284
    2e-12  12%  1e2fA  [c.37.1] THYMIDYLATE KINASE
    2e-12   8%  3cddF  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    3e-12   9%  3cddC  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    4e-12  10%  2eg5G  [x.x.x] XANTHOSINE METHYLTRANSFERASE
    4e-12  10%  2c9yA  [x.x.x] ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL
    5e-12  22%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-12  11%  3clvA  [x.x.x] RAB5 PROTEIN, PUTATIVE
    6e-12  10%  1dhjA  [c.71.1] DIHYDROFOLATE REDUCTASE
    6e-12   9%  3ch4B  [x.x.x] PHOSPHOMEVALONATE KINASE
    7e-12  11%  1eilA  [d.32.1 - d.32.1] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE
    1e-11   9%  2a2zB  [x.x.x] DEOXYCYTIDINE KINASE
    1e-11  12%  3bb1B  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-11   7%  2a30B  [x.x.x] DEOXYCYTIDINE KINASE
    1e-11  11%  2b92B  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    2e-11  11%  2dftC  [x.x.x] SHIKIMATE KINASE
    2e-11  21%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-11  18%  2ausC  [x.x.x] PSEUDOURIDINE SYNTHASE
    2e-11  15%  2cvfA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB
    2e-11   8%  1av6A  [c.66.1] PROTEIN (VP39 PROTEIN (E.C.2.7.7.19))
    2e-11   7%  3dt7A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    4e-11   9%  2a30A  [x.x.x] DEOXYCYTIDINE KINASE
    4e-11  11%  3cnlA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    4e-11  17%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-11  10%  3bczC  [x.x.x] PROTEIN MEMO1
    5e-11   9%  1accA  [x.x.x] ANTHRAX PROTECTIVE ANTIGEN
    5e-11  12%  3cddD  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    6e-11  10%  2ancF  [x.x.x] GUANYLATE KINASE
    6e-11  10%  2aunB  [x.x.x] HYPOTHETICAL PROTEIN
    7e-11  13%  3bb1E  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    8e-11  20%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    8e-11  13%  3cueF  [x.x.x] GTP-BINDING PROTEIN YPT1
    9e-11  13%  3cr7B  [x.x.x] ADENYLYL-SULFATE KINASE
    9e-11   5%  1bglA  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    9e-11  21%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-10  29%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-10  10%  3cioD  [x.x.x] TYROSINE-PROTEIN KINASE ETK
    1e-10   6%  3czjA  [x.x.x] BETA-GALACTOSIDASE
    1e-10   8%  3dlbB  [x.x.x] ARGONAUTE
    1e-10  21%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-10   8%  1e4yA  [c.37.1 - g.41.2] ADENYLATE KINASE
    2e-10   9%  2d0kA  [x.x.x] DIHYDROFOLATE REDUCTASE
    2e-10  10%  1e9rD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-10  12%  1e9sJ  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-10  11%  3bb1A  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-10   8%  1e3aB  [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT
    2e-10  25%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    2e-10  12%  3dfnA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-10  10%  3bpbA  [x.x.x] DIMETHYLARGININE DIMETHYLAMINOHYDROLASE
    3e-10   9%  2c4rL  [x.x.x] RIBONUCLEASE E
    3e-10  11%  3d3qA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    3e-10   8%  2c0bL  [x.x.x] RIBONUCLEASE E
    3e-10  10%  1e9sB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-10  10%  1cr0A  [c.37.1] DNA PRIMASE/HELICASE
    3e-10  12%  3dfqA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-10  12%  2c7cH  [x.x.x] 60 KDA CHAPERONIN
    4e-10  12%  1aldA  [c.1.10 (2aldA)] ALDOLASE A
    4e-10  12%  3dfqD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-10  12%  1e9dA  [c.37.1] THYMIDYLATE KINASE
    6e-10  10%  1e9sI  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    7e-10   3%  1cjaA  [d.144.1] PROTEIN (ACTIN-FRAGMIN KINASE)
    7e-10  19%  3b9qA  [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT
    7e-10  12%  6aldA  [c.1.10] FRUCTOSE-1,6-BIS(PHOSPHATE) ALDOLASE
    7e-10  11%  2d7vA  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    8e-10  11%  1d6jA  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    8e-10  15%  1cr1A  [c.37.1] DNA PRIMASE/HELICASE
    8e-10  10%  3dyoA  [x.x.x] BETA-GALACTOSIDASE
    9e-10  13%  1dekB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    1e-09  10%  1ai4B  [d.153.1] PENICILLIN AMIDOHYDROLASE
    1e-09   7%  2bhvD  [x.x.x] COMB10
    1e-09  10%  1dhiA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-09  12%  1e3mB  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    1e-09   9%  2bwjA  [x.x.x] ADENYLATE KINASE 5
    2e-09  13%  1e2hB  [c.37.1] THYMIDINE KINASE
    2e-09  11%  2d7vB  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    2e-09  12%  3dfoD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-09  12%  3dfpD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-09  12%  3bb1F  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-09  15%  3cmwC  [x.x.x] PROTEIN RECA
    2e-09  12%  2ck3C  [x.x.x] ATP SYNTHASE ALPHA CHAIN HEART ISOFORM
    2e-09  12%  3c8uA  [x.x.x] FRUCTOKINASE
    3e-09  11%  3cbnA  [x.x.x] CONSERVED PROTEIN MTH639
    3e-09  12%  3dftC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-09  11%  2d4hB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    3e-09  12%  3dftD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-09  11%  2dr3F  [x.x.x] UPF0273 PROTEIN PH0284
    3e-09  10%  1dvrA  [c.37.1 - g.41.2] ADENYLATE KINASE
    4e-09  22%  1d8jA  [a.4.5] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    4e-09  17%  3a00A  [x.x.x] GUANYLATE KINASE
    5e-09  11%  1e2kA  [c.37.1] THYMIDINE KINASE
    5e-09   9%  2bkeA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    6e-09  10%  3cmtD  [x.x.x] PROTEIN RECA
    7e-09   9%  1dp0A  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    7e-09  10%  1draA  [c.71.1] DIHYDROFOLATE REDUCTASE
    7e-09  13%  2b8wB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    8e-09  10%  2boeX  [x.x.x] ENDOGLUCANASE E-2
    8e-09   9%  2bx2L  [x.x.x] RIBONUCLEASE E
    1e-08   8%  2aumB  [x.x.x] HYPOTHETICAL PROTEIN
    1e-08   8%  2bofX  [x.x.x] ENDOGLUCANASE E-2
    1e-08   4%  2bhjA  [x.x.x] NITRIC OXIDE SYNTHASE
    1e-08   7%  3dfpC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-08  13%  1e9sH  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-08  19%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    2e-08  11%  3dfnC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-08  19%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-08  15%  3ed8A  [x.x.x] YELLOW FLUORESCENCE PROTEIN
    2e-08   7%  1ckvA  [x.x.x] PROTEIN (PROTEIN B)
    2e-08  12%  3bb1C  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-08  14%  1e9rF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-08   9%  3be4A  [x.x.x] ADENYLATE KINASE
    2e-08  15%  2a1fF  [x.x.x] URIDYLATE KINASE
    3e-08  10%  2bv7A  [x.x.x] GLYCOLIPID TRANSFER PROTEIN
    3e-08  10%  3bwdD  [x.x.x] RAC-LIKE GTP-BINDING PROTEIN ARAC6
    3e-08   9%  2dr3D  [x.x.x] UPF0273 PROTEIN PH0284
    3e-08  16%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-08  10%  2drcA  [c.71.1] DIHYDROFOLATE REDUCTASE
    4e-08  14%  3cmvE  [x.x.x] PROTEIN RECA
    4e-08   8%  2dr3C  [x.x.x] UPF0273 PROTEIN PH0284
    5e-08   8%  2bhvA  [x.x.x] COMB10
    6e-08  11%  3cnnA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    6e-08   7%  3dfnD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    6e-08  21%  2d2eA  [x.x.x] SUFC PROTEIN
    7e-08  16%  3cm0A  [x.x.x] ADENYLATE KINASE
    7e-08  11%  1bmfC  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    8e-08   7%  1akeA  [c.37.1 - g.41.2] ADENYLATE KINASE
    8e-08  10%  1culC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    9e-08   9%  1d2zD  [a.77.1] DEATH DOMAIN OF TUBE
    9e-08  12%  1e2gA  [c.37.1] THYMIDYLATE KINASE
    1e-07  16%  3bjdB  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)
    1e-07  11%  3b85B  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    1e-07  15%  1e9sL  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-07  12%  3dm9B  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    2e-07  17%  1cs4C  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    2e-07  17%  3bb1G  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-07  18%  2dpyB  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    2e-07   8%  2dflA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    2e-07  29%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-07  12%  1ak2A  [x.x.x] ADENYLATE KINASE ISOENZYME-2
    2e-07  10%  1e59A  [c.60.1] PHOSPHOGLYCERATE MUTASE
    2e-07  16%  1cjtC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    3e-07  11%  1c9kC  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    3e-07  11%  2c9oA  [x.x.x] RUVB-LIKE 1
    3e-07  13%  3crmA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    3e-07   8%  1afrA  [a.25.1] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    3e-07  23%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    3e-07  14%  1e2mB  [c.37.1] THYMIDINE KINASE
    3e-07  19%  1e9rG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-07  15%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-07  10%  3cqcA  [x.x.x] NUCLEAR PORE COMPLEX PROTEIN NUP107
    3e-07  13%  1e2lB  [c.37.1] THYMIDINE KINASE
    3e-07  12%  3b55A  [x.x.x] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN
    4e-07  16%  2e85B  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    4e-07  24%  3cmvB  [x.x.x] PROTEIN RECA
    4e-07  19%  1e9sM  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-07  13%  2cdnA  [x.x.x] ADENYLATE KINASE
    5e-07  15%  2a1fD  [x.x.x] URIDYLATE KINASE
    5e-07  17%  3dmdA  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    6e-07  12%  1e2iA  [c.37.1] THYMIDINE KINASE
    6e-07  10%  3dymA  [x.x.x] BETA-GALACTOSIDASE
    7e-07  12%  3dfqC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    7e-07   7%  1e3mA  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    8e-07   8%  2czvB  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    8e-07  14%  3dm5B  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    1e-06  18%  2dpyA  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    1e-06  14%  2a78A  [x.x.x] RAS-RELATED PROTEIN RAL-A
    2e-06  19%  2d2fA  [x.x.x] SUFC PROTEIN
    2e-06  16%  1e9sA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-06  11%  2d4uB  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    2e-06  13%  2bjbA  [x.x.x] 3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE
    2e-06  24%  2aexA  [x.x.x] COPROPORPHYRINOGEN III OXIDASE, MITOCHONDRIAL
    2e-06  12%  3d3qB  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    2e-06  11%  5dfrA  [x.x.x] DIHYDROFOLATE REDUCTASE
    3e-06  16%  3e70C  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    3e-06   9%  1dekA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    3e-06  12%  3dffA  [x.x.x] TEICOPLANIN PSEUDOAGLYCONE DEACETYLASES ORF2
    3e-06  16%  3do6A  [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
    4e-06  16%  3e8aC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    4e-06  10%  3ec1A  [x.x.x] YQEH GTPASE
    5e-06  11%  3dauA  [c.71.1 (1ddrA)] DIHYDROFOLATE REDUCTASE
    5e-06  10%  1e2iB  [c.37.1] THYMIDINE KINASE
    5e-06  12%  3c14C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    5e-06   6%  3cd9A  [x.x.x] GREEN FLUORESCENT PROTEIN
    6e-06   7%  1e4vA  [c.37.1 - g.41.2] ADENYLATE KINASE
    6e-06  16%  3a00B  [x.x.x] GUANYLATE KINASE
    7e-06  12%  3dfoC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    8e-06  11%  3cphA  [x.x.x] RAS-RELATED PROTEIN SEC4
    8e-06  20%  3bb1H  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    8e-06  21%  3c15C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    9e-06  15%  1e9sE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    9e-06  19%  2bwjB  [x.x.x] ADENYLATE KINASE 5
    9e-06   9%  3bjqB  [x.x.x] PHAGE-RELATED PROTEIN
    1e-05   9%  2aumA  [x.x.x] HYPOTHETICAL PROTEIN
    1e-05  15%  1eamA  [c.66.1] PROTEIN (VP39)
    1e-05  10%  1adoA  [c.1.10] ALDOLASE
    2e-05  12%  1e1qB  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    2e-05   9%  2b0lC  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    2e-05  12%  1e9rB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-05  20%  3bb1D  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-05  10%  1chdA  [x.x.x] CHEB METHYLESTERASE
    3e-05  18%  3d1mA  [x.x.x] SONIC HEDGEHOG PROTEIN
    3e-05  10%  1ek0A  [c.37.1] PROTEIN (GTP-BINDING PROTEIN YPT51)
    3e-05   9%  3brwA  [x.x.x] RAP1 GTPASE-ACTIVATING PROTEIN 1
    3e-05  13%  1e2kB  [c.37.1] THYMIDINE KINASE
    4e-05  18%  2a1fE  [x.x.x] URIDYLATE KINASE
    5e-05  12%  3bv4A  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    5e-05  11%  4dfrA  [c.71.1] DIHYDROFOLATE REDUCTASE
    5e-05  11%  1dyhA  [c.71.1] DIHYDROFOLATE REDUCTASE
    5e-05   8%  1e2nA  [c.37.1] THYMIDINE KINASE
    6e-05  38%  2ancD  [x.x.x] GUANYLATE KINASE
    6e-05   8%  2aunA  [x.x.x] HYPOTHETICAL PROTEIN
    6e-05  13%  1agpA  [x.x.x] C-H-RAS P21 PROTEIN
    7e-05  14%  3c7kA  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
    8e-05  32%  2b8tD  [x.x.x] THYMIDINE KINASE
    8e-05  44%  2anbA  [x.x.x] GUANYLATE KINASE
    9e-05  24%  1cjuC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    9e-05  25%  1azsC  [c.37.1 - a.66.1] GS-ALPHA
    1e-04  42%  2ancB  [x.x.x] GUANYLATE KINASE
    1e-04  13%  1e2nB  [c.37.1] THYMIDINE KINASE
    1e-04  16%  2bhvC  [x.x.x] COMB10
    2e-04  22%  2bwjD  [x.x.x] ADENYLATE KINASE 5
    2e-04  13%  2c5mD  [x.x.x] CTP SYNTHASE
    3e-04  18%  2a1fC  [x.x.x] URIDYLATE KINASE
    3e-04  10%  1drbA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-04  13%  1e2jA  [c.37.1] THYMIDINE KINASE
    4e-04  13%  3dofB  [x.x.x] ADP-RIBOSYLATION FACTOR-LIKE PROTEIN 2-BINDING
    4e-04  16%  3dvlD  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    4e-04  13%  1e2lA  [c.37.1] THYMIDINE KINASE
    5e-04  18%  2axnA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    5e-04  16%  1cjvC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    5e-04  15%  3cmuA  [x.x.x] PROTEIN RECA
    6e-04  17%  3dkvA  [x.x.x] ADENYLATE KINASE
    7e-04  44%  2an9A  [x.x.x] GUANYLATE KINASE
    9e-04   7%  2c1lA  [x.x.x] RESTRICTION ENDONUCLEASE
    0.001  17%  2dwuB  [x.x.x] GLUTAMATE RACEMASE
    2e-17  19%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING(query 10->198)
    6e-19  13%  3dmdC  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR(query 10->210)
    1e-19   9%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-(query 1->198)
    4e-19  15%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN(query 4->210)
    1e-16  14%  3dm5A  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN(query 15->198)
    6e-18  18%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC(query 4->210)
    3e-16  21%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN(query 4->198)
    1e-20   8%  2bifA  [c.37.1 - c.60.1] PROTEIN(query 33->207)
    2e-16  10%  3c95A  [x.x.x] EXODEOXYRIBONUCLEASE I(query 19->188)
    1e-13  16%  2c04A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN(query 4->187)
    2e-16   8%  2dwpA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-(query 23->191)
    6e-20   7%  1bifA  [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/(query 286->461)
    2e-14  17%  2c03A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN(query 4->192)
    5e-16  12%  3dmdB  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR(query 1->210)
    3e-15  14%  2c61B  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B(query 10->178)
    2e-09  15%  1e9sF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 3->176)
    3e-13  10%  1bg0A  [a.83.1 - d.128.1 (1m15A)] ARGININE KINASE(query 16->206)
    2e-17  11%  2czvA  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3(query 23->200)
    1e-13  17%  1e69A  [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN(query 12->198)
    7e-15  10%  3b85A  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN(query 15->176)
    3e-13  17%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 4->183)
    2e-15  12%  2bc9A  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1(query 4->178)
    1e-11   9%  3bo6B  [x.x.x] HYDROPHILIC PROTEIN, VIRA PROTEIN(query 10->210)
    3e-16   7%  2a5gA  [x.x.x] ADP-RIBOSYLATION FACTOR 6(query 29->178)
    1e-15  12%  2ccgB  [x.x.x] THYMIDYLATE KINASE(query 29->191)
    3e-14  12%  2akaB  [x.x.x] DYNAMIN-1(query 19->210)
    2e-12  10%  2ctsA  [x.x.x] CITRATE SYNTHASE(query 10->163)
    3e-11   8%  3eiuB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN(query 4->174)
    1e-16  12%  2ccgA  [x.x.x] THYMIDYLATE KINASE(query 291->480)
    3e-15   9%  2dr3A  [x.x.x] UPF0273 PROTEIN PH0284(query 11->205)
    2e-09  14%  1e9sG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 3->178)
    2e-12  14%  1e9rA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 3->182)
    8e-07  14%  2b8wA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1(query 1->167)
    5e-14   9%  3a1wA  [x.x.x] IRON(II) TRANSPORT PROTEIN B(query 33->181)
    1e-11  11%  1e0jA  [c.37.1] DNA HELICASE(query 1->174)
    2e-06  13%  3da4A  [x.x.x] COLICIN-M(query 23->154)
    2e-11  10%  1e0jB  [c.37.1] DNA HELICASE(query 4->173)
    1e-10  18%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING(query 1->202)
    2e-13  24%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 9->210)
    7e-14  14%  3cr7A  [x.x.x] ADENYLYL-SULFATE KINASE(query 29->189)
    2e-13   9%  2bdtA  [x.x.x] BH3686(query 287->453)
    3e-10  13%  2axzC  [x.x.x] PRGX(query 118->187)
    1e-08  16%  2d4hA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1(query 4->188)
    1e-11  10%  1cr4A  [c.37.1] DNA PRIMASE/HELICASE(query 4->202)
    9e-11  12%  2bkhA  [x.x.x] UNCONVENTIONAL MYOSIN(query 10->176)
    3e-07  13%  2c9oC  [x.x.x] RUVB-LIKE 1(query 19->191)
    2e-13   6%  4dcgA  [x.x.x] VP39(query 234->468)
    3e-15  12%  2ccjB  [x.x.x] THYMIDYLATE KINASE(query 33->198)
    2e-12  12%  3d3kA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3(query 19->210)
    2e-10  10%  1dkiA  [d.3.1] PYROGENIC EXOTOXIN B ZYMOGEN(query 1->198)
    2e-11  10%  3d7wA  [x.x.x] BETA-GALACTOSIDE-SPECIFIC LECTIN 1(query 23->202)
    2e-11   8%  2a2zD  [x.x.x] DEOXYCYTIDINE KINASE(query 29->198)
    6e-07  15%  1e9sD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 2->198)
    7e-08   9%  3dt4A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC(query 23->198)
    2e-11   9%  2a5jA  [x.x.x] RAS-RELATED PROTEIN RAB-2B(query 33->190)
    6e-15  11%  1e2dA  [c.37.1] THYMIDYLATE KINASE(query 29->183)
    5e-14  10%  3cr7D  [x.x.x] ADENYLYL-SULFATE KINASE(query 285->453)
    1e-12  13%  3cr7C  [x.x.x] ADENYLYL-SULFATE KINASE(query 28->185)
    3e-14   9%  2axpA  [x.x.x] HYPOTHETICAL PROTEIN BSU20280(query 291->445)
    8e-12   9%  2a2zA  [x.x.x] DEOXYCYTIDINE KINASE(query 29->191)
    1e-12  13%  2d4uA  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I(query 35->187)
    2e-09  11%  1cr2A  [c.37.1] DNA PRIMASE/HELICASE(query 4->202)
    6e-10  12%  421pA  [x.x.x] H-RAS P21 PROTEIN(query 33->183)
    6e-13  11%  1e9fA  [c.37.1] THYMIDYLATE KINASE(query 29->178)
    1e-13  10%  1e9cA  [c.37.1] THYMIDYLATE KINASE(query 29->167)
    1e-11  10%  2cckB  [x.x.x] THYMIDYLATE KINASE(query 33->198)
    4e-09  12%  1dg3A  [c.37.1 - a.114.1] PROTEIN (INTERFERON-INDUCED(query 1->178)
    2e-11  12%  1e6cA  [c.37.1] SHIKIMATE KINASE(query 33->178)
    2e-07   9%  3bh0A  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE(query 10->178)
    2e-09  13%  2dftA  [x.x.x] SHIKIMATE KINASE(query 33->178)
    3e-08   9%  2cgtH  [x.x.x] 60 KDA GROEL(query 19->191)
    5e-06  11%  1e9rE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 3->192)
    7e-12   9%  2b8tA  [x.x.x] THYMIDINE KINASE(query 29->178)
    2e-09  15%  2cjwB  [x.x.x] GTP-BINDING PROTEIN GEM(query 33->163)
    9e-11   7%  2b8tB  [x.x.x] THYMIDINE KINASE(query 29->198)
    2e-11  16%  1d6jB  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE(query 23->185)
    8e-12   8%  3adkA  [x.x.x] ADENYLATE KINASE(query 23->202)
    5e-10   7%  2ahwD  [x.x.x] PUTATIVE ENZYME YDIF(query 14->190)
    2e-09  14%  2cckA  [x.x.x] THYMIDYLATE KINASE(query 291->465)
    1e-10  11%  1e98A  [c.37.1] THYMIDYLATE KINASE(query 29->198)
    1e-07  10%  2ahvA  [x.x.x] PUTATIVE ENZYME YDIF(query 14->178)
    8e-06  11%  3cmxA  [x.x.x] PROTEIN RECA(query 20->187)
    4e-05   8%  3di4A  [x.x.x] UNCHARACTERIZED PROTEIN DUF1989(query 23->198)
    4e-11   7%  2a30D  [x.x.x] DEOXYCYTIDINE KINASE(query 29->210)
    9e-08   7%  1cfrA  [x.x.x] RESTRICTION ENDONUCLEASE(query 70->197)
    1e-08   9%  2dr3E  [x.x.x] UPF0273 PROTEIN PH0284(query 10->210)
    2e-09   7%  2b8tC  [x.x.x] THYMIDINE KINASE(query 29->210)
    6e-10  15%  2dr3B  [x.x.x] UPF0273 PROTEIN PH0284(query 39->198)
    1e-09  11%  1e2fA  [c.37.1] THYMIDYLATE KINASE(query 29->183)
    3e-07   9%  3cddF  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN(query 24->198)
    1e-07   9%  3cddC  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN(query 33->188)
    1e-08   8%  2eg5G  [x.x.x] XANTHOSINE METHYLTRANSFERASE(query 4->176)
    8e-09  10%  2c9yA  [x.x.x] ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL(query 29->174)
    4e-08  21%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 9->207)
    2e-08   9%  3clvA  [x.x.x] RAB5 PROTEIN, PUTATIVE(query 24->186)
    9e-10   8%  1dhjA  [c.71.1] DIHYDROFOLATE REDUCTASE(query 114->210)
    2e-10  11%  3ch4B  [x.x.x] PHOSPHOMEVALONATE KINASE(query 23->186)
    3e-09  10%  1eilA  [d.32.1 - d.32.1] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE(query 114->197)
    2e-08   8%  2a2zB  [x.x.x] DEOXYCYTIDINE KINASE(query 29->197)
    1e-04  12%  3bb1B  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34(query 4->198)
    1e-09   8%  2a30B  [x.x.x] DEOXYCYTIDINE KINASE(query 29->198)
    4e-11  10%  2b92B  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1(query 4->198)
    1e-07  16%  2dftC  [x.x.x] SHIKIMATE KINASE(query 33->176)
    2e-05  22%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC(query 4->198)
    5e-08  18%  2ausC  [x.x.x] PSEUDOURIDINE SYNTHASE(query 99->187)
    2e-06  14%  2cvfA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB(query 16->205)
    5e-11   7%  1av6A  [c.66.1] PROTEIN (VP39 PROTEIN (E.C.2.7.7.19))(query 286->475)
    1e-07   8%  2a30A  [x.x.x] DEOXYCYTIDINE KINASE(query 29->198)
    1e-07  14%  3cnlA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN(query 19->162)
    2e-06  18%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 10->187)
    3e-07   7%  3bczC  [x.x.x] PROTEIN MEMO1(query 23->187)
    2e-09  11%  3cddD  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN(query 10->188)
    1e-08  14%  2ancF  [x.x.x] GUANYLATE KINASE(query 29->167)
    2e-07   8%  2aunB  [x.x.x] HYPOTHETICAL PROTEIN(query 84->191)
    3e-04  13%  3bb1E  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34(query 4->198)
    6e-05  20%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC(query 4->198)
    3e-09  14%  3cueF  [x.x.x] GTP-BINDING PROTEIN YPT1(query 26->187)
    2e-07   9%  3cr7B  [x.x.x] ADENYLYL-SULFATE KINASE(query 29->181)
    4e-09  10%  1bglA  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE(query 402->468)
    5e-09   9%  3cioD  [x.x.x] TYROSINE-PROTEIN KINASE ETK(query 273->460)
    4e-09  10%  3dlbB  [x.x.x] ARGONAUTE(query 12->211)
    8e-09   9%  1e4yA  [c.37.1 - g.41.2] ADENYLATE KINASE(query 291->471)
    1e-08   8%  2d0kA  [x.x.x] DIHYDROFOLATE REDUCTASE(query 114->210)
    4e-07  15%  1e9sJ  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 2->178)
    2e-08   7%  1e3aB  [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT(query 23->198)
    4e-08   8%  3dfnA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 131->210)
    3e-06   7%  3bpbA  [x.x.x] DIMETHYLARGININE DIMETHYLAMINOHYDROLASE(query 23->191)
    3e-05  11%  2c4rL  [x.x.x] RIBONUCLEASE E(query 74->260)
    9e-06  13%  3d3qA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE(query 286->471)
    1e-06  16%  1e9sB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 3->174)
    2e-09  10%  1cr0A  [c.37.1] DNA PRIMASE/HELICASE(query 4->210)
    3e-09   8%  3dfqA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 131->210)
    4e-05   9%  2c7cH  [x.x.x] 60 KDA CHAPERONIN(query 111->210)
    1e-08   7%  1aldA  [c.1.10 (2aldA)] ALDOLASE A(query 130->210)
    4e-08   8%  3dfqD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 131->191)
    6e-10  12%  1e9dA  [c.37.1] THYMIDYLATE KINASE(query 29->173)
    1e-06  14%  1e9sI  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 10->181)
    6e-08  13%  1cjaA  [d.144.1] PROTEIN (ACTIN-FRAGMIN KINASE)(query 114->191)
    3e-08   8%  6aldA  [c.1.10] FRUCTOSE-1,6-BIS(PHOSPHATE) ALDOLASE(query 131->210)
    4e-04  10%  2d7vA  [x.x.x] HYPOTHETICAL PROTEIN VCA0330(query 1->84)
    1e-06  16%  1d6jA  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE(query 23->189)
    9e-09  13%  1cr1A  [c.37.1] DNA PRIMASE/HELICASE(query 4->210)
    1e-08   8%  3dyoA  [x.x.x] BETA-GALACTOSIDASE(query 381->465)
    7e-04  13%  1dekB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE(query 33->191)
    1e-05  10%  2bhvD  [x.x.x] COMB10(query 115->181)
    3e-07   8%  1dhiA  [c.71.1] DIHYDROFOLATE REDUCTASE(query 113->210)
    4e-07  11%  1e3mB  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR(query 321->465)
    1e-09  15%  2bwjA  [x.x.x] ADENYLATE KINASE 5(query 280->467)
    6e-04  10%  2d7vB  [x.x.x] HYPOTHETICAL PROTEIN VCA0330(query 1->59)
    4e-07   8%  3dfoD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 131->191)
    6e-07   8%  3dfpD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 131->191)
    4e-05  15%  3cmwC  [x.x.x] PROTEIN RECA(query 12->184)
    6e-07   8%  2ck3C  [x.x.x] ATP SYNTHASE ALPHA CHAIN HEART ISOFORM(query 1->211)
    4e-06  19%  3c8uA  [x.x.x] FRUCTOKINASE(query 9->165)
    3e-05   8%  3cbnA  [x.x.x] CONSERVED PROTEIN MTH639(query 123->181)
    5e-08   8%  3dftC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 131->191)
    1e-04  14%  2d4hB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1(query 1->208)
    6e-07   8%  3dftD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 131->191)
    1e-06   7%  1dvrA  [c.37.1 - g.41.2] ADENYLATE KINASE(query 27->178)
    2e-06  15%  1d8jA  [a.4.5] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA(query 119->172)
    2e-07  11%  3a00A  [x.x.x] GUANYLATE KINASE(query 33->194)
    1e-07   9%  1e2kA  [c.37.1] THYMIDINE KINASE(query 26->178)
    9e-05   8%  3cmtD  [x.x.x] PROTEIN RECA(query 21->191)
    3e-08   4%  1dp0A  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE(query 107->356)
    1e-06   8%  1draA  [c.71.1] DIHYDROFOLATE REDUCTASE(query 113->210)
    2e-06  15%  2boeX  [x.x.x] ENDOGLUCANASE E-2(query 114->198)
    3e-07   8%  2bx2L  [x.x.x] RIBONUCLEASE E(query 130->188)
    1e-05   6%  2aumB  [x.x.x] HYPOTHETICAL PROTEIN(query 85->187)
    3e-05  13%  2bofX  [x.x.x] ENDOGLUCANASE E-2(query 115->192)
    2e-08  12%  3dfpC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 396->473)
    3e-04  31%  1e9sH  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 10->51)
    5e-08   7%  3dfnC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 130->210)
    3e-05  12%  3ed8A  [x.x.x] YELLOW FLUORESCENCE PROTEIN(query 15->82)
    1e-04   6%  1ckvA  [x.x.x] PROTEIN (PROTEIN B)(query 15->119)
    3e-07  16%  1e9rF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 2->174)
    2e-06  19%  2a1fF  [x.x.x] URIDYLATE KINASE(query 137->198)
    1e-07  10%  2bv7A  [x.x.x] GLYCOLIPID TRANSFER PROTEIN(query 396->460)
    1e-07  10%  3bwdD  [x.x.x] RAC-LIKE GTP-BINDING PROTEIN ARAC6(query 29->183)
    3e-06   9%  2dr3D  [x.x.x] UPF0273 PROTEIN PH0284(query 10->201)
    4e-04  18%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 4->195)
    3e-05   8%  2drcA  [c.71.1] DIHYDROFOLATE REDUCTASE(query 113->210)
    2e-06   9%  3cmvE  [x.x.x] PROTEIN RECA(query 1->173)
    6e-06  10%  2dr3C  [x.x.x] UPF0273 PROTEIN PH0284(query 10->196)
    2e-06  15%  2bhvA  [x.x.x] COMB10(query 128->181)
    5e-07  12%  3cnnA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN(query 15->164)
    1e-07  12%  3dfnD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 396->473)
    1e-05  19%  3cm0A  [x.x.x] ADENYLATE KINASE(query 29->198)
    1e-04   8%  1bmfC  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE(query 1->201)
    4e-07   9%  1akeA  [c.37.1 - g.41.2] ADENYLATE KINASE(query 291->476)
    1e-06  16%  1culC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)(query 286->349)
    3e-07  10%  1e2gA  [c.37.1] THYMIDYLATE KINASE(query 29->181)
    1e-05  14%  3bjdB  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)(query 114->198)
    2e-04  28%  1e9sL  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 5->51)
    5e-07  13%  1cs4C  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)(query 28->95)
    0.001  18%  2dpyB  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE(query 15->187)
    4e-05  10%  1ak2A  [x.x.x] ADENYLATE KINASE ISOENZYME-2(query 29->210)
    3e-05   9%  1e59A  [c.60.1] PHOSPHOGLYCERATE MUTASE(query 24->253)
    4e-07  14%  1cjtC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)(query 286->341)
    5e-06  12%  1c9kC  [c.37.1] ADENOSYLCOBINAMIDE KINASE(query 33->192)
    9e-06  13%  3crmA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE(query 27->188)
    1e-04   5%  1afrA  [a.25.1] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE(query 23->62)
    1e-05  16%  1e9rG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 10->178)
    7e-05  12%  1e2lB  [c.37.1] THYMIDINE KINASE(query 26->203)
    4e-06   8%  3b55A  [x.x.x] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN(query 115->201)
    2e-05  11%  2e85B  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE(query 130->198)
    1e-05  22%  1e9sM  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 10->90)
    2e-05  16%  2cdnA  [x.x.x] ADENYLATE KINASE(query 27->198)
    2e-06  18%  2a1fD  [x.x.x] URIDYLATE KINASE(query 149->198)
    1e-05  10%  1e2iA  [c.37.1] THYMIDINE KINASE(query 283->435)
    8e-06  12%  1e3mA  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR(query 39->210)
    5e-06  11%  2czvB  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3(query 291->465)
    4e-04  18%  2dpyA  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE(query 15->202)
    2e-04  17%  1e9sA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB(query 6->118)
    6e-06  10%  2bjbA  [x.x.x] 3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE(query 15->191)
    4e-05  12%  2aexA  [x.x.x] COPROPORPHYRINOGEN III OXIDASE, MITOCHONDRIAL(query 418->478)
    8e-05  11%  3d3qB  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE(query 29->178)
    5e-05   8%  1dekA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE(query 33->162)
    2e-04  12%  3dffA  [x.x.x] TEICOPLANIN PSEUDOAGLYCONE DEACETYLASES ORF2(query 118->202)
    1e-05  21%  3e8aC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT(query 28->87)
    6e-06  15%  1e2iB  [c.37.1] THYMIDINE KINASE(query 285->479)
    1e-05  24%  3c14C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT(query 286->314)
    6e-06   9%  1e4vA  [c.37.1 - g.41.2] ADENYLATE KINASE(query 291->476)
    1e-05  13%  3a00B  [x.x.x] GUANYLATE KINASE(query 33->189)
    3e-04  14%  3cphA  [x.x.x] RAS-RELATED PROTEIN SEC4(query 33->187)
    1e-05  10%  3c15C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT(query 29->90)
    8e-04  18%  2bwjB  [x.x.x] ADENYLATE KINASE 5(query 280->318)
    5e-04   6%  3bjqB  [x.x.x] PHAGE-RELATED PROTEIN(query 155->205)
    3e-04   7%  2aumA  [x.x.x] HYPOTHETICAL PROTEIN(query 114->187)
    8e-05   8%  1eamA  [c.66.1] PROTEIN (VP39)(query 282->465)
    4e-05   8%  1adoA  [c.1.10] ALDOLASE(query 131->210)
    5e-04   8%  1e1qB  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE(query 10->174)
    7e-05   6%  2b0lC  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC(query 415->461)
    1e-04  16%  1chdA  [x.x.x] CHEB METHYLESTERASE(query 150->191)
    5e-05  20%  3d1mA  [x.x.x] SONIC HEDGEHOG PROTEIN(query 117->181)
    1e-04  14%  1ek0A  [c.37.1] PROTEIN (GTP-BINDING PROTEIN YPT51)(query 33->142)
    7e-04   7%  2aunA  [x.x.x] HYPOTHETICAL PROTEIN(query 99->210)
    3e-04  14%  1cjuC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)(query 28->76)
    5e-04  19%  2bwjD  [x.x.x] ADENYLATE KINASE 5(query 283->318)
    5e-04  14%  1e2jA  [c.37.1] THYMIDINE KINASE(query 33->186)
    5e-04  17%  3cmuA  [x.x.x] PROTEIN RECA(query 283->341)
:491

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSSLQISQGTFRLSDTKTLHLDSLTLNAGDSWAFVGANGSGKSALARALAGELPLLTGERQCRFTRITRL
3cmvG           LGEDRSMDVETISTGSLSLDIAAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
3cmvA           ---MDVETISTGSLSLDIALG-AGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
3czpB           ----------------------KQQARFPVIILINGIEGAGKGETVKLLNEWDPRLIEVQSFLRPSDEEL
3cmvC           ---------ISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
3b5jA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
3cmvH           ----------------------AGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
3c95A           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
3czpA           ----------------------KQQARFPVIILINGIEGAGKGETVKLLNEWDPRLIEVQSFLRPSDEEL
1bifA           ----------------------------PTLIVMVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQYRR
3b2qA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
2ccgA           --------------------------------TFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPT
2dr3A           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
2bdtA           --------------------------------IITGPAGVGKSTTCKRLAAQLDNSAYIEGDIINHVVGG
2axzC           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
4dcgA           ------YQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHH
2awnB           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
3dtbB           ----------------------SAKVIQGSLDSL---PQEVRKFVEGNAQ----LCQPEYI----HICDG
2a2zD           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
3cr7D           ---------------------------RGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIR
3cr7C           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
2axpA           --------------------------------ILEGPDCCFKSTVAAKLSKELKYPIIKEKLFEHFNKLA
2a2zA           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3dt4C           -----------------------------------------------------------------HICDG
2cgtH           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2cckA           --------------------------------TFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPT
3bgwA           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
1av6A           -------QGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHH
3dt7A           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
3cioD           ----------------------MMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRG
3czjA           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
1e4yA           --------------------------------ILLGALVAGKGTQAQFIMEKYGIPQISTGDMLRAAVKS
2d0kA           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3d31A           ----------------------------ALVRVKVDCGVPLNVLITRRSAEEMELSPGVQ----------
3dfnA           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
3d3qA           ----------------------------PFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVYQGDIG
2c0bL           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
1e3mB           --------------------------------------LVNLAERAYTLNYTCPTFIDKPGIRITEGRHP
2bwjA           ----------------------MEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSGELLREELASE
1e2hB           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2bv7A           -----------------TPIKADISGNITKIKAVYDTNPTKFRTLQNILEVEKEMYGAEWPKVGATLALM
3bwdD           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
1akeA           --------------------------------ILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKS
1culC           ---------------------------ATHRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKE
1d2zD           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
1cjtC           ---------------------------ATHRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKE
1c9kC           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
1e2iA           -------------------------MPTLLRVYIDGPHGMGKTDDIVYVPEPMTYWRVLGASETIANIYT
3dymA           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
2czvB           --------------------------------VSIKFNEEVDKEKLREARKEYGKVAILLSNPKPSLVRD
3dm5B           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
1e2iB           -------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALG-------SRDDIVYVP-
3c14C           ---------------------------ATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLK
3cd9A           ----------------------------------------------------------------------
1e4vA           --------------------------------ILLGAPVAGKGTQAQFIMEKYGIPQISTGDMLRAAVKS
3a00B           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
2bwjB           ----------------------MEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLS-----------
3bjqB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
1eamA           -------QGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHH
1adoA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
1e2kB           -------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRV
2a1fE           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
1e2nA           -------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSPMTYWRVLGASETIAN
2ancD           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1agpA           ----------------------------------------------------------------------
3c7kA           --------------------------------LLLGAGESGKSTIVKQMKIIFSGEDVKQYKPVVYSNTI
2b8tD           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
2bwjD           -------------------------LRKCKIIFIIGGPGSGKGTQCEKLVEKY-------GFTHLSTGEL
2c5mD           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
3dofB           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
1cjvC           ---------------------------ATHRLLLLGAGESGKSTIVKQMRILHVEKATKVQDIKNNLKEA
3cmuA           --------------------LGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
3dkvA           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
2c1lA           ----------------------------------------------------------------------
2dwuB           ----------------------------------VLDSGVGGLTVASEIIRQLPK--ESICYIGDNERCP
3b5jA           ---------RYKPDSPVILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGHDLALA
3dmdC           ---------ILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRA
2dwoA           LTQSRVQKIWVPV-DHRPSLPRSCGPNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRR
2c03B           ---VILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRP
3dm5A           --------------FLGTEAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWRP
2d3wB           ---LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLL
3b60A           ---LEFRNVTFTYPGREVPALRNLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREY
2bifA           --------------------------------VMVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQYRR
3c95A           ------------------ISPLLELDSDTLRAVPVKLVHINKCPVLAQANTLRPEDADRLDNLKILRENP
2c04A           ---VILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRP
2dwpA           ----------------------WVPVDHRNSPVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRR
1bifA           ----------------------------------------------------------------------
2c03A           ---VILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRP
3dmdB           IEEAVKEAVSEILETSRRIDLIIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRA
2c61B           ---------KDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMG
1e9sF           --GGKLKRMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
1bg0A           ---------------TLLDVIQSGVENLDSGVGIYAPDAESYRTFGPLFDPIIDDYHGHPPKQWGDINTL
2czvA           ----------------------EMDIRDKEAYELAKEWFDEVVVSIKFNEEVDKEKLREARKEYGKVAIL
1e69A           -----------YLKGFKSFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENLPPA
3b85A           --------------KTLGQKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIILTRPAVEA
2bbsA           ---EGFGELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCS
2bc9A           ---CLIENTNGRLANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIW
3bo6B           ---------MRQMPMSHFREALDAPDYSGMRQSGFFAMSQGFQLESHGGDVFMHAHRENPQCKGDFAGDK
2a5gA           ----------------------------EMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTY
2ccgB           ----------------------------SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPT
2akaB           ------------------SAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQ
2ctsA           ---------ASSTNLKDILADLIPKERIKTFRQQHGNTAVGQITVDMMYGGMRGMKGLVRFRGYSIPECQ
3eiuB           ---YARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSENEEAQYFMSDF
2ccgA           ----------------------------------------------------------------------
2dr3A           ----------VKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPV
1e9sG           --GGKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
1e9rA           --GGKLKRMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
2b8wA           MTGCLIENTNGRLMANPEA-LKSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIW
3a1wA           --------------------------------ALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGV
1e0jA           IREHLSSSVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESV
3da4A           ----------------------PAPSQYDYRSMNMKQMSGNVTTPIVALAHYLWGNGAERSVNIANIGLK
1e0jB           ---SSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESV
2d62A           IGAVKLINIWKRFGDVTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLRIAGLEEPTRGQIYIEDNLVADPE
2awnC           --------ASVQLQNVTVSKDINLDIHEGEFVVFVGPSGCGKS---------------TLLRMIAGLGVG
3cr7A           ----------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIR
2bdtA           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
2d4hA           ---CLIENTNGRLMANPELKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKTVQKGIWMWCVPHPKK
1cr4A           ---SSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESV
2bkhA           ---------PHVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEA
2c9oC           ------------------VELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYST
4dcgA           ----------------------------------------------------------------------
2ccjB           --------------------------------TFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPT
3d3kA           ------------------SVAEKHGLTLERRLEMTGVCASQMALTLLGGPQPTVALLCGPHVQGISCGRH
1dkiA           KSLLDSKGIHYNQGNPYNLTPVIEKVKPGEQSGQHAATGSVATATAQIMKYHNYPNKGLKDYTYTLSSNN
3d7wA           ----------------------TVPVSEGQRFVLVELTNAGGDTITAAIDVTNLYVVAYEAGNQSYFLSD
2a2zD           ----------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQ
1e9sD           -SGGKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
3dt4A           ----------------------TNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFD
2a5jA           --------------------------------IIIGDTGVGKSCLLLQFTDKRFQPIGVEFGARMVNIDG
1e2dA           ----------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERST
3cr7D           ----------------------------------------------------------------------
3cr7C           ---------------------------RGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIR
2axpA           ----------------------------------------------------------------------
2a2zA           ----------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQ
2d4uA           ----------------------------------LGSGGLFFNALKNCKENFTVLQTIRQQQSTLNGSWV
1cr2A           ---SSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESV
421pA           --------------------------------VVVGARGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQV
1e9fA           ----------------------------GALIVLEGVDGAGKSTQSRKLVEALCAAGHRAELLRFPERST
1e9cA           ----------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERST
2cckB           --------------------------------TFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPT
1dg3A           MTGCLIENTNGRLMANPEA-LKSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKHTKGIWMWCVPHPKKPG
1e6cA           --------------------------------FMVGARGCGMTTVGREIFMQHTSGMTVADVVAAEGWPG
3bh0A           ---------TGVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEMGKK
2dftA           --------------------------------VLVGLPGSGKSTIGRRLAKALGDVAIEQRTGRSIADIF
2cgtH           ------------------REIELEDKFENMGAQMVKEVASKATTTATVLAQAIKAVAAGMNPMDLKRGID
1e9rE           --GGKLKRMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLRELAYTGL--LRGDRMVIVDPNGD
2b8tA           ----------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDTR
2cjwB           --------------------------------VLIGEQGVGKSTLANIFAGVEDTYERTLMVDGESATII
2b8tB           ----------------------------GWIEFITGPMFAGKTAELIRRLHRLE--YADVKYLVFKPKIL
1d6jB           ----------------------ELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIR
3adkA           ----------------------EEKLKKSKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSS
2ahwD           -------------VPVLSAQEAVNYIPDEATLCVLGGILEATTLITALADKYKQTTGLGDRADRGISPLA
2cckA           ----------------------------------------------------------------------
1e98A           ----------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERS-
2ahvA           -------------VPVLSAQEAVNYIPDEATLCVLGGILEATTLI-TALADKYKQTQTPRNLSIGISPLA
3cmxA           -------------------SLDIALGAMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
3di4A           ----------------------CFEVKAGQFFRISSVEGPQVGDLNLHNLHDLTEFFSGKTRALHGTHVT
2a30D           ----------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQ
1cfrA           ---------------------------------------------------------------------I
2dr3E           ---------TRRVKTGIPGVDEHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPV
2b8tC           ----------------------------GWIEFITGPMFAGKTAELIRRLHRLEYLVFKPKIDSRTGTSL
2dr3B           --------------------------------------KTGIPGVDEILHGGIPLLSGGPGTGKTIFSQQ
1e2fA           ----------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERST
3cddF           -----------------------KTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTDVGEPF
3cddC           --------------------------------KAGGKIYQGWTKIGITRSLEASFIEPTVDIGGERVITG
2eg5G           ---LAKVKPVLEQCVRELLRANLPNINKCIKVADLGCASGPNTLLTVRDIVQSIDKVGQLERPTIQIFLN
2c9yA           ----------------------------GIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVAS
2awoC           --------ASVQLQNVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
3clvA           -----------------------MEKKSSYKTVLLGESSVGKSSIVLRLTKDTFHENTNTTIFCTYVVNL
1dhjA           ----------------------------------------------------------------------
3ch4B           ----------------------PLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQ
1eilA           ----------------------------------------------------------------------
2a2zB           ----------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQ
3bb1B           ---SGINTFAPATQTKLLELLGKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSGPRPVMVS
2a30B           ----------------------------IKKISIEGNIAAGKSTFVNILKWEVVPEPVARWCNVQSTNVL
2b92B           ---CLIENTNGRLANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIW
2dftC           --------------------------------VLVGLPGSGKSTIGRRLAKALGTDVAIEQRTGRSIADI
2d3wA           ---LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLL
2ausC           ----------------------------------------------------------------------
2cvfA           ---------------TGTKSLDGGGFAPGVLTQVYGPYASGKTTLALQTGLLSGK--KVAYVDTEGGFSP
1av6A           ----------------------------------------------------------------------
2a30A           ----------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQ
3cnlA           ------------------VLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAKGIQWFSLENGVKILD
2bbsB           ---------MENVTAFWVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCS
3bczC           ----------------------ASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGS
3cddD           ---------VLKAGGKIYQGWTKIGITRSDLETYKFNDAQYKAFIEPIKQGQACTVDIGGERVITGYVDD
2ancF           ----------------------------GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQVLATGV
2aunB           ----------------------------------------------------------------------
3bb1E           ---SGINTFAPATQTKLLELLGKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMV
2d3wD           ---LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLL
3cueF           -------------------------YDYLFKLLLIGNSGVGKSCLLLRFSDDYISTIGVDFKIKTVELDG
3cr7B           ----------------------------GLTIWLTGLSASGKSTLAVELEHQLVAYRLDGDNIRFGLNKG
1bglA           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
3dlbB           -----------RLLQERLRRLEGVWVEGLAVYRREHARGPGWRVLGG---------AVLDLWVSDSGAFL
1e4yA           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
1e9sJ           -SGGKLKRMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
1e3aB           ----------------------TINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGKWDWKGLLPF
3dfnA           ----------------------------------------------------------------------
3bpbA           ----------------------DYAKALEQHNAYIRALQTCDVDITLLPPDER--FPDSVFVEDPVLCTS
2c4rL           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
1e9sB           --GGKLKRMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
1cr0A           ---SSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESV
3dfqA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
1e9dA           ----------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERS-
1e9sI           ---------TREKAKQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGD--
1cjaA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
2d7vA           AFVAALSSCHLVFLSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSK---PTLQQL
1d6jA           ----------------------ELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIR
1cr1A           ---SSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWG-TAMGKKVGLAMLEES
3dyoA           ----------------------------------------------------------------------
1dekB           --------------------------------FLSGVKRSGKDTTADFIMSNYSAVKYQ-----------
2bhvD           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
2d7vB           AFVAALSSCHLVFLSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGT-----------
3dfoD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
3cmwC           -----------TIS-TGSLSLDIALGAMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
2ck3C           PGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIY
3c8uA           --------GTLAALCQGVLERLDPRQPGRQLVALSGAPGSGKSTLSNPLAAALS--AQGLPAEVVPDGFH
3cbnA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2d4hB           MTGCLIENTNGRLMANPEALLSAITQP-MVVVAIVGLYRTGKSYLMNKLAGKPHPKKPGHILVLLDTEGL
3dftD           ----------------------------------------------------------------------
1dvrA           --------------------------SESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAK
1d8jA           ----------------------------------------------------------------------
3a00A           --------------------------------VISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRA
1e2kA           -------------------------MPTLLRVYIDGPHGMGKTTTTQLLVADDIVYVPEPMTYWRVLGAS
3cmtD           --------------------LGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
1dp0A           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sH           ---------TREKAKQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLRELAY-------------------
3dfnC           ----------------------------------------------------------------------
3ed8A           --------------DGNILGHKLEYNFNSHNVYITATRGTQKNGIKANFTVRHNVEDGSVQLADHYQQNT
1ckvA           --------------ADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPTVNVEDRAGY
1e9rF           -SGGKLKRMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
2a1fF           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
3bwdD           ----------------------------FIKCVTVGDGAVGKTCLLISYTSNTFPFSANVVLGLWDTAGE
2dr3D           ---------RVKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPV
2bbtB           ---ELFEKAKQNNNNTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCS
2drcA           ----------------------------------------------------------------------
3cmvE           EDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
2dr3C           ---------TRRVKTGIPGVDEHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPV
2bhvA           ----------------------------------------------------------------------
3cnnA           --------------EPRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAGIQWFSLENGVKILDT
3dfnD           ----------------------------------------------------------------------
3cm0A           ----------------------------GQAVIFLGPPGAGKGTQASRLAQELGFKKLSTGDILRDHVA-
1bmfC           PGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIY
1akeA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1e2gA           ----------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERST
3bjdB           ----------------------------------------------------------------------
1e9sL           ----KLKRMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLRELAY-------------------
1cs4C           ---------------------------ATHRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKE
2dpyB           --------------DTGVRAINLLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIGERGREV
1ak2A           ----------------------------GVRAVLLGPPGAGKGTQAPKLAKNFHLATGDMLRAMVASGSE
1e59A           -----------------------VLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFD
1cjtC           ----------------------------------------------------------------------
1c9kC           --------------------------------LVTGGARSGKSRHAEAL------------IGDAPQVLY
3crmA           --------------------------SLPPAIFLMGPTAAGKTDLAMALADALPCELISVDSALIYRGMD
1afrA           ----------------------THSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFL--------
1e9rG           ---------TREKAKQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
1e2lB           -------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALG-------SRDDIVYVPE
3b55A           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
1e9sM           ---------TREKAKQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
2cdnA           --------------------------GSHMRVLLLGPPGAGKGTQAVKLAEKLGIRRNIEEGTKLGVEAK
2a1fD           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
1e3mA           --------------------------------------LVNLAERAYTLNYTCPTFIDKPGIRITEGRHP
2czvB           ----------------------------------------------------------------------
2dpyA           --------------DTGVRAINLLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIGERGREV
1e9sA           -----LKRMTREKAKQVTVAGVPMPRDAEPRHLLVNGTGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
2bjbA           --------------VGSELTVSGRIEPGPGARVDCGLAGT----VLRFVPPLAALGSVP--------VTF
2aexA           ----------------------------------------------------------------------
3d3qB           ----------------------------PFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVYQGDIG
1dekA           --------------------------------FLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDALAY
3dffA           ----------------------------------------------------------------------
3e8aC           ---------------------------ATHRLLLLGAGESGKSTIVKQMRILHV--NGEKATKVQDIKNN
1e2iB           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
3a00B           --------------------------------VISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRA
3cphA           --------------------------------LLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKT
3c15C           ----------------------------THRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLK
2bwjB           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
1e1qB           ---------REPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIY
2b0lC           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
1ek0A           --------------------------------VLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQR
2aunA           ----------------------------------------------------------------------
1cjuC           ---------------------------ATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLK
2bwjD           ----------------------------------------------------------------------
1e2jA           --------------------------------YIDGPHGMGKTTTTQLLRDDIVYVPEPRVLGASETIAN
3cmuA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SFEQLQKLVSDEWQRNNTDMLSPGEDDTGRTTAEIIQDEVHHPARCAMLAQQFGISALLDRRFKYLSTGE
3cmvG           PIYARKL---GVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGLAARMMSQAM
3cmvA           PIYARKLGVDIDNLLCSQPD-----------TGEQALEICDALARSGVVDSVAALTPKAEIGLAARMMSQ
3czpB           ERPPQWRFWRRLPPKGR-----------------------------------------------------
3cmvC           PIYARKLGVDIDQPDTGEQALEICDALARSGAVDVIVVDS--------VAALTPKAEIEGLAARMMSQAM
3b5jA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1d1cA           -------------------------------------------------------IHDRTSDYHKYLKVK
3b60A           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2akaA           -------------------------------------------------------IHDRTSDYHKYLKVK
3cmvH           PIYA-------RKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEISHMG
3c95A           ----------------------------------------------------------------------
1aroP           -------------------------------------------YGERLAREQLALEHSYEMGEARFRKMF
2c04A           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
3czpA           EQWRFWRRLPPKGRTGIFFGNWYSQLYARVEGHIKEAKLDQAIDAAERFERLCDEGALLFKFWFHLSKK-
1bifA           DMVKTYKSFEFFLPDNEEGLKIRKQ----------------CALAALNDVRKFLSEEGGHVAVFDATNTT
3b2qA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
3bgwD           -------------------------------------------VLGSILTEPELIKECPLTPEHFSPGKH
3eiuB           ----------------------------------------------------------------------
2ccgA           GEEIRKIVLEGNDMDIRTEAMLF--AASRREHLVLKVIPALKEGKVVLCDRY------IDSSLAYQGYAR
2dr3A           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
2bdtA           YRPPWESDELLLTWKNITDLTVNFLLAQNDVVLDYIAAQTVQAKVDDVEIRFIILWTNREELLRRDALRK
2axzC           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
4dcgA           DPILNGLSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASWRCPFPAQWIKDFYIPHGN
2awnB           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
3dtbB           SEEEYGRLL-AHMQEEGVIRKLKKYDTDPRDVARIESKTVIITQEQRDTVPIPKSGQSQLGRWMSEEDFE
2a2zD           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
3cr7D           FGLNKDLGFSIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVAEETGLPFVKGLYKKAREGVI
3cr7C           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
2axpA           DEDNVIIDRFVYSNLVYAKKFKDYSILTERQLRFIEDKIKAKAKVVYLHADPSVIKRLRVRGDEYIEGKD
2a2zA           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3dt4C           SEEEYGRLL-AHMQEEGVIRKLKKESKTVIITQEQRDKSGQSQLGRWMSEEDF--EKAFNARFPGCMKGR
2cgtH           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2cckA           GEEIRKIVLEDMDIRTEAMLFAA------------SRREHLVLKVIPAL--KEGKVVLCDRYIDSSLAYQ
3bgwA           -----------------------------------------------EYAEQAVLGSILTLTPEHFSPGK
1e98A           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
1av6A           DPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADL-LSNYALQNVMISILNPVASSL
3dt7A           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
1bglA           -------------------------------------QMWIGDKKQLLTPLRDQFTRAPLDNDIGVSEAT
3bk7A           ------------------------------------------------VVKELELENVLDRELHQLSGGE
2awnA           ----------------------------------------------------------------------
3cioD           YSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVLMRDRMRQLLEWANDHYDLVIVDTPP
3czjA           ----------------------------------FLSQMWIGDKKQLLTPLRDQFTRAPLDNDIGVSEAT
3dlbB           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
1e4yA           GSELGKQAKDIMDAGKLVTD---------------------ELVIALVKERIAQEDCRNGFLLDGFPRTI
2d0kA           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
3d3qA           TAKVTTEEEGIPHYIDILPPDASFSAYEFKKRAEKYIKDIRGKVPIIAGGTGLYIQSLLYNYAFEISEDK
2c0bL           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
3dyoA           ----------------------------------FLSQMWIGDKKQLLTPLRDQFTRAPLDNDIGVSEAT
1dekB           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
1e3mB           VVEQVLNEPFIANPLNLSPQRRLIITGPNGGKSTYRQTALIALAYIGSYVPAQKVEIGPIDRIFTRVGTF
2bwjA           SERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDC
1e2hB           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
3dfpC           -----------------------------------------------------------HSHPALTPEQK
1e9sH           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2bv7A           WLKR--------GLRFIQVFLQSICDGERDENHPNLIRVNATKA--------------YEMALKKYHGWI
3bwdD           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3dfnD           -----------------------------------------------------------HSHPALTPEQK
2d2eA           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
1akeA           GSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDV
1culC           AIETIVAAMSNPENQFRVDYILSVMNVPDFDFPPEFYEHAKLWEDEGVRACYERSNEYQLIDCAQYFLDK
1d2zD           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
1cjtC           AIETIVAA--------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
1e2iA           TQHRLDQGEISAGDAAVVMTSAQITMGMDAVLAPHIGGEAGPPPALTLIFDRHPIAALLCYPAARYLMGS
3dymA           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
2czvB           TVQKFSNDLRVIRYSIEKGVDAIISPWVNRKDPGIDHVLAKLMVKKNVALGFSLRPLLYSNPYERANLLR
3dm5B           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
1e2iB           ------EPMTYWRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGE
3c14C           EAIETIVAAMSNLV--------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
1e4vA           GSELGKQ-AKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFD
3a00B           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
1eamA           DPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLL---------------------
1adoA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
1e2kB           LGASTIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPY---------------AVTDAVLAPHIGGE
2a1fE           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
1e2nA           IYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVL-------APHIGGEAGSPPALTLIFDRHPI
2ancD           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1agpA           ----------------------------------------------------------------------
3c7kA           QSLAAIVRAMDTLGVEYGDK--------------------------------------------------
2b8tD           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
2bhvC           -------------------------------------------AHMGKAVLIPKGSKVIGYYSNNNKMGE
2bwjD           LREEL----ASESERSKLIRD-------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
3dofB           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
1cjvC           IETIVA----------------------------------------------------------------
3cmuA           PI--------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
2c1lA           ----------------------------------------------------------------------
2dwuB           YVQSFVFEMVEFLKQFPLKALVVACNTAAAATLAALQEALSIPARAAIKVTKKGKIGVIGQSNMYEKALH
3b5jA           DPNWLRRQVGDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQ
3dmdC           GAIEQLEEHAKRIGVKVIKH-----------------SYGADPAAVAYDAIQHAKARGIDVVLIDTAGRS
2dwoA           EAVKQYSSYNFFRPDNEEAMKVRKQCA----------------LAALRDVKSYLAKEGGQIAVFDATNTT
2c03B           AAREQLRLLGEKVGVPVLEV-----------------MDGESPESIRRRVEEKARLEARDLILVDTAGRL
3dm5A           GAYHQLRQLLDRYHIEVFGNPQ-----------------EKDAIKLAKEGVDYFKSKGVDIIIVDTAGRH
2d3wB           ALSPEDRAGEPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGE
3b60A           TLASLRNQVALVSQNVHLFNDTVANNIAYARTEEYSREQIEEAAMDFINKMDNGLDTIIGENGVLLSGGQ
2bifA           DMVKTYKSFEFFLPDNEEGLKIRKQCAL----------------AALNDVRKFLSEEGGHVAVFDATNTT
3c95A           QVREKVVAIFAESDNVDANGFFSDADRAAMKIVLETEPRNLPALDITFVIEKLLFNYRARNFPGTLDYAE
2c04A           AAREQLRLLGEKVGVPVLEV-----------------MDGESPESIRRRVEEKARLEARDLILVDTAGRL
2dwpA           EAVKQYSSYNFFRPDNEEAMKVRKQCA----------------LAALRDVKSYLAKEGGQIAVFDATNTT
1bifA           ----------------------------------------------------------------------
2c03A           AAREQLRLLGEKVGVP-----------------VLEVMDGESPESIRRRVEEKARLEARDLILVDTAGRL
3dmdB           GAIEQLEEHAKRIGVKVIKHSY-----------------GADPAAVAYDAIQHAKARGIDVVLIDTAGRS
2c61B           IFEKTGALERAVVFLNLADDPAVERIVTPRMALTAITNYAEALRQMGYPGYMYTDLATLYERAGIVKGAK
1e9sF           SKFGRDKDIILNPYDQRTKGWSFFN---------------------EIRNDYDWQRYALSVVPRGKTDEA
1bg0A           VGLDPAGQFIISTRVRCGRSLQGYPFNPCLTAEQYKEMEEKVSSTLSSMEDEL---KGTYYPLTGMSKAT
2czvA           LSNPKPSLVRDTVQKFYLIYVESNDLRVIRYSIEKGVDAIISPVLAKLMVKKNVALGFSLRPLLYSNPYE
1e69A           GSAYVELVFEENGEEIYYLNGSPVRLKDIRDRFAGTGLGVDFYGGEGRLEISIRKPGRRDQKLSLLSGGE
3b85A           GEKLGGDPYLRPLHDALRDVEPEVIPKLEAGIVEVAPLAYRGRTLNDAFVILDEAQNTTPAQKFLTRLGF
2bbsA           QNSWIMPGTIKENIIGVSYD---------------EYRYRSVIKACQLEEDISKFAEKDNIVLITLSGGQ
2bc9A           MWCVPHPKKPGHILVLLDTE--------------GLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTIN
3bo6B           FHISVQREQVPQAFLSGLLFSVDSPIDKWKVTDMERVDQQSRVAVGAQFTLYVKPDQENSQYSASSLHNT
2a5gA           KNVKFNVWDVGGLDKIRPLWRHYYTGTQGLIFVVDCADRDRIDRIINDREMRDAIILIFANKQDLPDAMK
2ccgB           GEEIRKIVLEGNDMDIRTEAMLFAAS--------RREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYAR
2akaB           LVNSTTEYAEFLHCRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIE
2ctsA           KMLPKAKGGEEPLPEGLFWLLVTGQIP------TEEQVSWLSKEWAKRAALPSHVVTMLDNFPTNLHPMS
3eiuB           EKTRIVTPRMALTAAEYLAYEHGMHVLVILTDITNYAEALRQMGAAGYPGYMYTDLATLYERAGIVKGAK
2ccgA           ----------------------------------------------------------------------
2dr3A           QVRQNMAQFGWDVKPYEEKG---------------------MFAMVDAFTAGIGKEYEKYIVHDLTDIRE
1e9sG           SKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALI
1e9rA           SKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGR--LLLRETAKKLA
2b8wA           MWCLDTEGLGDVEKGDNQNDSWILAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSVSFFPDFV
3a1wA           FTYKGYTIDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILAMTA
1e0jA           EETAEDLIGLHNRVRLRQSDSLKREIIEN-----GKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAY
3da4A           ISPMKINQIKDIIKSGVVGTFPVSTKFTHATGDYNVIRSYDDKYDFNASTHRGIIGESLTRLGAMFSGKE
1e0jB           EETAEDLIGLHNRVRLRQSDSLKREIIENG-----KFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAY
2d62A           KGVFVPPKERDVAVFQSYALYPHTVYDNIAFPLKLRKVPKQEIDKRVREVAELGLTELLNRKPRELSGGQ
2awnC           MVFQSYALYPHLSVAE---NMSFGLKLAGA-------KKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQ
3cr7A           FGLNKDLGDRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVTGLPFVKGLYKKAREGVI
2bdtA           ----------------------------------------------------------------------
2axzC           -----------------------------------------------FGIDYEIVSNLLNVLPYEEVSSI
2d4hA           PGHILVLLDTEGLGDVENQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSPDES
1cr4A           EETAEDLIGLHNRVRLRQSD--------------SLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAET
2bkhA           NPLLEAFGNATVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAGAS
2c9oC           EIKKTEVLMENFRRAIGLRIKETKKKEIITLHDLDVAGEINKVVNKYIDQGIAELVPGVLFVDEVHMLDI
4dcgA           ----------------------------------------------------------------------
2ccjB           GEEIRKIVLEGNDMDIRTEAMLFAA--------SRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYAR
3d3kA           LANHDVQVILFLPNFVKMLESITNELSLFS---KTQGQQVSSLKDLPTSPVDLVINCLDCPENVFLRDQP
1dkiA           PYFNHPKNLFAAISTRQYNWNNILPTY-----SGRESNVQKMAISELMADVGISVDMDYGPSSGSAGSSR
3d7wA           APAGAETQDFSGTTSSSQPFNGSYPDL--------------ERYAGHRDQIPLGIDQ-LIQSVTALRFPG
2a2zD           STNVLQMM--YEKPERWSFTFQTYACLSRIRAQLASLERSVYSDRYIFASNLYESECMNETEWTIYQDWH
1e9sD           SKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEE-------------------
3dt4A           AQGNLRAINPENGFFGVAPGTSVKTNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPGVTITSWKNKE
2a5jA           KQIKLQIWDTAGQESFRSITRSYYAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLES
1e2dA           EIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQ--GVTLVVDRYAFSGVAFTGAKENFSLD
3cr7D           ----------------------------------------------------------------------
3cr7C           FGLNKDLG----FSEADRNENIRRIAEVAKLFADSNSIAITSFDTARQLHEVTGLPFPKGLYKKAREGVI
2axpA           ----------------------------------------------------------------------
2a2zA           STNVLQMMYEKPERWSFTFQT---YACLSRIRAQLASLNGKEKPVLFFERSVYSDRYIFASNLYESECMN
2d4uA           ALLQTRNYMMDQNNIGSGSTVAELMESASISLKQAEKNWADYEALPRDPRQSTAAAAEIKRNYDIYHNAL
1cr2A           EETAEDLIGLHNRVRLRQSD-------------SLKREIIENGKFDQWFDELFGNDTFHLYDSFEAETDR
421pA           VIDGETCLLDILDTAGQEEYSAMRDQYM-RTGEGFLCVFAINNQYREQIKRVKDSDDVPMVLVGNKCDLA
1e9fA           EIGKLLSSYLQKKSDVEDHSVHLLFSANRW---EQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSL
1e9cA           EIGKLLSSYLQKKSDVEDHSVHLLFSANRW---EQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAKENFSL
2cckB           GEEIRKIVLEGDMDIRTEAMLFLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAIN
1dg3A           HILVLLDTEGLGDVEKGDNQNDSFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSSADFVSFF
1e6cA           FRRRESEALQAVATPNR-VVATGGGMVLLEQNRQFMRAHGTVVYLFAPAEELALRLQASLQAHQRPTLTG
3bh0A           ENIKRLIVTAGSINAQKIKAARRDFASEDW-----GKLSMAIGEISNSNINIFDKAGQSVNYIWSKTRQT
2dftA           ATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAAAGHTVVYLEISAAEGVRRTGGNDRAEKY
2cgtH           KAVTAAVEELKPCSDSKAIAQVGTISANSDETVGKLIEGVITVEDGTGLQDELDVVEGMQFDRGYLSPYF
1e9rE           MLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWAS--------------
2b8tA           SIRNIQSRTGILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFGPI
2cjwB           LLDMWENHDHMQVGDAYLIVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRREVSVSEGR
2b8tB           PSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFGPI
1d6jB           FGLNKDLGFSEADRNENIRRIAEFADSNSIAITSFISPYRKDRDTARQLHEVATPGEETGLPFVEVYVDV
3adkA           GSARGKMLEIMEKGQLVPLETVLDMLRDAMVAKVDTSKGFLIDGYPREVKQGEEFERKIGQPTLLLYVDA
2ahwD           QEGLVKWALCGHWGQSPRISDLAEQNKIIAPQGVLTQTLRAAAAHQPGIISDIGIGTFVDPRQQGGKLNE
2cckA           ----------------------------------------------------------------------
1e98A           --TEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSL
2ahvA           QEGLVKWALCGHWGQSPRISDLAEQIAYNYPQGVLTQTLRAAAAHQPGIISDIGIGTFVDPRQQGGKLNE
3cmxA           PIYADIDNLLCSQPDTGEQALEICDALARSGAVDVIARMMSQ--AMRKLAGNLKQSNTLLIFINQIRNPE
3di4A           TGERLWSNLPYLRPATIIEDTLGWYGIDQYGGSVHDVIGTRCDPYTGNLLAGGHYHHCCHSNLTRALADH
2a30D           STNVLQMMYEPERWSFTFQTYACLSRIRAQLASLNGKPVLFFERSVIFASNLYESECMNETEWTIYQDWH
1cfrA           GIRAIEFFLESETNFIVVKMPNATSFDVMSIYKSCLSEFIYD------LRSKLSL-----NNVNLITSNP
2dr3E           QVRQNMAQFGWDVKPYEEKG--------MFAMVDAFTAGIGKEYEKYIVHDLT-------------DIRE
2b8tC           PSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFGPI
2dr3B           FLWNGLK--MGEPGIYVALEEHPVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGEKYIVHDLTDIRE
1e2fA           EIGKLLS---SYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSL
3cddF           QRIQHELLARLAKQRGVLLTSDTFGNLVITRASKTKAGVSLILGDNVKAARGRFSWRQRFSKFTIKAAGI
3cddC           YVDDWVPSYDESTITISVSGRDKTADLVSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTDQRIQIEQG
2eg5G           DLFPNDFNSVGRKIGSCLIGAMPGSFYSRLFPEESMHFLHSCYCLQWLSQVPSGLVTEIGTNKGSIYSSK
2c9yA           GSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAELMEKRKEKLDSVIEFSI
2awoC           PPAERG------VGMVALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQ
3clvA           NCNIKFDIWDTAGQERYASIVPLYYRGATCAIVVFDISNSNTLDRAKTWVNQLKISSNYIIILVANKIDK
1dhjA           -------------------------------------------NAMPWNLPASLAWFKRNTLDKPVIMGR
3ch4B           YAQEHGLNFQYKEAFRKDPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQ
1eilA           -------------------------------------------YLGFAVKDVPAWDHFLTKSVGLMAAGS
2a2zB           STNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWH
3bb1B           RSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTLYVDRLDAYRVDNLDKLVAKAITDSFGKGIWN
2a30B           MYEKPERWSFTFQTYACLSRIRAQLASLNDAEKPVLFFERSVYSDRYIASNLYESECMNETEWTIYQDWH
2b92B           MWCVPHPKLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSFVSFF
2dftC           FATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGDRAEK
2d3wA           ALSPEDRAGEGIFMAFQYLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGE
2ausC           ----------------------------REVIVKDDKWGFPPDKRPIELHIQYGV-INLDKPPGPTSHEV
2cvfA           ERLVQMAETRGLNPEEALSRFILFTPSDFKEQRRVIGSLKKTVDSNFALVVVDSITAHYRAEENRSGLIA
1av6A           ----------------------------------------------------------------------
2a30A           STNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYYQDWH
3cnlA           TPGILYK-NIFSEDLAAKLLLVGSLPVERIEDQRIFERAFEIFARSIGIESSFSFEDFARKRGLLKKGGV
2bbsB           QNSWIMPGTIKENIIGVSYDEYRYRSV-------------IKACQLEEDISKFAEKDNIVLGGITLSGGQ
3bczC           CAAHAYKQVDPSITRRIFILGPSHHVCALSSVDIYRTPLYDLRIDQKIYGELWKTGFERSLQTDEDEHSI
3cddD           WVPSYD--ESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTDVGEIEQGE
2ancF           DVFLDIDWQGAQQIRLPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTD
2aunB           -------------IDGRVALIAPA----SAIATEVLEATL---RQLEVHGVDYHLGRHVEARYRYLAGTV
3bb1E           SRSRAGFTLNIIDTPGLIEGGYINDIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGIWN
2d3wD           ALSPEDRAPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLPEDLLTRSVNVGFSGGE
3cueF           KTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNMWLQEIDRYATSTVLKLLVGNKCDLKD
3cr7B           FSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVETGLPFVEVYVDVPVEVAQRDP
1bglA           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
3dlbB           LEVDPAYRILCEMSLEAWLAQGHPLPKRVRNAYDRRTWELLRLGEEDPKELPLPGGLSLLDYHASKGRLQ
1e4yA           ----------------------------------------------------------------------
2d0kA           -------------------------------------------NALPWNLPADLAWFKRNTLNKPVIYGR
1e9sJ           SKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYAL-SVVPRGK--------------------TDEA
1e3aB           EMNPKVYNPQSGYIANWNNSPQKDRLLEQKPRLTADQAWDVIRQTSRQDLNLRLFLPTLQAATSGLTQSD
3dfnA           ------------------------------------------------------------SHPALTPEQK
3bpbA           RCAIITRPGAESRRGETEIIEETVQRFYPGKVERAPGTVEAGDIMMVGDHFYIGESARTNAEGARQMIAI
2c4rL           ---FLIHQESNVIVRAFRDYLRQDIGEILIDNPKVLELARQHIAALGRP----DFSSKIKLYTGEIPLFS
3d3qA           ----------------------------------------------------------------------
1e9sB           SKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALI
1cr0A           EETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYM----
3dfqA           ------------------------------------------------------------SHPALTPEQK
2c7cH           ----------------------------------------ITVEDGTGLQDELDVVEGMQFDRGYLSPYF
1aldA           -----------------------------------------------------------YQYPALTPEQK
3dfqD           ------------------------------------------------------------SHPALTPEQK
1e9dA           --TEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAKENFSL
1e9sI           ---------MLSKFGRDKDIILNP----------YDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEA
1cjaA           -------------------------------------------RTLIAHPGHESSQFHSIRDIITLYTGY
6aldA           ------------------------------------------------------------SHPALTPEQK
2d7vA           EKHHLAHENCFIAN--------------------------------------------------------
1d6jA           FGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHE---------VATPGE
1cr1A           VEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTF-----------HLYDSFAEAETDR
3dyoA           ----------------------------------------------------------------------
1dekB           --------LAGPIKDALAYAWGVFAANTDYPLTRKEFEGIDYDRETNLNLTKLEVITIMEQAFCYLNGKS
2bhvD           --------------------------------------------HMGKAVLIPKGSKVIGYYSNNNKMGY
1dhiA           ------------------------------------------ENAMPWNLPASLAWFKRNTLDKPVIMGR
1e3mB           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
3dfoD           ------------------------------------------------------------SHPALTPEQK
3dfpD           ------------------------------------------------------------SHPALTPEQK
3cmwC           --PIYARKLGVDIDNLL---CSQ--PDTGEQALEICDALARSGAVDVIVVD--SVAALTPKAEIEGEIGD
2ck3C           VAIGQ------------------------KRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYS
3c8uA           LDNRLLEPRGLLPRKGAPETFDFEGFQRLCHALKH---------------QERVIYPLFDRARDIAIAGA
3cbnA           ----------------------------------------------------NGYDEIRGYGHPELTLDH
3dftC           ------------------------------------------------------------SHPALTPEQK
2d4hB           GQNDSWIFALAVLLSSTFVYNSIGTINQVTELTHRIRSKSSDSADFVSFFPDFVWTLRDFSLDLEADQPL
3dftD           ------------------------------------------------------------SHPALTPEQK
1dvrA           GTQLGLEAKKIMDQGLVSDDIMVNMIKDEPACKNGFILVGFPRTIPQAEKLDQMLKEQGTPLEKAIELKV
1d8jA           ------------------------------------------------GDTHPLTLDEILDETQHLDIGL
3a00A           GEVNGKDYNFVSVDEFKSMI---------KNNEFIEWAQFSGNYYGST---VASVKQVSKSGKTCILDID
1e2kA           ETIANIYTTQHRLDQGEISA-----------------GDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEA
3cmtD           PIYADIDNLLCSQPDTGEQALEICDALARSGAVDVITPKAEMGLAARMMSQAMRKLAGNLKQSNTLLIFI
1dp0A           ------------------------------------SQMWIGDKKQLLTPLRDQFTRAPLDNDIGVSEAT
1draA           ------------------------------------------ENAMPWNLPAELAWFKRNTLDKPVIMGR
2boeX           -------------------------------------------DRIASVPQGTWFA---HHNPGQITGQV
2bx2L           -----------------------------------------------------------KLYTGEIPLFS
2aumB           --------------DGRVALIAPASAIATEVLEATLR-------QLEVHGVDYHLGRHVEARYRYLAGTV
2bofX           --------------------------------------------AAGKIPILVVSNAPGRDCGAPSHSAY
3dfpC           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
3dfnC           -----------------------------------------------------------HSHPALTPEQK
3ed8A           PIGDGPVLLPDN----------------------------------------------------------
1ckvA           WWIKANGKVDCDEISELLGRQFNVYDFLVDVSSTIGGNKFTITSELMGL---------------------
1e9rF           SKFGRDKDIILNPYDQRTKGWSFFNEIRNDY--DWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLA
2a1fF           ------------------------------------------------------------------SQPI
2bv7A           ----------------------------------------------------------------------
3bwdD           DYNR-LRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFIDHAV
2dr3D           QVRQNMAQFGWDVKPYEEKG-------------------MFAMVDAFTAGIGKSKEYEKYIVHDLTDIRE
2bbtB           QNSWIMPGTIKENIIGVSYD--------------EYRYRSVIKACQLEEDISKFAEKDNIVLGITLSGGQ
2drcA           ------------------------------------------ENAMPFNLPADLAWFKRNTLDKPVIMGR
3cmvE           PIYARKL--GVDIDNLLCSQPDTGEQAL-EICDALARSGAVDVIVVDSVAALTPKAEIEGLAARMMSQAM
2dr3C           QV----------RQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGEYEKY------------IVHDLTDIRE
2bhvA           ---------------------------------------------------------VIGYYSNNNKMGE
3cnnA           PGILYKNIFSEDLAAKLLLVGSLPVERIEDQRIFERAFEIFARSIGIESSFSEFFEDFARKRGLLKKGGV
3dfnD           ----------------------------------------------------------------------
3cm0A           --------RGTPLGERVRPIMERGDLVPDDLILELIREELIFDGFPRTLAQAEALDRLLSERLLGVVLVE
1bmfC           VAIGQKRSTVAQL------------------------VKRLTDADAMKYTIVVSATASDAAPLQYLAPYS
1akeA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1e2gA           EIGKLLS---SYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSL
3bjdB           -------------------------------------------AQTRRWLARAIYRVEERFPAADLSRAL
1e9sL           ----------------------------------------------------------------------
1cs4C           AIETIVAAMSNLVPPVELANPENQF---------------------------------------------
2dpyB           KDFIENILGPDGRARSVVIAAPA------DVSPLLRMQGAAYATRIAEDFRDRGQHVLL------IMDSL
1ak2A           LGKKLKATMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFS
1e59A           FAYTSVLNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDE
1cjtC           ----------------------------------------------------------------------
1c9kC           IATSQILHHKDGRPAHWRTARHLDTLITADLAPDDAIL-LECITTMVTNLLFALGDPEQWDYAAMERAID
3crmA           IGTAKPSRELLARYPRLIDIRDPAESYSAEFRADAL--AAMAKATARGRIPLLVG---GTMLYYKALLEG
1afrA           ----------------------------------------------------------------------
1e9rG           SKFGRDKDIILNPYDQRTKGWSF--FNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGR-----------
1e2lB           PMTYWRVLGASETIANIFTTQHRLDQG-------EISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGE
3b55A           --------------------------------------------YNTNQIAKWLEAHAKPLKTTNPTASL
2e85B           -----------------------------------------------------------KGNWVVIDGGS
1e9sM           SKFGRDKDIILNPYDQRTKG--------------------------------------------------
2cdnA           RYLDAGDLVPSDLTNELVD---------DRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAFR
2a1fD           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
1e3mA           VVEQVLNEPFIANPLNLSPQRRLIITGPNGGKSTYRQTALIALAYIGSY-VPAQKVEIGPIDRIFTRVGF
2czvB           ----------------------------------------------------------------------
2dpyA           KDFIENILGPDGRARSVVIAAPADV------SPLLRMQGAAYATRIAEDFRDRGQHVLL------IMDSL
1e9sA           SKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDE----------------------
2bjbA           DGDQARGRPIAPLLDALRELGVAVDGTGLPFRVRGNGSLAGGTVAIDASASSQFVSGLLLSAASFTD-GL
2aexA           ----------------------------------------------------------------------
3d3qB           TAKVTTEEEGIPHYIDILPPDASFSAYEFKKRAEKYIKDITGKVPIIAGGTGLYIQSLLYNEDKKQVKLK
1dekA           AWGVFAANTDYPLTRKEFEGIDYDRETNLN--LTKLEVITIMEQAFCYLNGKS------PIKGVFVFDDE
3dffA           -----------------------------------------------ALDHLRVAHRHGRFLDSIYRKLP
3e8aC           LKEAIETIVAAMSNLVP-----------------------------------------------------
1e2iB           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
3a00B           GEVNGKDYNFVSVDEFKSMI------------KNNEFIEWAQFSGNYYGSTVASVKQVSKSGKTCILDID
3cphA           VDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIIERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDME
3c15C           EAIETIVAAMSNLVPPVELA--------------------------------------------------
2bwjB           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
2aumA           -------------------------------------------RQLEVHGVDYHLGRHVEARYRYLAGTV
1eamA           ----------------------------------------------------------------------
1adoA           ------------------------------------------------------------SHPALTPEQK
1e1qB           VAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYAYRQMSLLLRRPPGREA
2b0lC           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------AYKQFIPNVAEKTLGASGRYEGKI
1ek0A           VTINEHTVKFEIWDTAGQERFASLAPYYRNAQAALVVYDVTKPQSFIHEQASKDIIIALVGNKIDLQEGG
2aunA           ----------------------------ASAIATEVLEATL--RQLEVHGVDYHLGRHVEARYRYLAGTV
1cjuC           EAIETI----------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
1e2jA           IYTTQHRLDQVVMTSANITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAALLCYPAARYLMGS
3cmuA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TRKALLCQALMSEPELLILDEPFDGLDVTARQQLAQRLTALNQAGMTLALVLNRFDEIPDFVQFAGVLAD
3cmvG           RKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGEVVGSETRVKVVKNKIAAPFKQAEFQI
3cmvA           AMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKQILYGEGIN
3czpB           ----------------------------------------------------------------------
3cmvC           RKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYG
3b5jA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1d1cA           QGDSDLFKLTVSDKRYIWYNPDPKERDSYECGEIVSETSDSFTFKTVDGQDRQRNPIKFDGVEDMSELSY
3b60A           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2akaA           QGDSDLFKLTVSDKRYIWYNPDPKERDSYECGEIVSETSDSFTFKTVDGQDRQVKKDDANQRNPIKFDGV
3cmvH           LAARMMSQAMRKLAGNLKQSNTFINQGGNALKFYASVRLDIRR---------------------------
3c95A           ----------------------------------------------------------------------
1aroP           ERQLLITTLLPKMIARINDWFEEVKAKRGKRPTAFQFLQEIKPEAVAYITIKTTLACLTSADNTTVQAVA
2c04A           ----------------------------------------------------------------------
3eiuA           --------------------------------GPLIFVEKTEPVGYNEIVNIKMGDGTVRRGQVLDSSAD
2dwpA           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
1bifA           RERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATEDFMRRIECYENS---
3b2qA           -------------------------------------------YNEIVNIKMGDGTVRRGQVLDSSIVVV
2c03A           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
3bgwD           FNIYFTMQDLDRKGQSVDFTSIAARVGEKLPQLGGFGYLTELAASVASTTTFKQHCQTVSEYFQKRKAIS
3eiuB           ----------------------------------------------------------------------
2ccgA           GIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQEDLKFHEKVIEGYQEIIHNES
2dr3A           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
2c61A           ----------------------------------LIFVEKTEPVGYNEIVNIKMGDGTVRRGQVLDSSA-
3da4A           --------------ETLTVHAPSPSTNLPSYGNGAFSLSAPHVPGAGPLLV-------QVVYSFFQSPNM
1e0jB           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3b2qB           --------------------------GPLIFVEKTEPVGYNEIVNIKMGDGTVRGQVLDSSADIVVVQVF
2bkiA           ----------------WAPHPTDGFQVGNIVDIGPDSLTIEPLNQALINQVFPAEEDSKKDVEDNCSLMY
3cr7A           ----------------------------------------------------------------------
2bdtA           KGERCLELVEE--FESKGIDERYFYNTSHLQPTNLNDIVKNLKTNPR-----------------------
2axzC           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
4dcgA           KMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNY--------------------------------
2awnB           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
3dtbB           KAFNARFPGCMKGRTMYVIPFSMGPLGSPLAKIGIELTDSPYVVASMRIMTRMGTSVLEALGDGEFIKCL
2a2zD           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
3cr7D           KEF-TGISAPYEAPANPEVHVKNYELPV--QDAVKQIIDYLDTKGYLPA---------------------
3cr7C           ----------------------------------------------------------------------
2c9gA           -----------TGGRNSIRYSELAPLFDTTRDNKSTDVASLNYQNDHSNFLTTVI-QNNDYSPGEASTQT
2axpA           IDSILELYREVSNAGLHTYSWDTGQWSSDEIAKDIIFLVEL-----------------------------
2a2zA           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
3dt4C           TMYVIFSMGPLGSPLAKIGIELTDSPYVVASMRIMTRMGTSVLEALGDGEFIKCLHSVGCPLPLKKPLVN
2cgtH           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2cckA           GYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAERIIKNSRLDQEDLKFHEKVIEGYQEIIRFKSVNAD
3bgwA           HFNIYTMQDLDRKGQSVDFTSIAARVGEKLPQLGFGYLTELAASVASTTTFKQHCQTVSEYFQKRKAISI
1e98A           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
1av6A           KWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVN-------------
3dt7A           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
1bglA           RIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAQHQGKTLFISRKTYRIDGSGQMAITVDV
3bk7A           LQRVAIAAALLRKAHFYFFDEPSSYLDIRQRLKVARVIRRLANEGKAVLVVEHDLAVLDYLSDVIHVVYG
2awnA           ----------------------------------------------------------------------
3cioD           MLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNI--KGAILNGVI--------------
3czjA           RIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAQHQGKTLFISRKTYRIDGSGQMAITVDV
3dlbB           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
1e4yA           PQADAMKEAGINVDYVLEFDVPDELIVDRIVGRVHAPSGRVYHVKFNPPKVEGKDDVTGEEL--------
2d0kA           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
3d3qA           KYLASFDKESAKDIHPNNRKRVLRAIEYYTKKLLSSRQQFTENYDTLLIGIESRETLYLRINKRVDILGH
2c0bL           ------------KRMLINATQQEELRVALVDGQRLYDLDIESPEQKKANIYKGKITRIEAAFVDYGAERH
1e9sB           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
3dyoA           RIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAQHQGKTLFISRKTYRIDGSGQMAITVDV
1dekB           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
1e3mB           VETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWACNLANKIKALTLFATHYFELTQLPEKEGVANVH
2bwjA           SADTMTNRLLQMSRSSLPVDDTTKTIAKRLEAYYRASIPVIAYYETKTQLHKINAEGTPEDV--------
1e2hB           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
3dfpC           KELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHET
1e9sH           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2bv7A           VQKIFQAALYA-APYKSDFLKALSKGQNVTEEECLEKVRLFLVNYTATIDVIYEMYTR------------
3bwdD           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3dfnD           KELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHET
2d2eA           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
1akeA           PDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELT---------------------------
1culC           ID--------------------------------------------------------------------
1d2zD           -----------------------------------------------------------SKYSRNTELRR
1e2gA           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
1e2iA           MTPQAVLAFVALIPPTLPGTNIVL----------------------------------------------
3dymA           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
2czvB           FMMKAWKLVEKYKVRRFLTSSAQEKWDVRYPRDL---ISLGVVIGMEIPQAKASISMYPEII--------
3dm5B           --------------------------------NLGKALANT-LKKIARASSVDEA-------LIKELVRD
2dpyA           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
2aexA           ------------EDELAHRCSSFMAPPVTDLGELRRRPGDMKTKMELLILETQA----------------
3d3qB           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
1e2iB           AHAPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVA---------------------------
3c14C           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
1e4vA           VPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEY---------
3a00B           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
2b0lC           -------HHHMSKAVVQMAISSLSYSELEAIEHIFEELDGNEGLLVASKI--------------------
1e9rB           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
1e2kB           AHAPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAF-----------------------------
2a1fE           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
1e2nA           AALLCYPAARYLMGSMTPQAVL------------------------------------------------
2ancD           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1agpA           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
2bhvC           YRLDIWSRIITPHGINIMLTNAYNGLVGELIERNFQRYVPLLLSTLTNGLLI------------------
2bwjD           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
3dofB           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
2c1lA           ----------------------------------------------------------------------
2dwuB           ELDTYLKVHSHACPTLATVVENRLEDTAYVTQQVKQALLPLTKEDID-TLIL------------------
3b5jA           RQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK-GRTVIIIAHRLSTV------------
3dmdC           ETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNAVKIDGIILTKLDADARGGAALSISYVI
2dwoA           RERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFM------------
2c03B           QIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEVGVTGLVLTKLDGDARGGAALSARHVT
3dm5A           KEDKALIEEMKQISNVIHPHEVILVIDGTIGQQAYNQALAFKEAPIGSIIVTKLDGSA------------
2d3wB           KKRNDILQMAVLEPELCILDESDSLDIDALKVVADGVNSLRDGKRSFIIVTHYR-ILDYIKPDYVHVLYQ
3b60A           RQRIAIARALLRDSPILILDEATSALDTESERAI-QAALDELQKNRTSLVIAHRLSTI------------
2bifA           RERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATEDFMRRIECYENS---
3c95A           QQRWLEHRRQVFTP--EFLQGYADELQMLVQQYADDKLKALWQYADEI----------------------
2c04A           QIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGV-----------------------
2dwpA           RERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSA-------------------
1bifA           ----------------------------------------------------------------------
2c03A           QIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVL------------------
3dmdB           ETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEVKIDGIILTKLDADARGGAALSISYVI
2c61B           GSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVAREL--------------------------------
1e9sF           EEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIA----------------------------------
1bg0A           QQQLIDDHFLFKEGDRFLQTANACRYWPTGRGIFHNDAK-------TFLVWVNEEDHLRIISMQKG----
2czvA           RANLLWKLVEKYKVRRFLTSSAQEKWDVRYPRDL---ISLGVVIGMEIPQAKASISMYPE----------
1e69A           KALVGLALLFAKPSPFYVLDEVDSPLDDYNAERFKRLLKENSK-HTQFIVITHNKIVM------------
3b85A           GSKVVTGDGLRLVRHIL-RGVDDVHFSELTSSDVVR----------------------------------
2bbsA           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLM---------------------------
2bc9A           QQAMDQLYYVTELTHRIRSKSDFVSFFPDFVWTLRDFS--------------------------------
3bo6B           RQFIECLESRLSESGLMPGQYPESDVHPENWKYVSYRNELRSGRDGGEMQS-----QALREEPFYRLMAE
2a5gA           PHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWL--------------------------------
2ccgB           GIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSLDEDLKFHEK-------------------
2akaB           FQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAK-EVDPQGQRTIGVITKLDLMDEGTDARDVLEN
2ctsA           QLSAAITALNSESNFARAYAEGI-----------------------------------------------
3eiuB           GSVTQIPILSMPGDDITHPIPDLSGYITEGQIVV------------------------------------
2ccgA           ----------------------------------------------------------------------
2dr3A           FIEVLRQAIRDINAKRVVVDSVTTLYINKPAMAILQLKRVLAGTGCTSIFVSQVSGFGPGVEHGV-----
1e9sG           GTPSMRELWTTIATFDDLRGFLEGTLAESLFAGSNEAS--------------------------------
1e9rA           LIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEAS----------------------------
2b8wA           WTLRDFSLDLEADGQPLTPDEYLTYSL-------------------------------------------
3a1wA           IDEAKKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEY-----------------------------
1e0jA           MRSGLGCDVIILDHISIVVSASGESDERKMIDNL------------------------------------
3da4A           YQILLPGEIHIKES--------------------------------------------------------
1e0jB           MRSGLGCDVIILDHISIVVSASGESDERKMIDN-------------------------------------
2d62A           RQRVALGRAIIRRP-KVFLDEPLSNLDAKLRVKRAELKKLQRQLGVTTIYVTHDQVEATGDR--------
2awnC           RQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDA
3cr7A           KEFTGISAPYEAANPEVHVKNYELPVQDAVKQIIDY----LDTKGYLPA---------------------
2bdtA           ----------------------------------------------------------------------
2axzC           IKPYPIVDSFGKDYDLTIQTVLKNALTISINRNLKEAQYYINQFEHL-----------------------
2d4hA           ADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKD----------------------
1cr4A           LLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGFA--KSTGVVLVVICHLKDLRGGAL--------
2bkhA           EIRERLHLSSPDNFRYLNRGCTRYFANKETDKQILQ----------------------------------
2c9oC           ECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMI-------------------
4dcgA           ----------------------------------------------------------------------
2ccjB           GIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNNRLDQEDLKFHEKVIEGY------------
3d3kA           WYKAAVAWANQNRAPVLSIDPPV-HIDAKWSLALGLPLPLGEHAGRIYLCDIGIPQQVFQEVGINYHSPF
1dkiA           VQRALKENFGYNQSVHQINRGDF------SKQDWEAQIDKELSQNQPVYYQGKVGGHA------------
3d7wA           GQT--KTQARSILILIQMISEAARFNPILWRRQYINSGASFLPDVYMLELE-TSWGQQSTQV--------
2a2zD           DWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGLEYLEKLHYKESWLLHRTLKTNFD------------
1e9sD           --WASYGRLLLRETAKKLALIGTPSMRELFHWTTFDDLRGFLEGTLAESLFAGSNEAS------------
3dt4A           WRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIGGRRPAGVPLVYEALSWQHG------------
2a5jA           RRDVKREEGEAFAREHGLIFMETSAKTACNVEEAFINTAKEIRKIQQGLF--------------------
1e2dA           WCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQE---------------------------
3cr7D           ----------------------------------------------------------------------
3cr7C           KEFTGISAP-YEAPANPEVHVKNYELPVQDAVKQIIDY--LDTKG-------------------------
2axpA           ----------------------------------------------------------------------
2a2zA           ETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQG-------------------
2d4uA           AELIQLLGAGKINE---FFDQPTQGYQDGFEVAYMEQNDRLHDIAVS-----------------------
1cr2A           LLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGF--AKSTGVVLVVICHLKSGALRQL--------
421pA           ARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIR---------------------------
1e9fA           DWCKQPDVGLPKPDLVLFLQLQLADAAKRYENGAFQER--------------------------------
1e9cA           DWCKQPDVGLPKPDLVLFLQLQLADAA-------------------------------------------
2cckB           GLYPDLTIYLNVSAEVGRERIIKNRLDQEDLKFHEKVIEGYQIIRFKSVNADQPLENV------------
1dg3A           PDFVWTLRDFSLDLQPLTPDEYLTYSLKLKKGTSQKDE--------------------------------
1e6cA           RPIAEEMEAVLREREALYQDVAHYVVDATQPAAIVCEL--------------------------------
3bh0A           KRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISRD--------------------------------
2dftA           RALMAKRAPLYRRVATMRVDTNRRNPGAVV-RHILSRL--------------------------------
2cgtH           INKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLIIAEDVEG-------------------
1e9rE           -----YGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAES------------------
2b8tA           AKLFTYADKITKLTAICNECGAEATHSLRKIDGKHADY--------------------------------
2cjwB           AAVVFDCKFIETSAAVQHNVKEL-----------------------------------------------
2b8tB           AKLFTYADKITKLTAICNECGAEATHSLRKIDGKHADYNDDIVKIGCQEFYSAVCRHH------------
1d6jB           PVEVAEQRAPYEAPANPEVHVKNYELPV--QDAVKQIIDYLDTKG-------------------------
3adkA           GPETMTKRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDDV--------
2ahwD           VTKEDLIKLVEFDNKEYLYYKAI-APDIAFIRATTCDSEGYATFEDEVMY--------------------
2cckA           ----------------------------------------------------------------------
1e98A           DWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQERALHQLMKDTTLNW------------
2ahvA           VTKEDLIKLVEFDNKEYLYYKAIAPDIAFIRATTCDSE--------------------------------
3cmxA           TTTGGNALKFYASV-RLDIRRIGAVKEGENVVGSETRVKVVKNKIAA-----------------------
3di4A           TGLNVFCTGFTRDTGQYFKASPVRPGDYLEFFAEIDLLGNLSACPGGDCSSEASCHPL------------
2a30D           DWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGHYKHESWLLHRTLKTNFDYLQEVPILTLDV
1cfrA           DFSIIDIRGRREELKSMLKDISFSNISLSTISEIDNLYKNFDYAELEHIKSFLSVKT-------------
2dr3E           FIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARLQLKRVLAGTGCTSIFVSQVGPGVEHGVDGIIRLDL
2b8tC           AKLFTYADKITKLTAICNECGAEATHSLRKIDGK------HADYNDDI-VKIGCQEFYSAVCRHHHKVPN
2dr3B           FIEVLRQAIRDINAKRVVVDSVTTLYIAMARSIILQLKRVLAGTGCTSIFVSQVSVGE------------
1e2fA           DWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQ---------------------------
3cddF           KADVTDSEIGRYRPLIIVNEEVTTAEGAAKRGQWERQRSIGKS-NAEYTVTGWRIPQT------------
3cddC           ETPHELLARLAKQRGVLLTSDTFGNLVITRASKTKAGVSLILGDNVKA----------------------
2eg5G           ASRLPVQKAYLDQFTKDFTTFLRIHSEELFSHGRML----------------------------------
2c9yA           PDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMK------------------------------------
2awoC           RQRVAIGRTLVAEPSVFLLDEPLSNLDALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVV---
3clvA           NFQVDILEVQKYAQDNNLLFIQTSAKTGTNIKNIFYMLAEEIYKNI------------------------
1dhjA           HTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVEIMVIGGGRVYEQFLPKAQKLYLTHI
3ch4B           QRGWVFTPGVDDAESECGLDNFGDFDWVIENEEQLENLIEFIRSRL------------------------
1eilA           AGDAALYRADQRAWRIAVQPGELDDLAYAGLEVDAALERMADKLRQAGVAFTRGDEA-------------
2a2zB           DWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEESWLLHRTLKTNF-------------
3bb1B           KAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLASDIPVVLIENSGRCNSD------------
2a30B           DWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGHYKHESWLLHRTLKTNFD------------
2b92B           PDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPIRKFFPKKKCF------------
2dftC           YRALMKRAPLYRRVATMRVDTNRRNPGAVVRHILSR----------------------------------
2d3wA           KKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRIL------------
2ausC           VAWIKRILNLEKAGHGGTLDPKVSGVLPVALERATRVVQALLPAGKE-----------------------
2cvfA           ELSRQLQVNQVHFDSRTEMTKPVAEQTLGYRCKDILRLDKLPKPGLRVAVLEHRFRPEGLMAYFR-----
1av6A           ----------------------------------------------------------------------
2a30A           DWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGHYKHESWLLHRTLKTNFD------------
3cnlA           PDIERALMLFFTEAGRVSFERP------------------------------------------------
2bbsB           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKT-----------------------
3bczC           EHLPYTAKAESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSN-----------------------
3cddD           TPHELLAR-LAKQRGVLLTSDTFGNLVITRASKTKAGVSLILGDNVKA----------------------
2ancF           LKTIIRAERLRMSRQKQRHDALISKLL-------------------------------------------
2aunB           EQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGF-------------------
3bb1E           KAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKKASDIPVVLIENSGRCN------------
2d3wD           KKRNDILQMAVLEPELCILDESDGLDIDALKVVADGVN-SLRDGKRSFIIVTHYQRIL------------
3cueF           KRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMS-----------------------
3cr7B           KGLYKKAREGVIKEFTGISAPYEAPANPEVHVKNYELPVQD-----------------------------
1bglA           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
3dlbB           GREGGRVAWVADPK---DPRKPIPHLTGLLVPVGSLALSLPWERRRRTREIASWIGRRLGLGTPEAVRAQ
1e4yA           ----------------------------------------------------------------------
2d0kA           HTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAAADVPEIFVIGGGRVYEQFLPKAQKLYLTHI
1e9sJ           EEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATF--------------------------------
1e3aB           PRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSMLKRTVVAAVPMPFDKWYS------------
3dfnA           KELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHET
3bpbA           LEKHGLSGSVVRLEKVLGLKTGLAYLEHNNLLAAGEFVSKPEFQDFNIIEI-------------------
2c4rL           HYQIESQIESAFQRGGSIVIDSTEALTAIDINSARGDIEETAFTNLEAADEIARQLRLRDLGGLIDMTPV
3d3qA           ----------------------------------------------------------------------
1e9sB           GTPSMREL--FHWTTIATFDDLRGFLEGTLAESL------------------------------------
1cr0A           --------RSGLGCDVIILDHISIRKMIDNLMTKLKGFAKSTGVVLVVICHLKDLRALRQLSDTIIALER
3dfqA           KELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHET
2c7cH           INKPETGAVELESPFILLADKKISNIRELPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAA
1aldA           KELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHET
3dfqD           KELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLL-------------------
1e9dA           DWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFG-------------------------------------
1e9sI           EEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDL-----------------------------
1cjaA           D--VGTEGSISMQEGFLATVRECASFDLDAFQESLQKCHNLSISPQAIPFI-------------------
6aldA           KELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHET
2d7vA           ----------------------------------------------------------------------
1d6jA           ETGLPFVEVYVDVPVEAPYEAPANPEVHPVQDAVKQIIDYLDTKGYLPA---------------------
1cr1A           LLAKLAYMRSGLGCDVIILDHI--SIRKMIDNLMTKLKGFAKSTGVVLVVICHLKTDLRGS-GALRQLSD
3dyoA           ----------------------------------------------------------------------
1dekB           PIKGVFVFDDE-GKESVNFVAFNKITDVINNIEDQWSVRRLMQALGTDLIV-------------------
2bhvD           RLDIVWSRIITPHGINIMLTNGYNGLVGELIERNFQRYGVP-----------------------------
1dhiA           HTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPIMVIGGGRVYEQFLPKAQKLYLTHI
1e3mB           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
3dfoD           KELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLL-------------------
3dfpD           KELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLL-------------------
3cmwC           SHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGN--------------------------
2ck3C           GCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLR-RPPGREAYPGDVFYLHSRLLERAAKMNDAFGG
3c8uA           AEVGPECRVAIIEGNYLLFDAPGWR---------------------------------------------
3cbnA           PTDIVCRKSDYICSRTLIRADKAAFDLDENLVRDLRKGREL-----------------------------
3dftC           KELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLL-------------------
2d4hB           TPDEYLTYSLKLKKGTSVFDRPVHRRKLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTKTLSGGIQ--
3dftD           KELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLL-------------------
1dvrA           DDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVT--------------------------------
1d8jA           KQKWLMTEALVNNPKIEVIDGKYAFKPKYNVR--------------------------------------
3a00A           MQGVKSVKAIPELNARFLFIAPPSVTGAHDKVIVNDDLDKA-YKELKDFIFAEK----------------
1e2kA           GPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLA--------------------------------
3cmtD           NQIRMKNPETKFYASVRLDIRRIGAVKEGENVVGSETR----VKVVKNKIA-------------------
1dp0A           RIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITAHAWQHQGKTLFISRKTYRIDGSGQMAITVDV
1draA           HTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACDVPEIMVIGGGRVYEQFLPKAQKLYLTHI
2boeX           DALMSAAQAAGKIPILVVSNAPGRDCGGGAPSHSAYRAAGLKNRPAYIIVEPDLISLM------------
2bx2L           HYQIESQIESAFQREVRLPSGGSIVIDSTEALTAIDINSARGDIEETA----------------------
2aumB           EQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRP-----------------------
2bofX           RSWIDEFAAGLKNRPAYIIVEPDLISLMSSCMQHVQQEVTMAYAGKALKAGS------------------
3dfpC           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
3dfnC           KELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHET
3ed8A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1e9rF           LIGTPSMRELFHWTTIATFDDLRGFLEGTLAESL------------------------------------
2a1fF           YKRILLKL-----SGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLF------------
2bv7A           ----------------------------------------------------------------------
3bwdD           PITTVQGEELKKLIGAPAYIECSSKSQENVKGVFDAAIRVVLQ---------------------------
2dr3D           FIEVLRQAIRDINAKRVVVDSVTTLYIAMARSIILQLKRVLAGTGCTSIFVSQVSVGERGF---------
2bbtB           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKM---------------
2drcA           HTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGRVYEQFLPKAQKLYLTHI
3cmvE           RKLAGNLKQSNTLLIFINQGGNALKFYASVRLD-------------------------------------
2dr3C           FIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILRVLAGTGCTSIFVSQVSG--------------
2bhvA           YRDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRYGVP-----------------------------
3cnnA           PDIERALMLFFTEAGRVSFERPED----------------------------------------------
3dfnD           ----------------------------------------------------------------------
3cm0A           VPEEELVRRILRRAELDDNEETVRRRLEVYREKTEPLVGYYEARGLKRVDGLGTPDEV------------
1bmfC           GCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGRE-AYPGDVFYLHSRLLERA---------
1akeA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1e2gA           DWCKQPDVGLPKPDLVLFLQLQLADAAKRGERYENGAFQER-----------------------------
3bjdB           SEEDFAQSRERHPSYVFSGSASRAQLQVFLRHQWFRTFRLYRDAADLL-VNLTDVDEA------------
1e9sL           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
2dpyB           TRYA------MAQREIALAIGEPPATKGYPPSVFAKLPALVERAGNG-----------------------
1ak2A           IPDSLLIRITGRLIHPQSGRSYHEEFNPPKEPMKDDITGEPLISDDNKKALKIRLEAYHTQTTPLVEYYS
1e59A           RYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVIIAAHGNSLRALVKYLD-NMSE
1cjtC           ----------------------------------------------------------------------
1c9kC           DEIQILIAACQRCPAKVVLVTNEVGMGIVPENRLARHFRDIAGRVNQRLAAA------------------
3crmA           LPYTVAQLAIAPEQRQVLHARIAQRFRQMLEQGFIAEVEALHARSDLH----------------------
1afrA           ----------------------------------------------------------------------
1e9rG           --------LLLRETAKKLALIGTPSMRELFHWTTIATF--------------------------------
1e2lB           AGSPPALTLIFDRHALLCYPAARGSMTPQAVLAFVALIPPTLPGTNIVLGALP-EDRHIDRLA-------
3b55A           --NDLKPLKNVGSASIVGLGEATHGAHEVFTKHRIVKY-LVSEKGFTNLVLEEGWDRALEL---------
2e85B           PENDIVAIRELRPTRLLIVDATDMGLNPGEIRII-----DPDDIAEMFMMTTHNMPLN------------
1e9sM           ----------------------------------------------------------------------
2cdnA           VSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDAVGTMDEVFARALRA------------
2a1fD           --------ILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLF------------
1e2iA           ----------------------------------------------------------------------
1e3mA           VETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWACAENNKIKALTLFATHYFELTQLPEKEGVANVH
2czvB           ----------------------------------------------------------------------
2dpyA           TRYAMEIALAIGEPPATKGYPPSVFAKLPALVERAGNGIHGGGSITAFYTVLTEGDDQQDPI--------
1e9sA           ----------------------------------------------------------------------
2bjbA           TVQHT-GSSLPSAPHIAMTAAMLRQAGVDIDDSTPNRWQVRGPVAARRWDI-------------------
2aexA           ----------------------------------------------------------------------
3d3qB           LKEEHLNNNKLHEYLASFDKESAKDIHPNNRKRVLRAI--------------------------------
1dekA           GKESVNFVAFNKITDVINNIED------------------------------------------------
3dffA           DGRWLTAHVEGRQKLAVNDHSPDSDHDLVGEVADDIRSIIDEF-DPTLVVTCAAIGEHPDHE--------
3e8aC           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
3a00B           MQGVKSVKAIPELNARFLFIAPPSGAHDKVIVND--DLDKAYKELKDFI---------------------
3cphA           TRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKID-----------------------
3c15C           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
3bjqB           --------------DPILSTHARGYRQSTLIGKKLFPVAPVAQYGGKILTFGKEAFRLYNTKRNT-----
2aumA           EQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRP-----------------------
1eamA           ----------------------------------------------------------------------
1adoA           KELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHET
1e1qB           YPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVI------------------------------------
2b0lC           ----------------------------------------------------------------------
1chdA           ---------LLSSEKLIAIGASTGGTEA-----IRHVLQPLPLSSPAVIIT-------------------
3d1mA           TRNSERFKELTPNPDIIFKDEENTGADRLMTQRCKDKLNAL-----------------------------
1ek0A           ER--------------------------------------------------------------------
2aunA           EQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFSDISVLLSAFHRHGLPAIH
1cjuC           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
1e2jA           MTPQAV-LAFVALIPPTLPGTNIVLGALRHIDRLAKRQRPGERLDL------------------------
3cmuA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           CXXXXXXXXXXXXQRALVAQLAHSERLTDVQLPEPDEPSARHALPDGEPRIVLNDGVVSYNDRPILHHLS
3cmvG           LYGEGINFYGELVDLGVLIEKAGAWYSYKGEKIGQGKANATAWLIMRLGEDRSMDVETISTGSLDIALGA
3cmvA           FYGELVDLGVKEKLIEKAGAWYSYKGEKIGQGKANAIEKKVRELRLGEDRSMDVETISTGSLSLDIALGA
3czpB           -----------------------------------------DLGQYLDKDAYKEQLAAEQARLAGLIRDK
3cmvC           EGINFYGELVDLGVKIEKAGAWYSYKGEKIGQGKANATAWLKDNPERLGEDRSMDVETISTGSLSLDLGA
3b5jA           ------------------------------------------------HDITFRNIRFRYDSPVILDNIN
3dmdC           ------------------------DALREKIKQKLVGKKVRIGTDKEEAVKEAVSEILETSRRIDLIEEI
2dwoA           -----------------------------------------------LTQSRVQKIWVPV-DHRPSLPRS
2c03B           -------------RRALMDADVNLEVTRDFVERVREEALGKQVLESLTPAVILATVYEALKEALGGEARL
3dm5A           -------------QRALIQADVNVRLVLQLTREIQRRALEEKPPAGISKKEHIIKIVYEEKFLGTEAKPI
2d3wB           --------------------------------------------------LSIKDLHVSVEDKAILRGLS
1d1cA           LNEPAVFHNLRVRYNQDLIYTYSGLFLVAVNPFKRIPIYTQEMVDIFKGRRRNEVAPHIFAISDVAYRSM
3b60A           ----------------FQRGMAACQTLFAILDSEQEKDEGKRVIDRATGDLEFRNVTFTYPGRPALRNIN
2bifA           ----------------------------------------------------------------------
2akaA           EDMSELSYLNEPAVFHNLRVRYNQDLIYTYSGLKRIPIYTQEMVDIFKGRRRNEVAPHIFAISDVAYRSM
3cmvH           -------------QKALAAALGQIEKQF----------GKGSIMRLGE--DRSMDVETISTGSLSLDIGA
3c95A           ---------------------------------FGAWRGNTSWVAPLAWHPENRNAVIMVDLAGDISPLL
1aroP           ARFGRIRDLEAKHFKKFMQVVEADMLSKGLLGGEAWSSWHKEDSIHVGVRSTGMVSLHRQNSETIELAPE
2c04A           -------------RRALMDADVNLEVARDFVERVREEALGKQVLSLTPAEVILATVYEALKEALGGEARL
3eiuA           IVVVQVFFTGETLK--LPASVDLLGRILSGGGPRIVPDQLLDINGAAMNPYARLPPKDFIQTGISTIDGT
2dwpA           --------------------------------------------------------------QSRVQKIW
3czpA           -----------------------------------------------------------QARLAGLIRDK
1bifA           ----------------------------------------------------------------------
3b2qA           QVFEIFTGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLLDINGAAMNPYARLPPKIQTGISTIDGT
2c03A           -------------RRALMDADVNLEVTRDFVERVREEALGKQVLSLTPAEVILATVYEALKEALGGEARL
3dmdB           ------------------------DALREKQKLVGKKVRIGTDKGKIIEEAVKEAVSEILSRRIDLIEEI
2c61B           ----------------------------------------------------------FIQTGISTIDGT
1e9sF           -------------------------------EFGGAPFKRFLRGTRIVSGGKLKRMTREKAKQVTVAGVP
1bg0A           ----------------------------------------------------------------------
2czvA           --------------------------------------------------------------GGGVKFIE
1e69A           ---------------------------------------------------------LYLKGFKSFGRPS
3b85A           ---------------------------------------------------------VIRPKTLGQKHYV
2bbsA           -------------------------------------------------EEGFGELFEKAKGTPVLKDIN
2bc9A           ------------------------------------------EIHMTGPMCLIENTNGRLANPEALKILS
3bo6B           --------------------------------------------------HSLHNQMRQMPMSHFREALD
2a5gA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
2akaB           --------------------------------------------------------------QDAFSAIG
2ctsA           ----------------------------------------------------------STNLKDILADLI
3bgwD           I------------AQQIIENVNVKPIQEAVSELMEIEIDEALVTVYEEIESADGNITGVPSGFTELDRMT
3eiuB           ---------------------------------RIVPDQLLDINGAAMNPYARLPPKDFIQTGISTIDGT
2ccgA           ----------------------------------------------------------------------
2dr3A           ---------------------------------------------------------VKTGIPGVDEILH
1e9sG           --------------------------------FGGAPFKRFLRGTRIVSGGKLKRMTREKAKQVTVAGVP
1e9rA           -------------------------------------------GTRIVSGGKLKRMTREKAKQVTVAGVP
2b8wA           -----------------------------------------------GPMCLIENTNGRLANPEALKILS
3a1wA           ----------------------------------------------------------------------
1e0jA           -------------------------------------------LRERIREHLSSSVGLLFSGCTGINDKT
2c61A           -DIVVVQVFFTGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQAAMNPYARLPPKDFIQTGISTIDGT
3da4A           ------------CLQALTQLEDYIKKHGASNPLQIISTNIGYFCNADRNLVLHPGISVYDAYH---FAKP
1e0jB           ----------------------------------PDGVVSALSLREREHLSSEESVGLLFSGCTGINDKT
2d62A           ------------------------------------------------AEVKLINIWKRFGDVTAVKDLS
2awnC           -------------------------------------------------------ASVQLQNVTVSKDIN
3b2qB           -EGVIFTGETLKLPASVDLLGRILSGSGEPRDGGPRIVPDQLLDINGAAMNPRLPPKDFIQTGISTIDGT
2bkiA           LNEATLLHNIKVRSKDRIYTYVANILIAVNPYFDIPKIYSSETIKSYQGKSLGTMPPHVFAIADKAFRDM
3cr7A           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
3dt2A           ------------------------HLPDRREIISFGSGYGGNSLGKKCFALRIASRLAKEEGHMLILGIT
2d4hA           -----------------------------------------------GPMCLIENTNGRLANPEALKILS
1cr4A           -----------------------------------------------EHLSSEESVGLLFSGCTGINDKT
2bkhA           -------------SKDRIYTYVANILIAVNPYFDIPKIYSSETIKSYQGKSLGTMPPHVFAIADKAFRDM
2c9oC           --------------------TTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENARE-ACGVIVELIK
4dcgA           ----------------------------------------------------------------------
2awnB           --------------------------------------------------VQLQNVTKAWGEVVVSKDIN
2ccjB           ----------------------------------------------------------------------
3d3kA           ---------------------------------------------------LVVPSISYELHKKLLSVAK
1dkiA           -------------SGSFDV----NGKENIAMESYVEQIKENKKLPVVKSLLDSKGIHYNQGNPYLLTPVI
3d7wA           ---------------------------------DQQTTGEEYFSFITLLRDYVSSGSFSN-NIPLLRQST
3dtbB           HSVGCPLPLKKPLVNNWAC--NPELTLIAHLPDRREIISFGSGYGGLRIASRLAKEEGWLAEHMLILGIT
2a2zD           ----------------------------------------------------------------------
1e9sD           ----------------------------------GAPFKRFLRGTRIVSGGKLKRMTREKAKQVTVAGVP
3dt4A           --------------ACNPELTLIAHLPDRREIISFGSGYGGNSLGKKCFALRIASRLAKEEEHMLILGIT
2a5jA           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
2c9gA           INLD---------DRSHWGGDLKTILHTNMPNVNEFMFTNKF----KARVMVSRSLTKDKQVELKYEWVE
2axpA           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
1cr2A           ---------------------------------------------------------LLFSGCTGINDKT
421pA           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
2awnD           --------------------------------------------------VQLQNVTKAWGEVVVSKDIN
2cckB           ----------------------------------------------------------------------
1dg3A           -----------------------------------------------GPMCLIENTNGRLMANEALKILS
1e6cA           ----------------------------------------------------------------------
3bh0A           ---------------------------------DDGSIDEALVTVYEEIESADGNITGVPSGFTELDRMT
2dftA           ----------------------------------------------------------------------
3dt4C           N------------WACNPELTLIAHLPDRREIISFGSGYGGNSLGKKCFALRIASRLAKEEEHMLILGIT
2cgtH           -------------------------------LADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIE
1e9rE           ----------------------------------GAPFKRFLRGTRIVSGGKLKRMTREKAKQVTVAGVP
2b8tA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
1d6jB           -----------------------------------------------------------ASALTRSERTE
3adkA           --------------------------------------------------------------------ME
2ahwD           ---------------------------------------------------------INGRVPLSAQEAV
2cckA           ----------------------------------------------------------------------
3bgwA           AQQIIENVNVKPIQEAVSELMEIEASGTDDDDGSIDEALVTVYEEIESADGNIT---GVPSGFTELDRMT
1e98A           ----------------------------------------------------------------------
2ahvA           ---------------------------------------------------------INGRVPLSAQEAV
3cmxA           ----------------------------------------------GEDRSMDVETISTGSLSLDIALGA
3di4A           --------------------------------PVICYPDSLPRPDLALYRAARASAKTGEVLVPPREGRC
2a30D           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
2dr3E           ---------------------------------------------------------VKTGIPGVDEILH
2b8tC           ----------------------------------------------------------------------
2dr3B           ---------------------------------------------------------VKTGIPGVDEILH
1e2fA           ----------------------------------------------------------------------
3cddF           -------------DLETYKFNDAQYKAFIEPIKQGQACTVDI---GGERVITGYVDDWVPSITISVSGRD
3cddC           ----------------------------------------------------------------------
2eg5G           -------------------------------------------------------PVLEQCVRELLRANL
2c9yA           ----------------------------------------------------------------------
2awoC           ---------------------------------------------------------VQLQNVTVSKDIN
3clvA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
3ch4B           --------------------------------------------------------------------AP
1eilA           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
3bb1B           --------------------------------------------------SGINTFAPATQTLELLGNLK
2a30B           ----------------------------------------------------------------------
2b92B           -----------------------------------------------GPMCLIENTNGRLANPEALKILS
2dftC           ----------------------------------------------------------------------
2d3wA           --------------------------------------------------LSIKDLHVSVEDKAILRGLS
2ausC           ----------------------------------------------------------------------
2cvfA           --------------------------------------------------------MLSTGTKSLDSLLG
1av6A           ----------------------------------------------------------------------
3dt7A           -----------------------IAHLPDRREIISFGSGYGGNSLLGKKCFALRIASRLLAEHMLILGIT
2a30A           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------HKGEPRKVLLKK
2bbsB           ---------------------------------------------------------ENVTAFWVLKDIN
3bczC           --------------------------------------------------------------REASH---
1accA           --------------------------------------------TGSNWSEVLPQ--IQETTARIIFNGK
3cddD           ---------------------------------------------------------LKAGGKIYQGWTK
2ancF           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
3bb1E           --------------------------------------------------SGINTFAPATQTKELLGNLK
2d3wD           --------------------------------------------------LSIKDLHVSVEDKAILRGLS
3cueF           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
1bglA           -----EVASDTPHPARIGLNCQLAQVAERVNWLGLGPQENYPDRLTAACFDRWDLPLSDMYTPYVFPSEN
3bk7A           EPGVYGIFSKPKGTRNGINEFLQGYLKDENVRFRPYEIRFTKLSERVDVERETLVEYPRLVKDYGSFKLE
2awnA           --------------------------------------------------VQLQNVTKAWGEVVVSKDIN
3cioD           ----------------------------------------------------------------------
3czjA           ----EVASDTPHPARIGLNCQLAQVAERVNWLGLGPQENYPDRLTAACFDRW-DLPLSDMYTPYVFPSEN
3dlbB           ----------------------------------------------------------------------
2awoA           --------------------------------------------------VQLQNVTKAWGEVVVSKDIN
1e4yA           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
1e9rD           ----------------------------------GAPFKRFLRGTRIVSGGKLKRMTREKAKQVTVAGVP
1e9sJ           --------------------------------------------------GKLKRMTREKAKQVTVAGVP
3bb1A           --------------------------------------------------SGINTFAPATQTKELLGNLK
1e3aB           -----------------------------------------------------------WTQQAAKQALT
3d31A           --------------------------------------------------IEIESLSRKW-KNFSLDNLS
3dfnA           ----------------------------------------------------------------------
3bpbA           --------------------------------------------------------LVDGLTSSHLGKPD
2c4rL           ----------------------------------------------------------------------
3d3qA           GLFNEVQHLVEQGFEASQSQAIGYKELVPVIKGNISE---------------------------------
2c0bL           GFLPLKEIAREYFPRPNIKDVLREGQEVIVQIDKEERGNKGAALTTFISLAGSYLVLMPNNPRAGGISR-
1e9sB           -----------------------------QGEFGGAPFKRFLRGTRIVSGGKLKRMTREKAKQVTVAGVP
1cr0A           ---------------------------------------------------------LLFSGCTGINDKT
3dfqA           ----------------------------------------------------------------------
2c7cH           --------------------------------------------------TITKDGVS------VAREID
1aldA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
1e9sI           ------------------------------GEFGGAPFKRFLRGTRIVSGGKLKRMTREKAKQVTVAGVP
1cjaA           -----------------------------------------------------------VITTLANQANI
3b9qA           --------------EALLVSDFGPKITVRI-VERLREDIMSGKLKSGSEIKDALKESVLEMLAKSKTELQ
6aldA           ----------------------------------------------------------------------
2d7vA           ---------------HTWEFDGGSKILASASPHVVPVPLSVEANVDPEEAFVAASCHLVFLSIAAKQRYL
1d6jA           -----------------------------------------------------------ASALTRSERTE
1cr1A           ----------------------------------------------------------LFSGCTGINDKT
3dyoA           EVASDTPHPARIGLNCQLAQVAERVNWLGLGPQENYPDRLTAACFDRWDLPL--SDMYTPYVFPSENGLR
1dekB           ----------------------------------------------------------------------
1ai4B           ---------------------------------------------------------------------T
2bhvD           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
2d7vB           -------------RAHTWEFDGGSKILASASPHVVPVPLSVEANVDPEEAFVAALSSCHFLSIAAKQRYL
3dfoD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
3bb1F           --------------------------------------------------SGINTFAPATQTLELLGNLK
3cmwC           ----------------------------------------------------------------------
2ck3C           ---------------------ELLGRVVDALGNAIDGKGPIGSKAKAPGIIPRISVREPMQTGIKAVDSL
3c8uA           -------------------------------------------------------GTLAALCQGVLERLD
3cbnA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2d4hB           -----------------------------------------------GPMCLIENTNGRLMANPALKILS
3dftD           ----------------------------------------------------------------------
2dr3F           ---------------------------------------------------------VKTGIPGVDEILH
1dvrA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
2bkeA           -------------PQDL-SVAAGIPLSTAQKIIKEARDALDIRFKTALEVKKERNVKKISTGSQALDGLL
3cmtD           ----------------------------------------------------DVETISTGSLSLDIALGA
1dp0A           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
2b8wB           -----------------------------------------------GPMCLIENTNGRLANPEALKILS
2boeX           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sH           ---------------------------------GGAPFKRFLRGTRIVSGGKLKRMTREKAKQVTVAGVP
3dhwC           --------------------------------------------------IKLSNITKVFHQGQALNNVS
3dfnC           ----------------------------------------------------------------------
2d3wC           --------------------------------------------------LSIKDLHVSVEDKAILRGLS
3ed8A           ------------------------ERTISFKDDGKYKTRAVVKFEGDTLVRIELKGTDFKEDGNILGHKL
1ckvA           --------------------------------------------------AGIMGLKGKDFADQFFADEN
3bb1C           -----------------------------------------------RGWSGINTFAPATQTLELLGNLK
1e9rF           --------------------------------------------------GKLKRMTREKAKQVTVAGVP
3be4A           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
2dr3D           ---------------------------------------------------------VKTGIPGVDEILH
2bbtB           ---------------------------------------------EEGFGELFEKAKQNNNNTPVLKDIN
2drcA           ----------------------------------------------------------------------
3cmvE           -------------QKALAAALGQIEKQFGKG----------SIMRLGEDRSMDVETISTGSLSLDIALGA
2dr3C           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
3cnnA           -----------------------------------------------------------KGEPRKVLLKK
3dfnD           ----------------------------------------------------------------------
2d2eA           --------------------------------------------------LEIRDLWASIDGETILKGVN
3cm0A           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------APGIIPRISVREPMQTGIKAVDSL
1akeA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1d2zD           ----VEDNDIYRLAKILDEN----SCWRKLMSIIPKGMDVQASGAGCLNFPAEIKKGFKYQDVFQIDEAA
1e2gA           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
3b85B           --------------------------------------------------------------TLGQKHYV
1e9sL           --------------------------------------------------GKLKRMTREKAKQVTVAGVP
3dm9B           ------------------------DALREKIKQKLVGKKVRIGTDKIEEAVKEAVSEILETSRRIDLIEE
1cs4C           ----------------------------------------------------------------------
3bb1G           -------------------------------------------QQTVRGWSGINTFAPATQTKELLGNLK
2dpyB           -------------------------------LPAPDTLETGALITPPFNPLQRTPIEHVLDTGVRAINAL
2dflA           -------------PQDLSVAAGIPLSTAQKIIEARDALDIRFKTALEVKKERMNVKKISTGSQALDGLLA
2awoD           --------------------------------------------------VQLQNVTKAWGEVVVSKDIN
1ak2A           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
2c9oA           -----------------------TTKTQR--IASHSHVKGLGLDESGLAKQAASGLVGQEACGVIVELIK
3crmA           ----------------------------------------------------------------------
1afrA           -------------------------------------------------------------PREVHVQVT
1b0uA           --------------------------------------------------LHVIDLHKRYGGHEVLKGVS
1e2mB           ----------------------------------------------------------------------
1e9rG           --------------------------------------------------GKLKRMTREKAKQVTVAGVP
2bbtA           ------------------------------------------------WEEGFGELFEKAKGTPVLKDIN
3cqcA           ------------------------RLKIDV-IDWLVFD----PAQRAEALKQGNAIMRKFKKHEAAKEVF
1e2lB           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
3cmvB           ---------------------------------------------------------------LSLDIGA
1e9sM           --------------------------------------------------GKLKRMTREKAKQVTVAGVP
2cdnA           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
3dmdA           ------------------------DALREKIKQKLVGKKVRIGTDKEEAVKEAVSEILETSRRIDLIEEI
1e2iA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
3dm5B           ------------IQRALIQADVNVRLVLQLTREIQRRALEEKPPAGISKKEHIIKIVYEEKFLGTEAKPI
2dpyA           -------------------------------LPAPDTLETGALITPPFNPLQRTPIEHVLDTGVRAINAL
2a78A           ----------------------------------------------------------------------
2d2fA           --------------------------------------------------LEIRDLWASIDGETILKGVN
1e9sA           --------------------------------------------------GKLKRMTREKAKQVTVAGVP
2d4uB           ----------------------------------------------------------------------
2bjbA           ---------------ALAAAQGRGATISGA-LRSRDTELMLDALQT------LGLRVDGVGSELTVSGRI
2aexA           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
3e70C           ------------------------DALREKQKLVGKKVRIGGKIIEEAVKEAVSEILETS-RRIDLIEEI
1dekA           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
3do6A           -----------------------------------------------DDILYPYGHYIAKIDHRFLKSLE
3e8aC           ----------------------------------------------------------------------
3ec1A           -----------------------------------------------------------GIGMAKVMEAI
3dauA           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
3cd9A           --------------------------------NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNGHKLEYN
1e4vA           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
3bb1H           --------------------------------------------------SGINTFAPATQTKELLGNLK
3c15C           ----------------------------------------------------------------------
1e9sE           --------------------------------------------------GKLKRMTREKAKQVTVAGVP
2bwjB           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------PMQTGIKAVDSL
2b0lC           ----------------------------------------------------------------------
1e9rB           --------------------------------------------------GKLKRMTREKAKQVTVAGVP
3bb1D           --------------------------------------TVRG-------WSGINTFAPATQTKELLGNLK
1chdA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------HFLGKEHFNYYS
1e2kB           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1agpA           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
3dofB           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
2axnA           ------------------------------------------------------QKIWVPVDHRPSLPRS
1cjvC           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
2c1lA           -------------------------------------------------------------GVRFYETFT
2dwuB           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
4dcgA           -----------------------LDKPFMYEEIDNELDYEPESANEVAKKLP-YQGQLKLLLGELFFLSK
2ccjB           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
3cioD           --------------------------------------------------------------RTSLHFAM
3dlbB           A---------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
2c4rL           RHQRAVENRLREAVRQDRARIQISHISRFGLSRQRLSPSLGESSHHVCPR--------------------
3d3qA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2bwjA           ---------------------------------------------------------------------M
2d7vB           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2ck3C           G---------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
1dp0A           EVASDTPHPARIGLNC-----QLAQVAERVNWLGLGPQENYPDRLTAACFDRWDLPLSDMYTPYVFPSEN
1draA           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
1e59A           -----EEILELNIPTGVPLVYEFDEPLKRYYLGNADEIAAKAA---------------------------
1cjtC           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2bwjB           ---------------------------------------------------------------------M
3bjqB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           WRVNPGEHWQIVGPNGAGKSTLLSLITGDHPQGYSNDLTLFGRRRGSGETIWDIKKHIGYVSSSLHLDYR
3cmvG           GGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTC-----AFIDAEHALDPIYARKLGVDIDNLLCSQ
3cmvA           GGLPMGRIVEIYGPESSGKTTLTLQV-------------IAAAQREGKTCAFIDAEHALD-------PIY
3czpB           RFRQHSLVAVFEGNDAAGKGGAIRRVTDLDPRQYH---IVPIAAPTEEERAQPYLWRFWRHIPARRQFTI
3cmvC           GGLPMGRIVEIYGPESSGKTTLTLQVIAAAQ------------------REGKTCAFIDAEHALDPIYAR
3b5jA           LSIKQGEVIGIVGRAGSGKSTLTKLIQRFYI--PENGQVLIDGHDLALADPNWLRRQVGVVLQDNVLLNR
3dmdC           RKAEKPYVIMFVGFNGSGKTTTIAKLANWL-------------KNHGFSVVIAAS----DTFRAGAIEQL
2dwoA           CGPNSPTVIVMVGLPARGKTYISKKLTRYLNWI-------------GVPTKVFNVGEYRR----------
2c03B           PVLKDRNLWFLVGLQGSGKTTTAAKLALYY-------------KGKGRRPLLVAADTQ-------RPAAR
3dm5A           EIKEKPTILLMVGIQGSGKTTTVAKLARYFQKR-------GYKVGVVCSDTWRPGAYHQLRQ--------
2d3wB           LDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVGGTVEFKGKDLLALSPEDRAGEGIFMAYPVEIPGVS
1d1cA           LDDRQNQSLLITGESGAGKTENTKKVIQYLA--SVAGRNQAGVLEQQILQANPILEAFGNAKTTRNNNSS
3b60A           LKIPAGKTVALVGRSGSGKSTIASLITRFYDIDE-------GHILMDGHDLLASLRNQVALVSQNVHLFN
2bifA           ----------MVGLPARGKTYISKKLTRYLNFI-------------GVPTREFNVGQYRR----------
2akaA           LDDRQNQSLLITGESGAGKTENTKKVIQYLAS-VAGRNQANGSGVLEQQILQANPILEAFGNA--KTTRN
3cmvH           GGLPMGRIVEIYGPESSGKTTLTLQVIAAAQRE-GKTCAFIDAEH----ALDPIYARKLGVDIDNLLCSQ
3c95A           ELDSDTLRAVPVKLVHINKCPVLAQANTLRPDNLKILRENPQVREKVVAIFAESDNVDAQLYNGFFS-DA
1aroP           YAEAIATRAGALAGISPMFQPCVVPPKPWTGITGGGYWANGRRPLALVRTHS-KKALMRYEDVYMPEVYK
2c04A           PVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKG-------RRPLLVAADTQRPAAREQLRLLGEKVGVP
3eiuA           NTLVRGQKLPIFSASGLPHNEIALQIARQASV-PGSESAFAVVFAAMGITNEEAQYFMSDFEKTGALERA
2dwpA           VPVDHRNSPTVIGLPARGKTYISKKLTRYLNWI-------------GVPTKVFNVGEYRR----------
3czpA           RFRQHSLVAVFEGNDAAGKGGAIRRVTDLDPRQYHIVPIAAPTEEERAQPYLWRFWRHIPA----RRQFT
1bifA           ----------------------------------------------------------------------
3b2qA           NTLVRGQKLPIFSASGLPHNEIALQIARQAS--VPGSESAFAVVFAAMGITNEEAQYFMSDFEKTGALER
2c03A           PVLKDRNLWFLVGLQGSGKTTTAAKLALYYK-------------GKGRRPLLVAADTQRP-------AAR
3dmdB           RKAEKPYVIMFVGFNGSGKTTTIAKLANWLKN-----------------HGFSVVIAASDTFRAGAIEQL
2c61B           NTLVRGQKLPIFSASGLPHNEIALQIARQASV-PGSESAFAVVFAAMGITNEEAQYFMSDFEKTGALER-
1e9sF           MPRDAPRHLLVNGATGTGKSVLLRELAYTGLL-RGDRMVIVDPN-GDMLSKFGRDKDIILNPYDQRTKG-
1bg0A           --ENLDSGVGIYAPDAESYRTFGPLFDPIIDDYH-------GGFKLTDKHPPKQWGDINTLVGLDPAGQF
2czvA           MDIRDKEAYELAKEWFDEVVVSIKFNEEDKEKLREAILLSNPKPSLVRDTVQKFKSYLIYVESNDLRVIR
1e69A           LIGFSDRVTAIVGPNGSGKSNIIDAIKWVARELKRTGENTYYLNGSPVRLKDIRDRFAGTGLGVDFYSIV
3b85A           DAIDTNTIVFGLGPAGSGKTYLAAKAVQALQS-KQVSRIILTRPAVEAG--EKLGFLPGDPYLRPLHDAL
2bbsA           FKIERGQLLAVAGSTGAGKTSLLMMIMGELEP----------------SEGKIKHSGRISFCSQNSWIMP
2bc9A           AITQPMVVVAIVGLYRTGKSYLMNKLAGKK-------------KGFSLGSTVQSHTKG---------IWM
3bo6B           APDYSGMRQSGFFAMSQGFQLESHGGDVFMH--AHRENPQCKGDFAGDKFHISVQREQVPQAFQALSGLL
2a5gA           -----EMRILMLGLDAAGKTTILYKLKLGQVTTIP---TVGFNVETVTYKNVKFNVWDVGGLDKIRPLWR
2ccgB           -----SAFITFEGPEGSGKTTVINEVYHRLV--KDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAM
2akaB           QNADDLPQIAVVGGQSAGKSSVLENFVGRDFL-PRGSGIVTRRPL-VLQLVNSTTEYAEFLHFTDFEEVR
2ctsA           PQARIKTFRQQHGNTAVGQITVDMMYGGRGMKGLVYETSVLDPDEGIRFRGY-SIPECQKMLPKAKGGEE
3bgwD           YGYKRRNFVLIAARPSMGKTAFALKQAKNMSDND-------DVVNLHSLEMGKKENIKRLI-------VT
3eiuB           NTLVRGQKLPIFSASGLPHNEIALQIARQASV-PGSESAFAVVFAAMGITNEEAQYFMSDFEKTGALERA
2ccgA           ----------------------------------------------------------------------
2dr3A           GGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKM-------------GEPGIYVALEEHPVQVRQNM----
1e9sG           MPRDAPRHLLVNGATGTGKSVLLRELAYTGLL-RGDRMVIVDPNG-DMLSKFGRDKDIILNPYDQRTK--
1e9rA           MPRDAERHLLVNGATGTGKSVLLRELAYTGLL-RGDRMVIVDPNGDMLSKFG-RDKDIILNPYDQRTKG-
2b8wA           AITQPMVVVAIVGLYRTGKSY-LMNKLAGKKKGFSLGSTVQSHTKGIWCVPHPKKPGHILVLLDTEGLGD
3a1wA           ----------LAGCPNVGKTSLFNALTGTKQY-VANWPGVTVEKKEGVFTYKGYTINLIDLPGTYSLGYS
1e0jA           LGARGGEVIMVTSGSGMGKSTFVRQQALQWG-------------TAMGKKVGLAMLEESVEETAEDLIGL
2c61A           NTLVRGQKLPIFSASGLPHNEIALQIARQAS--VPGSESAFAVVFAAMGITNEEAQYFMSD-FEKTGALE
3da4A           APSQYDYRSMNMKQMSGNVTTPIVALAHYLWGNGIANIGLKISPMKINQIKDIIKSGVVGTFPVSTKFGN
1e0jB           LGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAM-------------GKKVGLAMLEESVEETAEDLIGL
2d62A           LEIKDGEFLVLLGPSGCGKTTTLRIAGLEEPTRGQIYIEDNLVADPEKGVFVPPKERDVAVFQSYALYP-
2awnC           LDIHEGEFVVFVGPSGCGKSTLLRMIAGLGVGMVFQSYALYPH--------LSVAENMSFGLKLAGAKKE
3b2qB           NTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESA--FAVVFAAMGITNEEAQYFMSDFEKTGALER
2bkiA           KVLKLSQSIIVSGESGAGKTENTKFVLRYLTES-------YGTGQDIDDRIVEANPLLEAFGNAKTVRNN
3cr7A           -----GLTIWLTGLSASGKSTLAVELEHQLVR-DRRVHAYRLDGDNIRFGLNKDLGFSEADRNENIRRIA
2bdtA           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
3dt2A           NPEGKKKYLAAAFPSACGKTNLAM-MNPTLPGWKVECVGDDIAWMKFDAQGNLRAINPENGFFGVAPGTS
2d4hA           AITQPMVVVAIVGLYRTGKSYLMN-KLAGKKKGFSLGSTVQKGIWMWCVPHPKKPGHILVLLDTEGLGDV
1cr4A           LGARGGEVIMVTSGSGMGKSTFVRQQALQW-------------GTAMGKKVGLAMLEE-------SVEET
2bkhA           KVLKLSQSIIVSGESGAGKTENTKFVLRYLTESY-------GTGQDIDDRIVEANPLLEAFGNAKTVRNN
2c9oC           SKKMAGRAVLLAGPPGTGKTALALAIA-QELGSKVPFCPMVGSEVYS-TEIKKTEVLMENFRRAIGLRIK
4dcgA           ----------------------------------------------------------------------
2awnB           LDIHEGEFVVFVGPSGCGKSTLLRMIAGLETIT-------SGDLFIGEKRMNDTPPAERGVG---MVFQS
2ccjB           ----------FEGPEGSGKTTVINEVYHRLVK-DYDVIMTREPGG-VPTGEEIRKIVLEGNDMDIRTEAM
3d3kA           HGLTLERRLEMTGVCASQMALTLLGGPQPTVALLCGPHVKGAQ----GISCGRHLANHDVQVILFL----
1dkiA           EKVKPGEQSFVHAATGSVATATAQIMKYHNYP--------------NKGLKDYTYTLSSNNPYFNHPKNL
3d7wA           VPVSEGQRFVLVELTNAGGDTITAAIDVT-------------NLYVVAYEAGNQSYFLSDAPAGAETQDF
3dtbB           NPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGD-------DIAWMKFDAQGNLRAINPENGFFG
2a2zD           -----IKKISIEGNIAAGKSTFVNILKQCEDWEVVPEPVARWCNVQSTNVLQMMYEKPERWSFTFQTYAC
1e9sD           MPRDAPRHLLVNGATGTGKSVLLRELAYTGLLR-------GDRMVIVDPNGDMLSKFG------------
3dt4A           NPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECV-----GDDIAWMKFDAQGNLRAINPENGFFGVA
2a5jA           ----------IIGDTGVGKSCLLLQFTDKRFQPIGVEFGARMVNIDGKQIKLQIWDTAGQESFRSITRSY
1e2dA           ----RGALIVLEGVDRAGKSTQSRKLVELCAAG--------HRAELLRFPERSTEIGKLLS----SYLQK
3cr7D           ----------------------------------------------------------------------
3cr7C           ----RGLTIWLTGLSASGKSTLAVELEHQLVR-DRRVHAYRLDGDNIRFGLNKDLGFSEADRNENIRRIA
2c9gA           FTLPEGNYSETMTIDLMNNAIVEHYLKVGRQ---------------------------------------
2axpA           ----------------------------------------------------------------------
2a2zA           -----IKKISIEGNIAAGKSTFVNILKQCEDWEVVPEPV------ARWCNVQSTNVLQMMYEKPERWSFT
2d4uA           ----------PLGSGGLFFNALKNCKENVLQTIRQQQSTLNGSWVALLQTNTLNRAGIRYMMDQNNIGSG
1cr2A           LGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLK
421pA           ----TEYKLVVVGARGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAM
1e9fA           ----RGALIVLEGVDGAGKSTQSRLVEALCAAG--------HRAELLRFPERSTEIGKLLSSYLQKKSDV
1e9cA           ----RGALIVLEGVDRAGKSTQSRKLVEALCAA-------GHRAELLRFPERSTEIGKLLSSYLQKKSDV
2awnD           LDIHEGEFVVFVGPSGCGKST-----LLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVEPSVFLLD
2cckB           ----------FEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGDMDIR--TEAML
1dg3A           AITQPMVVVAIVGLYRTGKSYLM--NKLAGKKHTKGIWMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQN
1e6cA           ----------MVGARGCGMTTVGRELARALGYEFVDTDIFMQHTSGMTVADVVAAEGWPGFRRRESEALQ
3bh0A           YGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDV-----VNLHSLEMGKKENIKRLIVTAGSINAQKI
2dftA           ----------LVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVR
3dt4C           NPEGKKKYLAAAFPSACGKTNLAMMNPTLPGW-KVECVGDDIAWMKFDAQGNLRAINPENGFFGVAPGTS
2cgtH           LEDKFNMGAQMVKEVASKATTTATVLAQADLKRGIDKAVTAAVEELKALSVPCSDSKAIAQVGTISANSD
1e9rE           MPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDR--MVIVDPNGDMLSKFGRDKDIILNP--------
2b8tA           -----GWIEFITGPMFAGKTAELIRRLHRLE--YADVKYLVFKPKIDTRSIRNIQSRTGTSLPSVEVESA
2cjwB           ----TYYRVVLIGEQGVGKSTLANIFAGVEDTYERTL--MVDGESATIILLDMWENHDHMQVGDAYLIVY
2b8tB           -----GWIEFITGPMFAGKTAELIRRLHRLEYADVKY-LVFKPKILPSVEVESAPEILNYIMSNSFNDET
1d6jB           LRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRNENIRRIAE
3adkA           EKLKKSKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTG--DLLRAEVSSGSARGKMLSEIMEKGQLVPLE
2ahwD           NYIPDEATLCVLGAGLEATTLITALADKYKQTQTPRNLSIGLGDRADRGISPLAKWALCGHWGQSPRISD
2cckA           ----------------------------------------------------------------------
3bgwA           YGYKRRNFVLIAARPSMGKTAFALKQAKNMSD------------------NDDVVNLHSLEMGKKENIKR
1e98A           ----RGALIVLEGVDRAGKSTQSRKLVELCAAG--------HRAELLRFPERSTEIGKLLSSYLQKKSDV
2ahvA           NYIPDEATLCVLGAGGGATTLITALADKYKQTQTPRNLSIGLGDRADRGISPLVKWALCGHWGQSPRISD
3cmxA           GGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREG-------KTCAFIDAEHALDPRKLGVDIDNLLCSQP
3di4A           FEVKAGQFFRISSVEGPQVGDLNLHNLHDLTERFFSGKTRALHGTHVTTGERLWSNLPYLRPATIIEDTL
2a30D           -----IKKISIEGNIAAGKSTFVNILKQLCEEVVPEPVARWCNVQSTNVLQMMYEKPERWSFTFQTYACL
1cfrA           ----------IISKSGEGNKYTIFVAYASHIDDFINDEAIRLGGKISDGSFNKCEWLIGIRA----IEFF
2dr3E           GGIPERNVVLLSGGPGTGKTIFSQQFLWNGLK-MGEPGIYVA-LEEHPVQVRQNMAQFGWDVKPYEEKG-
2b8tC           -----GWIEFITGPMFAGKTAELIRRLHRLEYADVK--YLVFKPKIDSRTGTSLPSVEVESAPEILNYIM
2dr3B           GGIPERNVVLLSGGPGTGKTIFSQQFLWGLKMGEPGIYVALEEHPVQVRQNMAQFGWDVK----------
1e2fA           ----RGALIVLEGVDRAGKSTQSRKLVEALCA-AGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVH
3cddF           KTADLVDCSIDYPSGQFNNQTLTQIADICKPFGIKVIVNTDVGEPFQRIQIEQGETPHELLARLAKQRGV
3cddC           ----------AGGKIYQGWTKIGITRSLEASGAFDLETYFIEPIKQGQACTVDIGGERVITGYVDDWVP-
2eg5G           PNINKCIKVADLGCAS-GPNTLLTVRDIVQSIDKVGQLERPLNDLFPNDFNSVFKLLPSFYRKLEKENGR
2c9yA           -----GIRAVLLGPPGAGKGTQAPRLAENFCVC-------HLATGDMLRAMVASGSELKLKATMDAGKLV
2awoC           LDIHEGEFVVFVGPSGCGKSTLLRMIAGLETIT-------SGDLFIGEKRMNDTPPAERGVGMVALYPHL
3clvA           --KKSSYKTVLLGESSVGKSS-IVLRLTKDTFHENTNTTIGASFCNYNENLCNIKFDIWDTAGQERYASI
1dhjA           ----------------------------------------------------------------------
3ch4B           LGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCA--VLRLSGPLKEQYAQEHGLNFQYKEAFRKD-MI
1eilA           ----------------------------------------------------------------------
2a2zB           -----IKKISIEGNIAAGKSTFVNILKQLCED-WEVVPEPVARWCNVQSTNVLQMMYEKPERWSFTFQTY
3bb1B           QEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPF-----QSGPRPVMVSRSRAGFTLNIIDTPGLIE
2a30B           -----IKKISIEGNIAAGKSTFVNILKWEVVP-EPVARWCNVQSTNVLQMMYEKPERWSFTFQT-YACLS
2b92B           AITQPMVVVAIVGLYRTGKSYLMN-KLAGKKKGFSLGSTVQSHTKGIWMWCVPHPKKPGHILVLLDTEGL
2dftC           ----------LVGLPGSGKSTIGRRL---AKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEED
2d3wA           LDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIP
2ausC           ----------------------------------------------------------------------
2cvfA           GGFAPGVLTQVYGPYASGKTTLALQTGLLSGKKVAYVDTEGGFSPERLV----QMAETRGLNPE-EALSR
1av6A           ----------------------------------------------------------------------
3dt7A           NPEGKKKYLAAAFPSACGKTNLAMMNPTLPGW-KVECVGDDIAWMKFDAQGNLRAINPENGFFGVAPGTS
2a30A           -----IKKISIEGNIAAGKSTFVNILKQCEDWEVVPEPVARWCNVQSTNVLQMMYEKPERWSFTFQACLS
3cnlA           LSFDRLARVLIVGVPNTGKST-IINKLKGKRAKGIQWFSLENGVKILDTPGILYKNIFSEDLAAKLLLVG
2bbsB           FKIERGQLLAVAGSTGAGKTSLLMMIMGELEP-------------SEGKIKHSGRISFCSQNSWIMPGTI
3bczC           --AGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIA-----PHAGYTYCGSCAAHAYKQVDPSITRRIF
1accA           DLNLVERRIAAVNPSTTKPDMTLKEALKIAFGFNEP----NGNLQYQGKDITEFDFNF------------
3cddD           IGITRS-----LEASGAFDLETYKFNDA------QYKAFIEPIKQGQACTVD-IGGERVITVDDWVPSYD
2ancF           ----QGTLYIVSAPSGAGKSSLIQALLKTQPDTQEAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARSIF
2aunB           ---------------------------------------------------------------------P
3bb1E           QEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYI
2d3wD           LDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIP
3cueF           --YDYLFKLLLIGNSGVGKSCLLLRFSDDYISTIGVD------FKIKTVELDGKTVKLQIWDTAGQERFR
3cr7B           -----GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRNENIRRIAE
1bglA           GLRCGTRELNYGPHQWRGDFQFNISRYSQQ--------QLMETSHRLLHAEEGTWLNIDGFHM--GIGGD
3bk7A           VEIRKGEVIGIVGPNGIGKTTFVKMLAGVEE-------------PTEGKVEWDLTVAYKPQYIKAEYEGT
2awnA           LDIHEGEFVVFVGPSGCGKSTLLRMIAGLET---------------------------------------
3cioD           ----------------------------------------------------------------------
3czjA           GLRCGTRELNYGPHQWRGDFQFNISRYSQ-----------------------------------------
3dlbB           --VEGLAVYRREHARGPGWRVL------------------GGAVLDLWVSDSGAFLLEVDPAYRILCEMS
2awoA           LDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLF----------IGEKRMNDTPPAERGVGMVFQS
1e4yA           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
1e9rD           MPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIIL------------
1e9sJ           MPRDAPRHLLVNGATGTGKSVLLRELAYTGLL-RGDRMVIVDPNGDMLSKFGRDKDII------------
3bb1A           QEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISP--FQSEGPRPVMVSRSRAGFTLNIIDTPGLIEGG
1e3aB           INWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGK--WDWKGLLPFEMNPKVYNPQSGYIANWNNSP
3d31A           LKVESGEYFVILGPTGAGKTLFLELIAGFHVPD-------SGRILLDGKDVTDLSPEKHDIAFVYQNYSL
3dfnA           ----------------------------------------------------------------------
3bpbA           YAKALEQHNAYIRALQTCDVDITLLPPD--------ERFPDSVFVEDPVLCTSRCAIITRPGAESRRGET
2c4rL           ---------LPEGMGLIVRTAGVGKSAEALQWDLSFRLKHWEAI----KKAAESRPAPFLIHQESNVIVR
3d3qA           ----------------------------------------------------------------------
2c0bL           -RIELKEALASLELPLIVRTAGVGKSAEALQWDLSFRLKHWEAIK-----KAAESRPAPFLIHQESNV--
1e9sB           MPRDAPRHLLVNGATGTGKSVLLRELAY-TGLLRGDRMVIVDPN----GDMLSKFGRDKDIILNPYDQRT
1cr0A           LGARGGEVIMVTSGSGMG-------------KSTFVRQQALQWGTAMGKKVGLAMLE--------ESVEE
3dfqA           ----------------------------------------------------------------------
2c7cH           KFENMGA--QMVKEVAAGDGTTTATVLAQAIITEGLKAVKRGIDKAVTAAVEELKALSVPCSDSKAQVGT
1aldA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
1e9dA           ----RGALIVLEGVDRAGKSTQSRKLVEALCAAG-------HRAELLRFPERSTEIGKLLSSYLQKKSDV
1e9sI           MPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDM-----LSKFGRDKDIILNPYDQRT
1cjaA           LLMELVRGITLNKLTTTSAPEVLTKSTMQQLGSLMALDVIVNNSDRLPIAWTNEGNLDNIMLSERGATVV
3b9qA           LGFRKPAVIMIVGVNGGGK---------------------------------------------------
6aldA           ----------------------------------------------------------------------
2d7vA           VESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSK-----PTLQQLEKHHLAHENCFIANSV-----
1d6jA           LRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDR-------------RVHAYRLDGDNIRFGLNKDLGFS
1cr1A           LGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLK
3dyoA           C---GTRELNYGPHQWRGDFQFQQLMETSHRAEEGTWLNIDGFHMGGGDDSWSPSVSAEFQLSAGRYHY-
1dekB           ----------LSGVKRSGKDTTADFIMSNYS-------------AVKYQLAGPIKDALAYAWGVFAA-NT
1ai4B           INWYYADVNGNIGYVHTGAYPDRQSGHDPRLMNPKVYNPQSGYIANWNNSPQKDYPASDLFAFLWGGADR
2bhvD           ---------------------------------------------------------LLRTITADKM-IP
1dhiA           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1e2hB           --MPTLLRVYIDGPHGMGKTTTTQLLVADDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGEISAGDA
2d7vB           VESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKP-----TLQQLEKHHLAHENCFIANSV-----
3dfoD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
3bb1F           QEDVNSLTILVMGKGGVGKSS----TVNSIIGERVVSISPFQSEGPRPVMVSRSRAGFTLNIIDTPGLIE
3cmwC           --LPMGRIVEIYGPESSGKTTLTLQVIAAAQRE-------GKTCAFIDAEHPIYARKLGVDIDNLLCSQ-
2ck3C           VPIGRGQRELIIGDRQTGKTSIAIDTIINQ-------------KRFNDGTDEKKKLYCIYVAIGQK----
3c8uA           PRQPGRQLVALSGAPGSGKSTLSNPLAAALSA-QGLPAEVVPDG------FHLDNRLLEPRGLLPRKGAP
3cbnA           ------------------------------------------------PNVTAGHRTTFEVTVDPEI---
3dftC           ----------------------------------------------------------------------
2d4hB           AITQPMVVVAIVGLYRTGKSYLMNWMWCVPHP-KKPGHILVLLDTEGLGQNDSWIFALAVLLSSTFVYNS
3dftD           ----------------------------------------------------------------------
2dr3F           GGIPERNVVLLSGGPGTGKTIFSQQFLWNGKMGEP---GIYVALEEHPVQVRQNMAQFGWD---------
1dvrA           ---SESIRMVLIGPPGAGKGTQAPNLQERFH-------AAHLATGDMLRSQIAKGTQLGLEAKKIMDQGV
1d8jA           ----------------------------------------------------------------------
3a00A           ----------ISGPSGTGKSTLLKKLFAEYPDS-------FGFSVSSTTRTPRAGEVNGKDYNFVSVDEF
1e2kA           ----TLLRVYIDGPHGMGKTTTTQLLVADDIV--YVPEPMTYWRVLGASETIANIYTTQHRLDQGEISA-
2bkeA           AGGIETRTTEFFGEFGSGKTQ--------------LCHQLSVNVQLPPEKGGLSGKAVYIDTEGTFRWER
3cmtD           GGLPMGRIVEIYGPESSGKTTLTLQVIAAAQRE-------GKTCAFIDAEHALDARKLGVDIDNLLCSQP
1dp0A           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
2b8wB           AITQPMVVVAIVGLYRTGKSY-----LMNKLAGKKKGFSLGSTVQSHTKGIWMWCVPHPKKPGHILVLLD
2boeX           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sH           MPRDAPRHLLVNGATGTGKSVLLRELAYTG----------------------------------------
3dhwC           LHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSV-----LVDGQELTTLSESELTKARRQIGMIFQH
3dfnC           ----------------------------------------------------------------------
2d3wC           LDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIP
3ed8A           EYNFNSHNVYITATRGTQKNGIKANFTVHNVED--------GSVQLADHYQQNTGDGPVLLPDNHYLSYQ
1ckvA           QVVHESDTVVLVLKKSDEINTFIEEILLTDYVEDRAGYWWIKANGKIEVDCDEISELLGRQFNVYDFLVD
3bb1C           QEDVNSLTILVMGKGGVGKSST----VNSIIGERVVSISPFQSEGPRPVMVSRSRAGFTLNIIDTPGLIE
1e9rF           MPRDAPRHLLVNGATGTGKSVLLRELAYGLLRG--------DRMVIVDPNGDMLSKFGR-----------
3be4A           --NSKKHNLILIGAPGSGKGTQCEFIKKEYGLAHLS--TGDMLREAIKNGIGLEAKSIIESGNFVGDEIV
2a1fF           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
3bwdD           -----FIKCVTVGDGAVGKTCLLISYTSNTFPFS-------ANVVLGLWDTAGEDYNRLRPLS--YRGAD
2dr3D           GGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKM-------GEPGIYVALEEHPVQVRQNM----------
2bbtB           FKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQNSWIMPGTIKEN----------
2drcA           ----------------------------------------------------------------------
3cmvE           GGLPMGRIVEIYGPESSGKTTLTL-QVIAAAQREGKTCAFIDAEHA-----LDPIYARKLGVDIDNLLCS
2dr3C           ------------RRVKTGIPGVDEILHGGIPER---NVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYV
2bhvA           ---------------------------------------------------------LLRTITADKM-IP
3cnnA           LSFDRLARVLIVGVPNTGKSTIINKLKGKRAGIQWF--SLENGVKILDTPGILYKNIFSEDLAAKLLLVG
3dfnD           ----------------------------------------------------------------------
2d2eA           LVVPKGEVHALMGPNGAGKSTLGK-ILAGDPEYTVERGEILLDGENILELSPDERARKGLFLAFQYPVVP
3cm0A           -----GQAVIFLGPPGAGKGTQASRLAQLGFKKLSTGDIL----RDHVARGTPLGERVRPIMERGDLDDL
1bmfC           VPIGRGQRELIIGDRQTGKTSIAIDTIINQK-------------RFNDGTDEKKKLYCIYVAIGQKRST-
1akeA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1d2zD           NRLPPDQDEWKTSGKLNERPTVGVLLQLLVQLFSAADFVALDF---------------------------
1e2gA           ----RGALIVLEGVDRAGKSTQSRKLVEALCAAG-------HRAELLRFPERSTEIGKLLSSYLQKKSDV
3bjdB           ----------------------------------------------------------------------
3b85B           DAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSR------------IILTRPAVEAGEKLGFLPDPY
1e9sL           MPRDAPRHLLVNGATGTGKSVLLRELAYTGLL-RGDRMVIVDP---------------------------
3dm9B           IRKAEKPYVIFVGFNGSGKTTTIAKLANWLKN-------HGFSVVIAASDT-----------------FR
1cs4C           -----THRLLLLGAGESGKSTIVKQMRILHVG-EKATKVQDIKNN-LKEAIETIVAAMSNL---------
3bb1G           QEDVNSLTILVMGKGGVGKS--------------------------------------------------
2dpyB           LTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADV-------IVVGLIGERGREVKDFI------------
2dflA           GGIETRTMTEFFGEFGSGKTQLCHQLSVNVQLPPEKGGLSGKAVYIDTEGTFRWERIE------------
2awoD           LDIHEGEFVVFVGPSGCGKSTL------------------------------------------------
1ak2A           -----GVRAVLLGPPGAGKGTQAPLAKNFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVL
1e59A           --VRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLDELDQ
1cjtC           ----------------------------------------------------------------------
1c9kC           ----------VTGGARSGKSRHAEALIGDAPQ--------VLYIATSQILHHKDGRPAHWRTARHLDTLI
2c9oA           SKKMAGRAVLLAGPPGT-----------------------------------------------------
3crmA           ---SLPPAIFLMGPTAAGKTDLAMALADALPCE-------LISVDSALIYRGMDIGTAKPS---RELLAR
1afrA           HSMPPQKIEIFKSLDNWAEENILVHLKP------------------------------------------
1b0uA           LQARAGDVISIIGSSGSGKSTFLRCINFLEKEGAIIVNGQNINLVRDKDGQLKVADKNQLRLLRTRLTMV
1e2mB           ----TLLRVYIDGPHGMGKTTTTQLLVASRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGEISAG
1e9rG           MPRDAPRHLLVNGATGTGKSVLLRELAY------------------------------------------
2bbtA           FKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQNSWIMPGTIKEN----------
3cqcA           VKIPQDSIAEIYLPAEDDN---------------------------------------------------
1e2lB           ----TLLRVYIDGPHGMGKTTTTQLLVAGSRDDIVYVPEPMTYWRVLGASET------------------
3b55A           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
3cmvB           GGLPMGRIVEIYGPESSGKTTLTLQVIAAAQ---------------------------------------
1e9sM           MPRDAPRHLLVNGATGTGKSVLLRELAY------------------------------------------
2cdnA           ---GSHMRVLLLGPPGAGKGTQAVKLAEGIPQISTGELFRRNIEEGTKL-----GVEAKRYLDAGDLVPS
2a1fD           ----------------------------------------------------------------------
3dmdA           RKAEKPYVIMFVGFNGSGK---------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
1e3mA           ---------------LVNLAERAYTLNYCPTFIDKPGIRITEGRH----PVVEQVLNEPFIANPLNLSPQ
2czvB           ----------------------------------------------------------------------
3dm5B           EIKEKPTILLMVGIQGSGKTTT------------------------------------------------
2dpyA           LTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADV-------IVVGLIGERGREVKDFI------------
2a78A           ----------MVGSGGVGKSALTLQFMYDEFVEDYEP--TKADSYRKKVVLDGEEVQIDILDTAGQEDYA
2d2fA           LVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLDGENILELSPDERARKGLFLAFQYPVEVP
1e9sA           MPRDAPRHLLVNGATGTGKSVLLRELAY-------TGLLRGDRMVIVDPNGDMLSKFGRDK---------
2d4uB           ----------------------------------------------------------------------
2bjbA           EPGPGARV--DCGLAG----TVLRFVPPLAALG-SVPVTFDGDQGRPIAPLLDALRELGVAVDGTGLPFR
2aexA           ----------------------------------------------------------------------
3d3qB           -----PFLIVIVGPTASGKTELSIEVAKKFNGEIIS--GDSQVYQGDIGTAKVTTEEEGIPHYIDILPPD
5dfrA           ----------------------------------------------------------------------
3e70C           RKAEKPYVIMFVGFNGSGK---------------------------------------------------
1dekA           ----------LSGVKRSGKDTTADFIMSNYSA-------VKYQLAGPIKDALAYAWGVFAANTDYPLTRK
3dffA           --------------------------------------------------------NVLVYTVFAGAAPP
3do6A           NHEDGKLILVTATPAGEGKTTTSIGLSSLNRIGK------------------------------------
3e8aC           -----THRLLLLGAGESGKSTIVKQMRILHVNG-------EKATKVQDIKNNLKEAI-------------
3ec1A           NRYREGGDVYVVGCTNVGKSTFINRIIEEATG-KGNVITTSYFPG-TTLDMIEIPLESGATLYDTPGIIN
3dauA           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
3cd9A           YNCESNVYIMADKQKNGIKANFKTRHNIDGSVQLADHYQQNTPIG---DGPVLLPDNHYLSTCSA-----
1e4vA           ----------------------------------------------------------------------
3a00B           ----------ISGPSGTGKSTLLKKLFAEYPD-------------SFGFSVSSTTRTP-------RAGEV
3dfoC           ----------------------------------------------------------------------
3cphA           ----------LIGDSGVGKSCLLVRFV--EDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQERF
3bb1H           QEDVNSLTILVMGKGGVGKSSTVNSIIGERV---------------------------------------
3c15C           --YRATHRLLLLGAGESGKSTIVKQMRILHV---------------------------------------
1e9sE           MPRDAEPHLLVNGATGTGKSVLLRELAY-TGLLRGDRMVIVD-PNGDMLSKFGRDKDIILNPYDQRTK--
2bwjB           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
1e1qB           VPIGRGQRELIIGDRQTGKTSIAIDTII------------------------------------------
2b0lC           ----------------------------------------------------------------------
1e9rB           MPRDAPRHLLVNGATGTGKSVLLRELAY-------TGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQ
3bb1D           QEDVNSLTILVMGKGGVGKSSTVNSIIGERV---------------------------------------
1chdA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
1ek0A           ----------LLGEAAVGKSSIVLRFVSDFAENKE---PTIGAAFLTQRVTINEHTVKFEIWDTAGQERF
3brwA           LDTALGHLVFSLKYDVIGDQEHLRLLLRTKCRTYHDVIPISCLTEFPNVVQMAKLVCEDVNVDRFYPVLY
1e2kB           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
2ancD           -----GTLYIVSAPSGAGKSSLIQAL--------------------------------------------
2aunA           ----------------------------------------------------------------------
1agpA           ----------VVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAM
3c7kA           ----------------------------------------------------------------------
2b8tD           -----GWIEFITGPMFAGKTAELIRRLHRL----------------------------------------
2anbA           ----QGTLYIVSAPSGAGKSSL------------------------------------------------
1cjuC           -----THRLLLLGAGESGKSTIVKQMRILHVNGE------------------------------------
1azsC           --YRATHRLLLLGAGESGKSTI------------------------------------------------
2ancB           ----QGTLYIVSAPSGAGKSSLI-----------------------------------------------
1e2nB           ----TLLRVYIDGPHGMGKTTTTQLLVASRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGEISAG
2bhvC           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
1e2jA           ----TLLRVYIDGPHGMGKTTTTQLLRDDIV-------YVPEPMTYWRVLGAETIANIYTTQHRLDQGEI
3dofB           ----------------------------------------------------------------------
3dvlD           --LPIGRSTLVSGTSGTGKTLFSIQFLYNGII-EFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVD---
1e2lA           --MPTLLRVYIDGPHGMGKTTTTQLLDIYVPEPMTYWRVLGASETIANIFTTQHRLDQGEI--SAGDAAV
2axnA           CGPNSPTVIVMVGLPARGKTYI------------------------------------------------
1cjvC           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
3dkvA           ----------LMGLPGAGKGTQAERIVEKYGIPH---ISTGDMFRAAMKEETPLGLEAKS----------
2an9A           ----QGTLYIVSAPSGAGKSSL------------------------------------------------
2c1lA           EHINQGGRVIAILGGSTSQRLSSRQVVEELLNRGVEVHIINRKRILKLYGTSNNLGESLVVSSGMSQNIE
2dwuB           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
1bifA           -----PTLIVMVGLPARGKTYISKKLTRYLNFIG-------VPTREFNVGQYRR----------------
2c03A           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
2ccgA           ----------FEGPEGSGKTTVINEVYHLVKDY--------DVIMTREPGGVPTGEEIRKI---------
2dr3A           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
2bdtA           ------KLYIITGPAGVGKSTTCKRLAAQLDNSAYIEGDIINHVVGGYSDELLALTWKNITDLTVNFLLA
2axzC           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
4dcgA           LQRHGILDGATVVYIGSAPGTHIRYLRDHFYN-LGVIIKWMLINGLRDVTLVTRFVDEEYLRSIKKQLHP
2ccjB           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
3cr7D           ----RGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAY-RLDGDNIRFGLNKDLGFSEADRNENIRRIA
3cr7C           ----------------------------------------------------------------------
2axpA           ----------LEGPDCCFKSTVAAKLSKKYPIIKGSSFELAKSGNEKLFEHFNKLADEDNVIIDRFVYSN
2a2zA           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2cckA           ----------FEGPEGSGKTTVINEVYHLVKDY--------DVIMTREPGGVPTGEEI------------
1e98A           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
1av6A           -----ILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVT----------LV
2a30A           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
3cioD           METENNILMITGATPDSGKTFVSSTLAAVIAQSDQK--VLFIDADLRRGYSHNLFTVSNEHGLSEYLAGK
3dlbB           ----------------------------------------------------------------------
1e4yA           ----------LLGALVAGKGTQAQFIMEKYGIP-------QISTGDMLRAAVKSGSELGKQ---------
2d0kA           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
3d3qA           -----PFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVYQGDIGTAKVTTEEEGIPHYIDILPPDAS
1e9sB           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
1e3mB           ----------------------------------------YTCPTFIDKPGIRITEVVEQVLNEPFIANP
2bwjA           EDLRKCKIIFIIGGPGSGKGTQCEKLVEGFTHLSTGELL---REELASES--ERSKLIRDIMERGDLVP-
2d7vB           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
1dp0A           GLRCGTRELNYGPHQWRGDFQFNISRYS--------QQQLMETSHRLLHAEEGTWLNIDGFHM--GIGGD
1draA           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
1akeA           ----------LLGAPGAGKGTQAQF----IMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVT
1culC           -----THRLLLLGAGESGKSTIVKQMRILHVG-EKATKVQDIKNN-LKEAIETIVAAMSNLVPPVELAN-
1e2gA           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
1cjtC           -----THRLLLLGAGESGKSTIVKQMRIHVGEKATKVQDIKNNLKEAIETIVAAMSNLVPP---------
1c9kC           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
1e2iA           --MPTLLRVYIDGPHGMGKTDDIVYVPETYWRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQIT
1e3mA           ----------------------------------------------------------------------
2czvB           ----------SIKFNEEVDKEKLREARKEYG--KVAILLSNPKPSLVRDTVQKFKSYLIYVESNDLRVIR
2dpyA           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1e2iB           ----TLLRVYIDGPHGMGKTTTTQLLVA---------LGSRDDIVYVPEPMTYWRVLGA-----------
3c14C           -----THRLLLLGAGESGKSTIVKQMRILHVNGE------------------------------------
1e4vA           ----------LLGAPVAGKGTQAQFIMEKYGIPQIST----------GDMLRAAVKSGSELGKQAKDIMD
3a00B           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2bwjB           EDLRKCKIIFIIGGPGSGKGTQCEKLVEGFTHLSTGEL--------------------------------
3bjqB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
1eamA           -QRHGILDGATVVYIGSAPGT-------------HIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDV
1adoA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
2bwjD           --LRKCKIIFIIGGPGSGKGTQCEKLVEGFTHLSTGEL--------------------------------
1e2jA           ----------------------------------------------------------------------
3cmuA           --LPMGRIVEIYGPESSGKTTLTLQVIA-------AAQREGKTCAFIDAEHALYARKLGVD---------


                         .         .         .         .         *         .         .:420
query           VSTTVRNVILSGYFDSIGIYQAVSDRQRKLAQQWLDILGIDKRTADAPFHSLSWGQQRLALIVRALVKHP
3cmvG           PDTGEQALEICDALARSGAVDVI------VVDSVAALTPKAEI-EGLAARMMSQAMRKLAGNLKQSNTLL
3cmvA           ARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPLAARMMSQAMRKLAGNLKQSNT
3czpB           FDRSWYGRV-LVERIEGFCAPADWLRAYGEINDFEEQLSEYGIIVVKFWLAIDKQTQER-FKEREKTPYK
3cmvC           KLGVDIDNLLCSQPDTGEQALEICDALARSGA--VDVIVVDSVAAPLAARMMSQAMRKLAGNLKQ--SNT
3b5jA           --SIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTI-VGEQGAGLSGGQRQRIAIARALVNNP
3dmdC           EEHAKRIGVKVIKHS--------YGADPAAVAYDAIQHAKARGIDVVL-IDTAGRSETNRNLMDEMKKIA
2dwoA           -EAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEG-GQIAVFDATNTTRERRHMILHFAKEN
2c03B           EQLRLLGEKVGVPVL---EVMDGESPESIRRRVEEKARLEAR---DLILVDTAGRLQIDEPLMGELARLK
3dm5A           -----------LLDRYHIEVFGNPQEKDAIKLAKEGVDYFKSKGVDIIIVDTAGRHKEDKALIEEMKQIS
2d3wB           NQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEP
1d1cA           RFGKFIEIQFNNAGFISGASIQ---SYLLEKSRVVFQSETERN--YHIFYQLLAGATAEEKKALHLAGPE
3b60A           DTVANNIAYARTEEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENGVL-LSGGQQRIA-IARALLRDS
2bifA           -DMVKTYKSFEFFLPDNEEGLKIRKQCALAALNDVRKFLSEEG-GHVAVFDATNTTRERRAMIFNFGEQN
2akaA           NNSSRFGKFIEIQFNSAGFISGASIQSYLLEKSRVVFQSETERNYHIFYQLLAGATAEEKKALHLAGPES
3cmvH           PDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEG-EIGDSHMGLAARMMSQAMRKLAGNLKQSNT
3c95A           DRAAMKIVL-------ETEPRNLPALDITFVDKRIEKLLFNYR-ARNFPGTLDYAEQQRWLEHRRQVFTP
1aroP           AINIAQNTAVLAVANVITKWVYRKDKAKSRRISLEFMLEQANKFANHKAYNMDWRGYAVSMFNPQGND-M
2c04A           ------------------VLEVMDGESPESIRRRVEEKARLEA-RDLILVDTAGRLQIDEPLMGELARLK
3eiuA           --VVFLNLADDPAVERVILTDITNYAEALRQMGPGYMYTDLAT-LYERAGIVKGAKGSVTQIPILSMPGD
2dwpA           -EAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEG-GQIAVFDATNTTRERRHMILHFAKEN
3czpA           IFDRSWYGRVLVERIEGFCAPADWLRAYGEINDFEEQLSEYGIIVVKFWLAIDKQTQER-FKEREKTPYK
1bifA           ----------------------------------------------------------------------
3b2qA           --AVVFLNLADDPAVERIV----TPRMALTAAEYLAYEHGMHVLVILTDITNYAEALRQMGAARN---EV
2c03A           EQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEA------RDLILVDTAGRLQIDEPLMGELARLK
3dmdB           EEHAKRIGVKVIKHSYG--------ADPAAVAYDAIQHAKARGIDVVL-IDTAGRSETNRNLMDEMKKIA
2c61B           -AVVFLNLADDPAVERILTDITNYAEALRQMGYPGYMYTDLAT-LYERAGIVKGAKGSVTQIPILSMPGD
1e9sF           --WSFFNEIR------NDYDWQRYALSVVPRG-------------------KTDEAEEWASYGRLLLRET
1bg0A           IISTRVRCGRSLQGYPFNPCLTAEQYKEEKVSSTLSSMEDELKGTYYPLTGMSKATQQQLIDDHFLFKEG
2czvA           YSIEK----GVDAIISPWVNRKDPGIDHVLAKLMVKKNVALGF-SLRPLLYSNPYERMMKAWKLVEKYKV
1e69A           GQGQIDRIVNAYQRVNESFNRFISLLFFGGEGRLEISIRKPGR-RDQKLSLLSGGEALVGLFALMEIKPS
3b85A           RDVEPEVIPKLEAGIVEVAPLAYRGRTLNDAFVILDEA---QNTTPAQKFLTRLGFGSKVVTGDGLRLVR
2bbsA           -------GTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEK-DNIVLITLSGGQRARISLARAVYKDA
2bc9A           WCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMD-QLYYVTELT
3bo6B           FSVDSPIDKWKVTDMERVDQQ-----SRVAVGAQFTLYVKPDQENSQYSASSLHNTRQFIECLESRLSES
2a5gA           HYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIR
2ccgB           LFAASRREHL--------------VLKVIPALKEGKVVLCDRY-IDSSLAYQGYARGIGVEEVRALNEFA
2akaB           LEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMT-KVPVGDQPPDIEFQIRDMLMQFVTKE
2ctsA           --PLPEGLFWLLVTGQIPTEEQVSWLSKEWAKRAALPSHVVTM-LDNFPTNLHPMSQLSAAITALNSESN
3bgwD           AGSINAQKIKAARRDFASEDWGKLSMAIGEISNSNINIFDKAGQSVNYIWSKTRQTKRKNPGKRVIVMID
3eiuB           --VVFLNLADVLVILTDITNYAEALRQMGAAGYPGYMYTDLAT-LYERAGIVKGAKGSVTQIPILSMPGD
2ccgA           ----------------------------------------------------------------------
2dr3A           -------------AQFGWDVKPYEEKGMFAMVDAFTAGIGKEYEKYIVHDLTDIREFIEVLRQAIRDINA
1e9sG           -GWSFFNEIRND-----------YDWQRYALSVVP--------------RGKTDEAEEWASYGRLLLRET
1e9rA           --WSFFNEIRNDYDWQRYALSVVPRGKTDEAEEW------ASYGRLLLRETAKKLALIGTPSMRELFHWT
2b8wA           -VEKGDNQNDSWIFALAVLLSSTFVYNSIMDQLYYVTELTHRI-RSKSVSFFPDFVWTLRDFSLDLEADG
3a1wA           SIDEKIARDYLLK-----GDADLVILVADSVNPEQSLYLLLEILEMEKKVILAMTAIDEAKKIDRYELQK
1e0jA           HNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAE-AETDRLLAKLAYMRSGLGCDVIILDH
2c61A           RAVVFLNLADDPA-----VERIVTPRMALTAAEYLAYEHGMHVLVILTDITNYAEALRQMGAARNEVPGR
3da4A           ITLKTEGTLTISANGSWTYNGVVRSYDDKYDFNASTHRGIIGESLTRLGAMFSGKEYQILLPGEIHIKES
1e0jB           HNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAE-AETDRLLAKLAYMRSGLGCDVIILDH
2d62A           --HTVYDNIAFPLKLRKVPKQEIDKRVREVAELGLTEL------LNRKPRELSGGQRQRVALGRAII-RR
2awnC           -------------------------VINQRVNQVAEVLQLAHL-LDRKPKALSGGQRQRVAIGRTLVAEP
3b2qB           -AVVFLNLADDPAVERIDITNYAEALRQMGRGYPGYMYTDLAT-LYERAGIVKGAKGSVTQIPILSMPGD
2bkiA           NSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERN-YHIFYRLCAGASEDIRERLHLSSPDN
3cr7A           EVAKLFADSNSIAITSFISPY---RKDRDTARQLHEVTGLPRDPKGLYKKAREGVIKEFTGISAPYEAPN
2bdtA           ----------------------------------------------------------------------
2axzC           -------------------------YDKRTTFFGIDYEIVSNL-LNVLPYEEVSSIIKPYPIVDSFGKDY
3dt2A           VKTNPN------AIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPGVTITSWKNKEWRPQDEEPCAHPNS
2d4hA           E--NQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSPDESADFVSFFPDFVWTL
1cr4A           AEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKL-AYMRSGLGC
2bkhA           NSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERN-YHIFYRLCAGASDIRERLHLSSPDNF
2c9oC           -ETKKKEIIQDVTLHDLDVAGE--INKVVNKYIDQGIAELVPGVLFVDEVH-MLDIECFTYLHRALESSI
4dcgA           ----------------------------------------------------------------------
2awnB           YALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHL-LDRKPKALSGGQRQRVAIGRTLVAEP
2ccjB           LFAASRREHLVLKVIPALKEGKVVLCDRYI---------------DSSLAYQGYARGIGVEEVRALNEFA
3d3kA           PNFVKMLESITNELSLFSKTQGQQVSSLKDLPTSPVDLVINCL-DCPENVFLRDQPWYKAAVAWANQNRA
1dkiA           FAAISTRQYNWNNILPTYSGRESNVQKMAISELMADVGISVDMDYGPSSGSAGSSRVQRALKENFGYNQS
3d7wA           SGTTSSS-----------QPFNGSYPDLERYAGHRDQIPLGIDQLIQSVTALRFPGQTKTQARSILIL--
3dtbB           VAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPGVTITSWKNKEWRPQDEEPCAHPNS
2a2zD           LSRIRAQLASLNEKPVLFFERSVYSDRYIFASNLYESECMNET----EWTIYQDWHDWMNNQFGQSLELD
1e9sD           -----------RDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRET
3dt4A           PGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPGVTI--TSWKNKEWRPQDEEPCAHPNS
2a5jA           YRGAAGALL-----VYDITRRETFNHLTSWLEDARQHSSSNMV-IMLIGNKSDLESRRDVKREEGEAFAR
1e2dA           KSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDL
3cr7D           ----------------------------------------------------------------------
3cr7C           ---EVAKLFADSNSIAITSFISPYRKDRDTARQLHEVTGLPRDPKGLYKKAREGVIKEFTGISAPYE-AP
2c9gA           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2a2zA           FQTYACLSR-------IRAQLASLNGKEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWM
2d4uA           STVAELMES---ASISLKQAEKNWADYEALPRDPRQSTAAAA-EIKRNYDIYHNALAELIQLLGAGKINE
1cr2A           ----------------------REIIENGKFDQWFDELFGNDTFHLYDSFEAETDRLLAKLAYMRSGLGC
421pA           RDQYMRTGEGFLCVFAINNTKSFEDIHQY-REQIKRVKDSDDV-PMVLVGNKCDLAARTVESRQAQDLAR
1e9fA           EDHSVHLLFSANRW-----EQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPD
1e9cA           EDHSVHLLFSANRW-----EQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAKENFSLDWCKQPDVGLPKPD
2awnD           EPLSNLDAA---LRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYP
2cckB           FAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSA
1dg3A           DS--WIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSDSADFVSFFPDFVWTLRDFSLDL
1e6cA           AVATPNRVVATGGGMVLLEQNRQFMRAHGTVVYLFAPAALRLQASLQAHQRPTLTGRPIAEEMEAVLRER
3bh0A           KAA--------RRDFASEDWGKLSMAIGEISNSNINIFDKAGQSVNYIWSKTRQTKRKNP-GKRVIVMID
2dftA           AALADHDGVLSLGGGAVTSPGVRAALAG--HTVVYLEISAAEGVRRTGGNDRAEKYRALMAKRAPLYRRV
3dt4C           V---KTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPGV---TITSWKNKEWRPQDEEPCAHPNS
2cgtH           --ETVGKLIAEA----MDKVGKEGVITVEDGTGLQDELDVVEG-MQFDRGYLSPYFINKPETGAVELESP
1e9rE           -------------------YDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWAS-YGRLLLRET
2b8tA           PEILNYIMSNSFNDETKVIGIDRICEVANILAENGFVVIISGL-DKNFKGEPFGPIAKLFTYADKI----
2cjwB           --SITDRASFEK----ASELRIQLRRARQTEDIPIILVGNKSDLVRRE-VSVSEGRAAVVFDCKFIETSA
2b8tB           KV----------IGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFGPIAKLFTYADKITKLT
1d6jB           VAKLFADSNSIAITSFISPY----RKDRDTARQLHEVATPGEETGLPFVEVYVDVPVEVAEQ-RAPYEAP
3adkA           TVLDMLRDAMVAKVDTSKGFL-----IDGYPREVKQGEEFERK-IGQPTLLLYVDAGPETMTKRLLKRGE
2ahwD           --LAEQNKIIAYNYPQGVLTQTL--RAAAAHQPGIISDIGIGTFVDPRQQGGKLNEVTKEDLIKLVEFDN
2cckA           ----------------------------------------------------------------------
3bgwA           LIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNSNINI--FDKAGQSVNYIWSKTRQTKRKNPGKR
1e98A           EDHSVHL----LFSANRWEQVPLIKEKLSQGVTLVVDRYAFSG-VAFTGAKENFSLDWCKQPDVGLPKPD
2ahvA           --LAEQNKIIAYNYPQGVLTQTLRAAAAHQ-PGIISDIGIGTF-VDPRQQGGKLNEVTKEDLIKLVEFDN
3cmxA           --DTGEQALEICVVDSVAALTPKEARMMSQAMRKLAGNLKQSNTLLIFINQIRNPETTTGGNALKFYASV
3di4A           GWYGIDQYGGSVHDVIGTRCDPYTGNLLAGGHYHHCCHSNLTRALADHTGLPLHEAELLNVFCTGFTRDT
2a30D           SRIRAQLASLNG----KPVLFFERSVYSDRYIFASNLYESECM-NETEWTIYQDWHDWMNNQFGQSLELD
1cfrA           LSETNFIVVKMPNATSFDVMSIYKSCLSEFIYDLRSKLSLNN------VNLITSNPDFSIIDIRGRREEL
2dr3E           ---------------------------MFAMVDAFTAGIGKEYEKYIVHDLTDIREFIEVLRQAIRDINA
2b8tC           SNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEP--FGPIAKLFTYADKITKLT
2dr3B           ------------------------PYEEKGMFAMVDAFTAGIGEKYIVHDLTDIREFIEVLRQAIRDINA
1e2fA           LLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGV-----------AFTGAKENFSLDWCKQPDVGLPKPD
3cddF           LLTSDTFGNLVITRASKTKAGVSLILGD--NVKAARGRFSWRQR-FSKFTIKAAGIKADVTDSEIGRYRP
3cddC           -SYDESTITISVSGRDKTADLVDCSIDYPIADIVCKPFGIKVIVNTDVGEPIEQGETPHELLARLAKQ-R
2eg5G           ---KIGSCLIGAMPGSFYSRLFPEESMHFLHSCYCLQWLSQVPSIGTNKGSIYSSKASRLPVQKAYLDQF
2c9yA           SDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLI
2awoC           SVAENMSFGLKLAGAK-------KEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVA-IGRTLVAEP
3clvA           VPLYYRGATCAIVVFDISNSNTLDRAKTWVNQLKIS------SNYIIILVANKIDKNFQVDILEVQKYAQ
1dhjA           ---------------------------ENAMPWNLPASLAWFK-RNTLDKPVIMGRHTWESIGRPLPGRK
3ch4B           RWGEEKRQADPGFFCRKIVIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEPGVDDAESECGLDNFGDF
1eilA           ---------------------------GYLGFAVKDVPAWDHF-LTKSVGLMAAGSAGDAALYRADQRAW
2a2zB           ACLSRIRAQLASLNGEKPVLFFERSVYSDRYIFASNLYESECM-NETEWTIYQDWHDWMNNQFGQSLELD
3bb1B           GGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPP
2a30B           RIRAQLASLNDAEKPVLFF----ERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELD
2b92B           GDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHSSFVSFFPDFVWTLRDFSLDL
2dftC           VVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGDRAEKYRALMAKRAPLYRRV
2d3wA           GVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRVGFSGGEKKRNDILQMAVLEP
2ausC           ------------------------DKRPIELHIQYGVINLDK-----PPGPTSHEVVAWIKRILNLEKAG
2cvfA           FILFTPSDFKEQRRVIGSLKKTVDSNFALVVVDSITAHYRAEENRSGLIAELSRQLQVLPVIVINQVHFD
1av6A           ----------------------------------------------------------------------
3dt7A           VKTNPN------AIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPGVTITSWKNKEWRPQDEEPCAHPNS
2a30A           RIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELD
3cnlA           SLPVERIEDQRIFERAFEIFARSIGIESSFSEFFEDF-------ARKRGLLKKGGVPDIERALMLFFTKA
2bbsB           K--------ENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDN-IVLGGITLSGGQRARISLARAVYKDA
3bczC           ILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGFERSLQTDEDEHSIEHLPYTAKAESHKD
1accA           -DQQTSQNIKNQLAE-------LNATNIYTVLDKIKLNAKMNILIRDK-RFHYDRNNIAVGADESVVKEA
3cddD           ESTSVSGRDKTADLVDCGQFNNQTLTQI--ADIVCKPFGIKVIVNTDVGIQIEQGETPHELLAR-LAKQR
2ancF           ILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSR
2aunB           IDGRVALIAPAS---------AIATEVLEATLRQLEVHGVDYHLGRARYRYLAGTVEQRLEDLHNAFDMP
3bb1E           NDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKL----VAKAITDSFGKGIWNKAIVALTHAQFSPP
2d3wD           GVSNQFFLQTALNAVRSYRGQETLDRFDFQDLIALLKMPEDLLT-RSVNVGFSGGEKKRNDILQMAVLEP
3cueF           TITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFAD
3cr7B           VAKLFADSN----SIAITSFISPYRKDRDTARQLHEVETGLPFVVDVPVEAEQRDPKGLYKKAREGVIKE
1bglA           DSWSPS----------------------------------------------------------------
3bk7A           V------------YELLSKIDSSKLNSNFYKTELLKPLGIIDL-YDRNVEDLSGGELQRVAIAATLLRDA
2awnA           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
3dlbB           LEAWLAQGHPLPKRVRNAYDRRTWELLRLGEEDPKELPLPGGLSLLDYHASKGRLQGREGGRVAWVADPK
2awoA           YALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHL-LDRKPKALSGGQRQRVAIGRTLVAEP
1e4yA           ----------------------------------------------------------------------
2d0kA           -------------SLIAALAVDRVIGNENALPWNLPADLAWFK-RNTLNKPVIYGRHTWESIGRPLPGRK
1e9rD           ------------------NPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRET
1e9sJ           ---LNPYDQRTKGWSFFNEIRNDYDWQRYALSVV--------------PRGKTDEAEEWASYGRLLLRET
3bb1A           ---YINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITSFGKGIWNKAIVALTHAQFSPP
1e3aB           QKDYPASDLFAFLWGGADRVTEIDRLLEQKPRLTADQAWDVIRTLQAATSGLTQSDPRRQLVETLTRWDG
3d31A           FPHMNV------KKNLEFGMRMKKIKDPKRVLDTARDLKIEHL-LDRNPLTLSGGEQQRVALARALVTNP
3dfnA           -----------------------------------------------HPALTPEQKKELSDIAHRIVAPG
3bpbA           EIIEETVQRFYPGKVERIEAPGTVEAGDIMMVGDHFYIGESAR-TNAEGARQMIAILEKHGLSGSVVRLE
2c4rL           --AFRDYLRQDIGEILIDNPKV-----LELARQHIAALGRPSSKIKLYTGEIPLFSHYQIESQIESAFQR
3d3qA           ----------------------------------------------------------------------
2c0bL           IVRAFRDYLRQDIGEI-LIDNPKVLELARQHIAALGRPDFSSK-IKLYTGEIPLFSHYQIESQIESAFQR
1e9sB           KGWSFFN-EIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRET-----AKKLALIGTPSMRELFHWT
1cr0A           TAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGC
3dfqA           -----------------------------------------------HPALTPEQKKELSDIAHRIVAPG
2c7cH           ISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEG-MQFDRGYLSPYFINKPETGAVELESP
1aldA           -------------------------------------------------ALTPEQKKELSDIAHRIVAPG
3dfqD           -----------------------------------------------HPALTPEQKKELSDIAHRIVAPG
1e9dA           EDHSVHL----LFSANRWEQVPLIKEKLSQGVTLVVDRYAFSG-VAYTGAKENFSLDWCKQPDVGLPKPD
1e9sI           KGWSFFNEIRNDYD-------------------------WQRYALSVVPRGKTDEAEEWASYGRLLLRET
1cjaA           PIDSKIIPLDASHPHGERVREL-----LRTLIAHPGHESSQFH---SIRDIITLYTGYDVGTEGSISMQE
3b9qA           ----------------------------------------------------------------------
6aldA           -------------------------------------------------ALTPEQKKELSDIAHRIVAPG
2d7vA           ----------------------------------------------------------------------
1d6jA           EADRNENIRRIAEVAKLFADS----NSIAITSFISPYRKDRDTARQLHEVATPGEETGLP-FVEVYVDVP
1cr1A           RE---------------------IIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGC
3dyoA           ----------------------------------------------------------------------
1dekB           DYPLTRKEFEGIDY-------------DRETNLNLTKLEVITIMEQAF-CYLNGKSPIKGVFVFDDE-GK
1ai4B           VTEIDRLLEQKPRLTADQAWD-----VIRQTSRQDLNLRLFLPTLQAATSGLTQSDPRRQLVETLTRWDG
2bhvD           AFLITPISSQIAGK----VIAQVESDIFAHMGKAVLIPKGSKVIGYYSNNNKMGEYRLDIVWSRIITPHG
1dhiA           ---------------------------ENAMPWNLPASLAWFK-RNTLDKPVIMGRHTWESIGRPLPGRK
1e3mB           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1e2hB           AVVMTSQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAAL-LCYPAARYLMGSMTPQAVLAF
2d7vB           ----------------------------------------------------------------------
3dfoD           -----------------------------------------------HPALTPEQKKELSDIAHRIVAPG
3dfpD           -----------------------------------------------HPALTPEQKKELSDIAHRIVAPG
3bb1F           GGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPP
3cmwC           -PDTGEQALEICDAL-----------ARSGA---VDVIVVDSVAALTPEIEGEIGDSHMGLAARMMSQAM
2ck3C           ----------------RSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKH
3c8uA           ETFDFEGFQRLCHALKHQVIYPLFDRARDIA--------------------IAGAAEVGP-ECRVAIIEG
3cbnA           ---GETDCIIGVSSSDSISTLPDEKRAIARESLVRVILRTENEIRGYGHPELTLDHPTDIVCRKSDYICS
3dftC           -----------------------------------------------HPALTPEQKKELSDIAHRIVAPG
2d4hB           IGTINQQAMDQLYYVTELTHRIRSKSSDSADFVSFFPDFVWTLRDFSLDLEADQPLTPDEYLTYSLKLKK
3dftD           -----------------------------------------------HPALTPEQKKELSDIAHRIVAPG
2dr3F           -----------------VKPYEEKGMFAMVDAFTAGIGKSKEYEKYIVHDLTDIREFIEVLRQAIRDINA
1dvrA           SDDIMVNMIKDELTNNPACNGFILVGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDELLVARITGRLI
1d8jA           ----------------------------KTRHQRGDTHPLTLDEILDETQHLDIGLQKQWLMTEALVNNP
3a00A           KSMIKNNEFIEWAQFSGNYYGSTVASVKQVSKSGKTCI--------------LDIDMQGVKSVKAIPELN
1e2kA           -----------------------GDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGPPPALTLIFDRHP
2bkeA           IENAKALGLDIDNVNNIYYIRAINTDHQIAIVDD-------------LQELVSKDPSIKLIVVDSVTSHF
3cmtD           ARSGAVDVIVVDSVAALTPKAEMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIKNPETTTGGNALKFYA
1dp0A           ---------------------------DKKQLLTPLRDQFTRAPLDNDIGVSEATRIDPN-AWVERWKAA
1draA           ---------------------------ENAMPWNLPAELAWFK-RNTLDKPVIMGRHTWESIGRPLPGRK
2b8wB           TEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTIN------QQAMDQLYYVTELTHRIRSKSSVSFF
2boeX           ---------------------------RDRIASVPQGTWFA----HHNPGQITGQVDALMSAAQAAGKIP
2bx2L           ---------------------------------------------KLYTGEIPLFSHYQIESQIESAFQR
2aumB           --GRVALIAPAS---------AIATEVLEATLRQLEVHGVDYHLVEARYRYLAGTVEQRLEDLHNAFDMP
2bofX           -------------------------SAAQAAGKIPILVVSNAPGRDCG-APSHSAYRSWIDEFAAGLKNR
2bhjA           ---LLPHAIEFINQYYGSFKEAKIEEHLARLEAVTKEIETTGT-YQLTLDELIFATKMAWRNAPRCIGRI
3dfpC           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
3dhwC           FNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELLSLVGLGDK-HDSYPSNLSGGQKQRVAIARALASNP
3dfnC           ---------------------------------------------HSHPALTPEQKKELSDIAHRIVAPG
2d3wC           GVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEP
3ed8A           ---TVLSKDPNEKRDHMVLLEFV-----------------------------------------------
1ckvA           --VSSTIGRAYT-----------LGNKFTITSE---LMGLDRKLEDY-----------------------
3bb1C           GGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPP
1e9rF           -----DKDIILNPYDQRTKGWSFFNEIRNDYD-------WQRYALSVVPRGKTDEAEEWASYGRLLLRET
3be4A           LGLVKEKFDLGVCVNGFVLDGFPRTIPQAEGLAKILSEIGDSLTDDSEIIERISGRCTHPASGRIYHVKY
2a1fF           ----------------------------------------------------SQPIYK-----RILLKLS
2bv7A           ----------------------------------------------------------------------
3bwdD           VFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFIDHAVPITTV-QGEELKKLI
2dr3D           -----------AQFGWDVKPYEEKGMFAMVDAFTAGIGKSKEYEKYIVHDLTDIREFIEVLRQAIRDINA
2bbtB           ------------IIGVSYDEYRYRSVIKACQLEEDISKFAEKD-NIVLGITLSGGQRARISLARAVYKDA
2drcA           ---------------------------ENAMPFNLPADLAWFK-RNTLDKPVIMGRHTWESIGRPLPGRK
3cmvE           QPDTGEQALEICLARSGAVDVIVVDSVAAL-------TPKAEI-EGLAARMMSQAMRKLAGNLKQSNTLL
2dr3C           ALEEHPVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGEYEKYIVHDL-TDIREFIEVLRQAIRDINA
2bhvA           AFLITPISSQIAG-----KVIAQVESDIFAHMGKAVLIPKGSKVIGYYSNNNKMGEYRDIVWSRIITPHG
3cnnA           SLPVERIEDQRIFERAFEIFARSIGIESSFSEFFEDF-------ARKRGLLKKGGVPDIERALMLFFTKA
3dfnD           ----------------------------------------------------------------------
2d2eA           GVTIANFLRLALQAKLGREVGVAEFWTKVKKALELLDWDESY-----LSRYLNEGEKKRNEILQLLVLEP
3cm0A           ILELIREELAERVIFDGFPRTL---AQAEALDRLLSETGT--RLLGVVLVEVPEEELVRRILRRAELEGR
1bmfC           -------------------VAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKH
1akeA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
1e2gA           EDHSVHL-----LFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPD
3bjdB           ------------------------DVATAQTRRWLARAIYRVE-ERFPAADLSRAEQEIA-AQSRERHPS
3b85B           LRPLHDALRDVEPEVIPKLEAG--IVEVAPLAYRGRTLNDAFVI-LDEAQNTTPAQKFL----TRLGFGS
1e9sL           ----------------------------------------------------------------------
3dm9B           AGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYD----AIQHAKARGIDVVLIDTAGRSETNRNLDEKKIA
1cs4C           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
2dflA           ------------NMAKALGLDIDNVMNNIYYIRAINTDHQIAI-VDDLQELVSKDPSIKLIVVDSVTSHF
2awoD           ----------------------------------------------------------------------
1ak2A           ELIEKNLETPPCKNGFLLDGFP-----RTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLL-IRRITGRLI
1e59A           AWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGF-AVTPPELTKDDERYPGHDPRYAKLSE
1cjtC           ----------------------------------------------------------------------
1c9kC           TADLAPDDAILLECITTMVTNLLFALGDPEQWDYAAMERAIDDEIQILI---AACQRCPAKVVLVTNEVG
2c9oA           ----------------------------------------------------------------------
3crmA           YPHRLIDIRDPAESYSAAEFRALAAMAKATARGRIPLLV---GGTMLYYKALLEGLPY-TVAQLAIAPEQ
1afrA           ----------------------------------------------------------------------
1b0uA           FQHFNLWSHMTVLENVMEAPIQSKHDARERALKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEP
1e2mB           DAAVVMTSAQITMGMPYAVTDAVLAPHIGGAGSPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAF
1e9rG           ----------------------------------------------------------------------
2bbtA           ------------IIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGGITLSGGQRARISLARAVYKDA
3cqcA           ----------------------------------------------------------------------
1e2lB           -IANIFTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIFDRHP--IA
3b55A           ------------------------------NTNQIAKWLEAHA-KPLKTTNPTASLNDL--KPLKNVGSA
2e85B           -----------------------------------------AAAPKGNWVVIDGGSAPENDIVARELRPT
3cmvB           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
2cdnA           D--LTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDA-VLEFRVSEEVLLERLKGRG
2a1fD           -------------------------------------------------------------YKRILLKLS
3dmdA           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3dymA           ------------------------------KKQLLTPLRDQFT-RAPLDNDIGVSEATRIDPNAWVWKAA
3dfqC           -----------------------------------------------HPALTPEQKKELSDIAHRIVAPG
1e3mA           --RRLIITGPNGGKSTYRQTA----LIALAYIGSYVPAQKVEI-GPIDRIFTRVGFVETETANILHNATE
2czvB           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2a78A           AIRDNYFRSGEGFLCVFSITEMESAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAE
2d2fA           GVTIANFLRLALQAKLGREVGVAEFWTKVKKALELLDWDESYLSRYLNEGFSGGEKKRNE-ILQLLVLEP
1e9sA           ----------------------------------------------------------------------
2d4uB           -------------------------DYEALPRDPRQSTAAAAE-IKRNYDIYHNALAELIQLLGAGKINE
2bjbA           VR--------------------GNGSLAGGTVAIDASASSQFVSGLLLSAASFTDGLTVQHTGSSLPSAP
2aexA           ----------------------------------------------------------------------
3d3qB           ASFSAYEFK--KRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYNYAFEDKKQVLKLKELEHLNNNKLHEY
5dfrA           ------------------------AVDRVIGPWNLPADLAWFK-RNTLDKPVIMGRHTWESIGRPLPGRK
3e70C           ----------------------------------------------------------------------
1dekA           EIDYDRETNLNLTKLEVITIMEQAFCYLNGGVFVFDDEGKESVNFVAFNKITDVINNIEDQWSVRRLMQA
3dffA           YSPAAQRHTIWGLA----PDDDAVLYRRKEDIAALDHLRVAHRHGRFLDSIYRKLPDGRWLTAHVEGRQK
3do6A           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
3ec1A           H--HQMAHFVDARDLKII---TPKREIHPRVYQLNEGQTLFFGGLARL-DYIKGGRRSFVCYMANELTVH
3dauA           ------------------------------MPWNLPADLAWFK-RNTLNKPVIMGRHTWESIGRPLPGRK
1e2iB           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
3cd9A           LSKDPNEKR-------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
3a00B           NGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQVSKSGKTCILDIDMQGVK-SVKAIPELN
3dfoC           -----------------------------------------------HPALTPEQKKELSDIAHRIVAPG
3cphA           RTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDMETRVVTADQGEALAK
3bb1H           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
1e9sE           -GWSFFNEI-------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
3bjqB           -------------------------------------------------------QARVVDP--------
2aumA           --GRVALIAPASAIA---------TEVLEATLRQLEVHGVDYHLVEARYRYLAGTVEQRLEDLHNAFDMP
1eamA           ----------------------------------------------------------------------
1adoA           -----------------------------------------------HPALTPEQKKELSDIAHRIVAPG
1e1qB           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
1e9rB           RTGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATF
3bb1D           ----------------------------------------------------------------------
1chdA           -----------------------------------------------------------------LLSSE
3d1mA           -------------------------------------------KTLGASGRYEGKITRNSERFKELNYNP
1ek0A           ASLAPYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQASKDIALVGNKIDLQEGGER------------
3brwA           PKA----------------------------SRLIVTFDEHVISNNFKFGVIYQKLGATSEEELFS-TNE
1e2kB           ----------------------------------------------------------------------
2a1fE           -------------------------------------------------------------YKRILLKLS
3bv4A           -------------------------------------------------ALTPEQKKELSDIAHRIVAPG
4dfrA           --------------------------------------------RNTLDKPVIMGRHTWESIGRPLPGRK
1dyhA           --------------------------------------------RNTLDKPVIMGRHTWESIGRPLPGRK
1e2nA           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
2aunA           ------------------------TEVLEATLRQLEVHGVDYHLVEARYRYLAGTVEQRLEDLHNAFDMP
1agpA           RDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVK--DSDDVPMVLVGNKCDLAARTVESRQAQDLAR
3c7kA           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
1e2nB           DAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPLTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAF
2bhvC           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
2c5mD           --------------------------------------------------------KSCGLHVTSIKIDP
2a1fC           ----------------------------------------------------SQPIYK-----RILLKLS
1drbA           ---------------------------ENAMPWNLPACLAWFK-RNTLDKPVIMGRHTWESIGRPLPGRK
1e2jA           SAGDAAVVMTSANITMGMPYAVTDAVLAPHIGGEAGSPPPALTLFDRHPIAALLCYPAARYLMGSMTPQA
3dofB           ----------------------------------------------------------------AVVGYL
3dvlD           -------------EGKLFILDASPDPEGQEVVGGFDLSALIERINYA---------IQKYRARRVSIDSV
1e2lA           VMTSAQITMGMP-------YAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQ
2axnA           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
2c1lA           ASLLLDNNTTQSNDMISEMLNQNWHIHNMTNATDASPGWNLLYDERTTNLTLDETERVTLIVTLGHADTA
2dwuB           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
1bifA           -DMVKTYKSFEFFLPDNEEGLKIRKQCALAALNDVRKFLSEEG-GHVAVFDATNTTRERRAMIFNFGEQN
2c03A           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
2ccgA           VLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRY-IDSSLAYQGYARGIGVEEVRALNEFA
2dr3A           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
2bdtA           QNDVVLDYIAFPDEAEALAQTVQAKVDDVEIRFI-----ILWTNREELLRRDALRKKGERCLELVE--EF
2axzC           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
4dcgA           SKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFQWIKDFYIPHGNKMLQPFAPSYSAEM
2ccjB           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
3cr7D           EVAKLFADSNSIAITSFISPYRKDRDTARQLHEVAEETGLPRDPKGLYKKAREGVKEF--TGISAPYEAP
3cr7C           ----------------------------------------------------------------------
2axpA           --LVYAKKFKDYSILTERQLR----FIEDKIKAKAKVVYLHKRLRVRGDEYIEGKDIDSILELYREVSNA
2a2zA           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2cckA           ----RKIVLEDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRAL
1e98A           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
1av6A           TRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDF
2a30A           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
1bglA           ---------------------------------------------------VSEATRIDPNAWVERWKAA
3cioD           DELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSDAAVVGRSV
3dlbB           ----------------------------------------------------------------------
1e4yA           --------------AKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVD
2d0kA           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
3d3qA           FSAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYNYAFEISEDKKQVKLKHEYLASFDKESAKDI
1e9sB           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
3dyoA           ------------------------------QLLTPLRDQFTRA-PLDNDIGVSEATRIDPNAWVERWKAA
1dekB           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
1e3mB           LNLSPQRLIITGPNGGKSTYRQTALIALAYIGSYVPAQKVEIGPIDRI-FTRVGTFVETETANILHNATE
2bwjA           -SGIVLELLKEAMVASLGDTRGFLIDGY---PREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQMSR
2d7vB           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
1dp0A           DSWSPS----------------------------------------------------------------
1draA           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
3dfpC           ---------------------------------------------HSHPALTPEQKKELSDIAHRIVAPG
1e9sH           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2bv7A           ---------------------------------------------EMALKKYHGWIVQKIFQ-AALYAAP
3bwdD           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3dfnD           ---------------------------------------------HSHPALTPEQKKELSDIAHRIVAPG
3cm0A           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
1akeA           DELVIALVKERIAQEDCRNGFLLDGFPRTIPQAD-----AMKEAGINVDYVLEFDVPDELIVDRIVGRRV
1culC           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
1e2iA           MGMPYAVTD------AVLAPHIGGEAGPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIP
1e3mA           ----------------------------------------------------------------------
2czvB           YSIEKGVDAIISPWVN----RKDPGIDHVLAKLMVKKNVALGFSLRPLLYSNPYERANLKAWKLVEKYKV
2dpyA           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
2aexA           -------------------------------------------------------------------EED
3d3qB           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1e2iB           --SETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAV-TDAVLAPHIGGEAHAPPPALTLIFDR
3c14C           ----------------------------------------------------------------------
1e4vA           AGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRR
3a00B           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
1eamA           TLVTRFVDEEYLRSIKKQLHPSKIILISD--VRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQ
1adoA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------HHMSKA
1chdA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           TVLILDEPLQGLDPLNRQLVRRFVDVLIRQGETQLLFVSHHAEDAPACITHRLEFVPEGERYKYVSGRCx
3cmvG           IFINQGGNALKFYASVRLDIRRIGAVKEVVGSETRVKVVKNKIAAPFKQAE-------------------
3cmvA           LLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVTRVKVVKNKIAAPFKQAEFQILYGEGINF------
3czpB           RYKITEEDWRNRDKW--DQYVDAVGDVDR---TSTEIAPWTLVEANKVLRTINDAIEAAYK---------
3cmvC           LLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVRVKVVKNKIAAPFKQAEFQILYGEG----------
3b5jA           KILIFDEATSALDYESEHVIMRN--MHKICKGRTVIIIAHRLSTVKNA----------------------
3dmdC           RVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADA-------------------------
2dwoA           DFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYE-------------------
2c03B           EVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDA-------------------------
3dm5A           NVIHPHEVILVIDGTIGQQAYNQALAFKEATPIGSIIVTKLDGSA-------------------------
2d3wB           ELCILDESDSLDIDALKVVADGVNS--LRDGKRSFIIVTHYRILDYIK----------------------
1d1cA           SFNYLNQSGCVDIKGVSDSEE---FKITRQAMDIVGFSQEEQMSI-------------------------
3b60A           PILILDEATSALDTESERAIQA-ALDELQKNRT-SLVIAHRLSTIEQA----------------------
2bifA           GYKTFFVESICVDPEVIAANIVQVKLGSPDYVN-RDSDEATEDFMRRIECYENSYESLDEEQDRD-----
2akaA           FNYLNQSGCVDIKGVSDSEEFK----ITRQAMDIVGFSQEEQMS-IFKIIAGILHLGNIK----------
3cmvH           LLIFINQGGNALKFYASVRLDIRRIGAVKEGEN-VVGSETRVK-----VVKNKIAA--------------
3c95A           --EFLQGYADELQMLVQQYKVALLKALWQYADE-------------------------------------
1aroP           TKGLLTLA--KGKPIGKEGYYWLKIHGAVPFPERIKFIEENHENIMACAKSPLE----------------
2c04A           EVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKP----------
3eiuA           DITHPIPDLSGYITEGQIVVAR------ELHRKGIYPPINVLPSL-------------------------
2dwpA           DFKAFFIESVCDDPTVVASNIMEVKISSPDYKD-CNSAEAMDDFM-------------------------
3czpA           RYKITEEDWRNRDKWDQ--YVDAVGDVDREIAPWTLVEANDKRFARKVLRTINDAIEAAYK---------
1bifA           ----------------------------------------------------------------------
3b2qA           PGRRGYPGYMYTDLATLYERAGIVK-GAKGSVTQIPILSMPGDDITHPIPD-------------------
2c03A           EVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSA-----------------
3dmdB           RVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAAL-------------------
2c61B           DITHPIPDLSGYITEGQIVVAR-----ELHRKGIYPPINVLPSLSRLM----------------------
1e9sF           AKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTS------------------
1bg0A           DRFLQTANACRYWPTGRGIFKTFLVWVNEEDHLISMQKGGDLKTV-YKRLVTAVDNIES-----------
2czvA           RRFLTSSAQEKWDVRYPRDLIS----LGVVIGMEIPQAKASISMYPEIILKR------------------
1e69A           PFYVLDEVDSPLDDYNAERFKRLLKEN--SKHTQFIVITHNKIVMEAA----------------------
3b85A           -HILRGVDDVHFSELTSSDVVR--HQLVGH----------------------------------------
2bbsA           DLYLLDSPFGYLDVLTEKEIFESCVCKLM--ANKTRILVTSKMEHLKKADKIL-----------------
2bc9A           HRIRSKSDFVSFFPDFVWTLRDFS----------------------------------------------
3bo6B           GLMPGQYPESDVHPENWKYVSYRNELRSGRDGGEMQSQALREEPF-------------------------
2a5gA           DRNWYVQPSCATSGDGLYEGLTWL----------------------------------------------
2ccgB           INGLYPDLTIYLNVSAEVGRERIIKNSLDQEDLKFHEKVIGYQEIIHNESQRFKSVNADQ----------
2akaB           NCLILAVSPANSDLANSDALKIAKE-VDPQGQRTIGVITKLDLMDEGTDAR-------------------
2ctsA           FARAYAEGIHRTKYWELIYEDCMDLIAKLPCVAAKIYRNLYREGSSIGAIDSKLDWSH------------
3bgwD           YLQLLEPAKANDSRTNQISQISRDLKKMARELDVVVIALSQLSRQVEQRQDKRPMLSDLRESGQL-----
3eiuB           DITHPIPDLSGYITEGQI------VVARELHRKGIYPPINV-----------------------------
2ccgA           ----------------------------------------------------------------------
2dr3A           KRVVVDSVTTLYINKPAMARSIILKRVLAGTGCTSIFVSQVSGFGVEHGVDGIIRLDLDE----------
1e9sG           AKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLF------------------------------
1e9rA           TIATFDDLRGFLEGTLAESLFAGSNEA-------------------------------------------
2b8wA           QPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHRRK-----------------
3a1wA           HLGIPVVFTSSVTGEGLEELKEKIVEYAQ-----------------------------------------
1e0jA           ISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDK-GKAHEEGRPVSITDLRG------
2c61A           RGYPGYMYTDLATLYERAGIVKGAKGSVTQI-PILSMPGDDITHPIPD----------------------
3da4A           ----------------------------------------------------------------------
1e0jB           ISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHE-------------------
2d62A           PKVFLDEPLSNLDAKLRVKRAELKKLQRQLGVT-TIYVTHDQVEATGDR---------------------
2awnC           SVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAM-TLADKIVVLDAG-----------
3b2qB           DITHPIPDLSGYITEGQIVVARELHRKGI------YPPINVLPSL-------------------------
2bkiA           FRYLNRGCTRYFANKETDKQIL------------------------------------------------
3cr7A           PEVHVKNYELPVQDAVKQIIDY----LDTKGYL-------------------------------------
2bdtA           ----------------------------------------------------------------------
2axzC           DLTIQTVLKNALTISINRNLKEAQYYINQFEHLKTIKNISI------NGYYDLEINYLKQIYQFLTDKN-
3dt2A           RFCTPASQCPIIDPAWEVPIEGIIFGGRRPAGVPLVYEALSWQHG-------------------------
2d4hA           RDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVF--------------
1cr4A           DVIILDHISIRKMIDNL---MTKLKGFAKSTGVVLVVICHLKDLRGGALRQ-------------------
2bkhA           RYLNRGCTRYFANKETDKQILQN-----------------------------------------------
2c9oC           APIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRTMLYTPQEMK---------------------
4dcgA           ----------------------------------------------------------------------
2awnB           SVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEA-------------------------
2ccjB           INGLYPDLTIYLNVSAEVGRERIIKNNRLDQED-LKFHEKVIEGY-QEIIQRFKSVNADQ----------
3d3kA           PVLSIDPP-VHIDAKWSLALGLPLPLGEHAGRI-YLCDIGIPQQV-FQEVGINYHSPFGCKF--------
1dkiA           VHQINRGDFSKQDW------EAQIDKELSQNQP--VYYQGV-----------------------------
3d7wA           -IQMISEAARFNPILWRARQY-------INSGASFLPDVYM-----------------------------
3dtbB           RFCTPASQCPIIDPAWEVPIEGIIFGGRRPAGVPLVYEALSWQHGVFV----------------------
2a2zD           GIIYLQATPLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFD-------------------------
1e9sD           AKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLSLFAGSNEAS-KALTSARFVLSDK-----------
3dt4A           RFCTPASQCPIIDPAWEVPIEGIIFGGRRPAGVPLVYEALSWQHG-------------------------
2a5jA           EHGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGLF---------------------------------
1e2dA           VLFLQLQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTLN-WKMVDASKSIEAV-----------
3cr7D           ----------------------------------------------------------------------
3cr7C           ANPEVHVKNYELPV--QDAVKQIIDYLDTKG---------------------------------------
2c9gA           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2a2zA           NNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEK-------------------------
2d4uA           ---FFDQPTQGYQDGFEKQYVAYME-QNDRLHDIAVSDNN------------------------------
1cr2A           DVIILDHISIRKMIDNL---MTKLKGFAKSTGVVLVVICHLKSGALRQLSDTIIALERNNLVLV------
421pA           SYGIPYIETSAKTRQGVEDAFYTLVREIRQ----------------------------------------
1e9fA           LVLFLQLQLADAAKRYENGAFQERALRCFHQLMKMVDASKSIEAVHEDIRV-------------------
1e9cA           LVLFLQLQLADAAKRGAFGHERY-----ENGAFQERALRCFHQLM-------------------------
2awnD           ADRFVAPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQ-VGANMSLGIRPEH----------
2cckB           EVGRERIIKNRLDQEDLKFHEKVIEGYQEIIRFKSVNADQPLENV-------------------------
1dg3A           QPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKK-----------------------------
1e6cA           EALYQDVAHYVVDATQPAIVCELMQTM-------------------------------------------
3bh0A           YLQLLEPAKANDSRTNQISQISRDLKKMARELDVVVIALSQLSRQVEQRQDKRPMLSDLRESGQLEQ---
2dftA           ATMRVDTNRRNPGAVVRHILSR------------------------------------------------
3dt4C           RFCTPASQCPIIDPPEGVPIEGIIFGGRRPAGVPLVYEALSWQHG-------------------------
2cgtH           FILLADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEAL-----------------------------
1e9rE           AKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLSLFAGSNEAS-------------------------
2b8tA           ---TKLTAICNECGAEATHSLRKIDGKHADYNDDIVKIGCQEFYSAVC----------------------
2cjwB           AVQHNVKELEGIVRQRRDSKEKNERAYQKRKES-------------------------------------
2b8tB           AICNECGAEATHSL-------RKIDGKHADYNDDIVKIGCQEFYSAVC----------------------
1d6jB           ANPEVHVKNYELPV--QDAVKQIIDYLDTKG---------------------------------------
3adkA           TSGRVDDNEETIKKRLETYYKATEPVIAFYEKR-GIVRKVNAEGSVDDVFSQV-----------------
2ahwD           KEYLYYKAIAPDIAFIRAT---------------------------------------------------
2cckA           ----------------------------------------------------------------------
3bgwA           VIVMIDYLQLLEPAKANDSRTNQISKMARELDVVVIALSQLSRQV-EQRQDKRPMLSDLRESGQLEQ---
1e98A           LVLFLQLQLADAAKRGAFGHERYENGAFQE-----RALRCFHQLM-------------------------
2ahvA           KEYLYYKAIAPDIAFIRATTC------DSEGYATFEDEVMYLDALVIAQAVHNNG---------------
3cmxA           -RLDIRRIGAVKEGENVVGSETRVKVV------KNKIAAPFKQAE-FQILYGEGINFYG-----------
3di4A           GQYFKASPVRPGDYLEFFAEIDLLGNLCPGGDCSSEASCH------------------------------
2a30D           GIIYLQATPETCLHRIYGIPLEYLEKLHYKHESWLLHRTLKTNFD-------------------------
1cfrA           KSMLKDISFSNISLSTISEIDNLYKNFIDYAELEHIKSFLSVKTTFRPDRRLQ-----------------
2dr3E           KRVVVDSVTTLYINKPAMARSIILQLLAGTGCTSIFVSQVSVGPGVEHGVDGIIRLDLDE----------
2b8tC           AICNECGAEATHSLRKIDGKH-------ADYNDDIVKIGCQEFYSAVC----------------------
2dr3B           KRVVVDSVTTLYINKPARSIILQLKRVLAGTGCTSIFVSQVSVGERGFGGPGVEHGVDGI----------
1e2fA           LVLFLQLQLADAAK---RGAFGHERYENGAFQERAL-RCFHQLMKDTT----------------------
3cddF           LIIVNEEVTTAEGAAKRGQWERQRSIGKSNAEYTVTGWRIPQTGKLWNINTLVPVIDEI-----------
3cddC           GVLLTSDTFGNLVITRASKTKAGVSLILGDNVKAARGRFSWRQRFS------------------------
2eg5G           TKDFTTFLRIHSEELFSHGRMLL-----------------------------------------------
2c9yA           HPKSGRSYHEEFNPPKEPMKDDI--TGEPLIRRSDDNEKALKIRLQAY----------------------
2awoC           SVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTVVLDAGRVAQVGKPL--------
3clvA           DNNLLFIQTSAKTGTNIKNIFYMLAEEIYKN---------------------------------------
1dhjA           NIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQF-LPKAQKLYLTHIDA----------
3ch4B           DWVIENHGVEQRL---EEQLENLIEFI-------------------------------------------
1eilA           RIAVQPGELDDLAYAGEVDDAAALERMADKLRQAGVAFTRGDEALMQ-----------------------
2a2zB           GIIYLQATYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLK-TNFDYLQEVPILTLDVNE----------
3bb1B           DGLPYDEFFSKRSEALLQVVRSGASLA--SDIPVVLIENSGRCNSDEKVLPNGIAWIPH-----------
2a30B           GIIYLQATYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFD-------------------------
2b92B           EADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRRKFFPKK-----------------------------
2dftC           ATMRVDTNRRNPGAVVRHILSR------------------------------------------------
2d3wA           ELCILDESDSGLDIDALKVVADGVNSLRDGKRSF-IIVTHYQRILDYIKPDYVHVLYQGR----------
2ausC           HGGTLDPKVSGVLPVALERATRVVQALLPAGKEYVALMHLHGDVPEDKIRAVMK----------------
2cvfA           SRTEMTKPVAEQTLGYRCKDILRLDKLPKPGLR--VAVLERHRFRPEGLMAYFRITERG-----------
1av6A           ----------------------------------------------------------------------
3dt7A           RFCTPASQCPIIDPAWESPEGVPIE--------GIIFGGRRPAGVPVYEALSWQHG--------------
2a30A           GIIYLQATPETCLNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFD-------------------------
3cnlA           GRVSFERP--------------------------------------------------------------
2bbsB           DLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTR--ILVTSKMEHL-KKADKILILHEGS----------
3bczC           EFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFSSDFCHWGQRFRYSYYDESQGEIYRS---------
1accA           HREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKEVIND---------------------------
3cddD           GVLLTSDTFGNLVITRASKTKA----GVSLILGDNVKAARGRFSW-------------------------
2ancF           QKQRHDALISKLL---------------------------------------------------------
2aunB           DITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFSDISVLLSAFHRHGLPLGLEQQER---------
3bb1E           DGLPYDEFFSKRSEALLQVVRSGASLKKASDIP-VVLIENSGRCNKND--SDEKVLPNGI----------
2d3wD           ELCILDESDGLDIDALKVVADGVNSLRDGKRSFI--IVTHYQRILDYIKPDYVHVLYQGR----------
3cueF           ANKMPFLETSALDSTNVEDAFLTMARQIKESMS-------------------------------------
3cr7B           FTGISAPYEAPANPEVHVKNYELPVQDAVKQIIDYL----------------------------------
1bglA           ----------------------------------------------------------------------
3bk7A           DIYLLDEPSAYLDVEQRLAVSRAIRHLMEKNEKTALVVEHDVLMIDY-VSDRL-IVFEGE----------
2awnA           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
3dlbB           ---DPRKPIPHLTGLLVPVGSLALSLPWEERRRRTREIASWIGRR-------------------------
2awoA           SVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAM-TLADKIVVLDAG-----------
1e4yA           ----------------------------------------------------------------------
2d0kA           NIILSSQPGTDDRVTWVKSVDEAIAAAGDVPEIFVIGGGRVYEQF-------------------------
1e9rD           AKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLSLFAGSNEAS-------------------------
1e9sJ           AKKLALIGTPSMRELFHWTTIA------------------------------------------------
3bb1A           DGLPYDEFFSKRSEALLQVVR---SGASLKSDIPVVLIENSGRCNKNDSDEKV--LPNGIAWI-------
1e3aB           INLLNDDGKTWQQPGSAILNVWLTSMLKRTVVA-AVPMPFDKWYS-------------------------
3d31A           KILLLDEPLSALDPRTQENAREMLSVLHKKNKLTVLHITHDQTEARIMADR-------------------
3dfnA           KGILAANESTGSIAKRLQSIGTENTEENRRFYR-QLLLTADDRVNPCIGGVILFH---------------
3bpbA           KVLGLKTGLAYLEHNNLLAAGEFVSKPEFQDFNIIEIPEEESYAANCIWVNERVIMPAG-----------
2c4rL           EGSIVIDSTEALTAIDINSARGDIEETAFNTNLEAADEIARLRDLGGLIVIDFIDM--------------
3d3qA           ----------------------------------------------------------------------
2c0bL           EVRLPSGGSIVIDSTEALTAIDINSARDIEETAFNTNLEAADEIARQLRLRDLG----------------
1e9sB           TIATFDDLRGFLE---------------------------------------------------------
1cr0A           DVIILDHI---SIRKMIDNLMTKLKGFAKSTGVVLVVICHLKD---------------------------
3dfqA           KGILAASESTGSIAKRLQSIGTENTEENRRFYR-QLLLTADDRVNPCIGGVILFH---------------
2c7cH           FILLADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIV-----------------
1aldA           KGILAADESTGSIAKRLQSIGTENTEENRRFYR-QLLLTADDRVNPCIGGVILFH---------------
3dfqD           KGILAASESTGSIAKRLQSIGTENTEENRRFYR-QLLLTADDRVNPCIGGVILFH---------------
1e9dA           LVLFLQLQLADAAKRGAFGHERY-----ENGAFQERALRCFHQLM-------------------------
1e9sI           AKKLALIGTPSMRELFH-----------------------------------------------------
1cjaA           GFLATVRECASFDLDAFERELLSWQESLQKCHNLIPFILR------------------------------
3b9qA           ----------------------------------------------------------------------
6aldA           KGILAADESTGSIAKRLQSIGTENTEENRRFYR-QLLLTADDRVNPCIGGVILFH---------------
2d7vA           ----------------------------------------------------------------------
1d6jA           VEAPYEAPANPEVKNYELPVQDAVKQIIDYLDTKGYLPAK------------------------------
1cr1A           DVIILDHI--SIRKMIDNLMTKLKGFAKSTGVV-LVVICHL-----------------------------
3dyoA           ----------------------------------------------------------------------
1dekB           ESVNFVAFNKITDVINNIEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFAL-------------------
1ai4B           INLLNDDGKTWQQPGSAILNVWLTSMLKRTVVAA-VPMPFDKWYS-------------------------
2bhvD           INIMLTNGYNGLVGELIERNFQRYGVPLFGDYLLMQLMRQSGMGINQVVNQILRDK--------------
1dhiA           NIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQF-------------------------
1e3mB           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
1e2hB           VALIPPTLPGTNIVLGALPEDRHIDRLAKRLDLAMLAAIRRVYGLLANTVRYLQ----------------
2d7vB           ----------------------------------------------------------------------
3dfoD           KGILAANESTGSIAKRLQSIGTENTEENRRFYR-QLLLTADDRVNPCIGGVILFH---------------
3dfpD           KGILAANESTGSIAKRLQSIGTENTEENRRFYR-QLLLTADDRVNPCIGGVILFH---------------
3bb1F           DGLPYDEFFSKRSEALLQVVRSGAS-LKKDIPV-VLIENSGRCNK-------------------------
3cmwC           RKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGA---------------
2ck3C           ALIIYDDLSKQAVAYRQMSLLLR-RPPGREAYP-GDVFYLHSRLL-------------------------
3c8uA           NYLLFDAPGWRDLTAIWDIRLEVPADLEARLVQRWLDHGLNHDAAV-ARAQGNDLANARA----------
3cbnA           RTLIRADKAAFDLDENLVRDLR---------KGRELKVEIIVEYE-------------------------
3dftC           KGILAASESTGSIAKRLQSIGTENTEENRRFYR-QLLLTADDRVNPCIGGVIL-----------------
2d4hB           GTSVFDRPVHRRKLAQLEKLQDEELDPEFVQQV-ADFCSYFSNSKTKTLSGG------------------
3dftD           KGILAASESTGSIAKRLQSIGTENTEENRRFYR-QLLLTADDRVNPCIGGVILFH---------------
2dr3F           KRVVVDSVTTLYINMARSIILQLKRVLAGTGCT-SIFVSQVSGFGPEHGVDGIIRLDLDE----------
1dvrA           HPASGRSYHKIFNPPKEDMKDDVTGEALVQ----------------------------------------
1d8jA           KIEVIDGKYAFKPKYNVR----------------------------------------------------
3a00A           ARFLFIAPPSVTGAHDKVIVNDDLDKAYKELKD--FIFAE------------------------------
1e2kA           IAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGVLGALPEDRHIDRLAKRQRPGERL-----------
2bkeA           RAEYPGRENLAVRQQKLNKHLHQLTRLAEVYDIAVIITNQVVPGIRIQLKKRIARVVDAPHLPE------
3cmtD           SVRLDIRRIGAVKEGENVVGSE----TRVKVVK-NKIAAPFKQAE-------------------------
1dp0A           GHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRI-------------------------
1draA           NIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPK----------------------
2b8wB           PDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFN-------------------------
2boeX           ILVVSNAPGRDCGGGARSWIDEFAAGLKNRPAY--IIVEPDLISLMSSCMQHVQQEVLETMAYA------
2bx2L           EVRLPSGGSIVIDSTEALTAIDINSARGDIE---ETAFNTNLEAA-DEIARQLRLRDLGG----------
2aumB           DITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPL--IGFADISVLLSAFHRHGLPAIHGPV---------
2bofX           PAYIIVEPDLISLMSSCMQHVQQEVLETMAYAGKALKAGSSQARIYFDAGHS-AWHSPAQMASWL-----
2bhjA           QWSNLQVFDARNCSTAQEMFQHICRHILYATNNGNIRSAIT-----------------------------
3dfpC           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
3dhwC           KVLLCDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVA-----------------
3dfnC           KGILAANESTGSIAKRLQSIGTENTEENRRFYR-QLLLTADDRVNPCIGGV-------------------
2d3wC           ELCILDESDDIDALKVVADGVNSLR---DGKRSFIIVTHYQRILDYIK----------------------
3ed8A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
3bb1C           DGLPYDEFFSKRSEALLQVVRS-GASLKSDIPV--VLIENSGRCNKNDSDEKV--LPNGIA---------
1e9rF           AKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLF------------------------------
3be4A           NPPKQPGIDDVTGEPLVWRDDDNAEAVKVRLDVFHKQTAPLVKFY-------------------------
2a1fF           GEALQGEDGLGIDPAILDRMAVEIKELVEMGVE-VSVVLGGGNLF-RGAKLAKAGMNRVVGDHM------
2bv7A           ----------------------------------------------------------------------
3bwdD           GAPAYIECSSKSQENVKGVFDAAIRVVLQ-----------------------------------------
2dr3D           KRVVVDSVLYINKPAMARSIILQLKRVLAGTGCTSIFVSQVSVGERGFGGPGVEHGVDGI----------
2bbtB           DLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTR-ILVTSKMEHLKKA----------------------
2drcA           NIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQF-------------------------
3cmvE           IFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNK-IAAPFKQAEFQILY----------
2dr3C           KRVVVDSVTTLYINKPAMAIILQLKRVLAGTGCTSIFVSQVSG---------------------------
2bhvA           INIMLTNAYNGLVGELIERNFQ------------------------------------------------
3cnnA           GRVSFERP--------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
2d2eA           TYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVIT-HYQRILNYIQPDKVHVMMDGR----------
3cm0A           SD-DNEETVRRRLEVYREKTEPLVGYYEARGVLKRVDGLGTPDEVYARIRAAL-----------------
1bmfC           ALIIYDDLSKQAVAYRQMSLLLR--RPPGREAYPGDVFYLHSRLL-------------------------
1akeA           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
1e2gA           LVLFLQLQLADAAKRGERYENGAFQE---------RALRCFHQLM-KDTTLNWKMVDASKSIEAVHED--
3bjdB           QYVSGSASRAQLQVFLRHQWFRTFRLYRDAADL--LVNLTDVDEAAAL----------------------
3b85B           KVVTGDSGLRLVRHILRGVDDVHFSELTSSDVVRHQLVGHIVDAY-------------------------
1e9sL           ----------------------------------------------------------------------
3dm9B           RVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALPILFVGVGQGY--------
1cs4C           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
2dflA           RAEYPGRENLAVRQQKLNKHLHQLTRLAEVYDIAVIITNQVMHTLYHVPGIRI-----------------
2awoD           ----------------------------------------------------------------------
1ak2A           HPQSGRSYHEEFNPPKEPMKDDITGEPLIRRSDNKKALKIRLEAY-HTQTTPLVEYYSKR----------
1e59A           KELPLTESLALTIDRVIPYWNETILPRMKS-GERVIIAAHGNSLRALV----------------------
1cjtC           ----------------------------------------------------------------------
1c9kC           MGIVPENRLARHF---RDIAGRVNQRLAAAADE-VWLVVSG-----------------------------
2c9oA           ----------------------------------------------------------------------
3crmA           RQVLHARIAQRFRQMLEQGFIAEVEALHARSDLHAGLPSIRAVGYRQVW---------------------
1afrA           ----------------------------------------------------------------------
1b0uA           DVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVT-HEMGFARHVSSHVI-----------------
1e2mB           VALIPPTLPGTNIVLGALPEDRHIDRLAKRLDLAMLAAIRRVYGLLANTVRYLQ----------------
1e9rG           ----------------------------------------------------------------------
2bbtA           DLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTR--ILVTSKMEHL-KKADKILILHEGS----------
3cqcA           ----------------------------------------------------------------------
1e2lB           ALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNVLGALPEDRHIDRLAKRLDL---------------
3b55A           SIVGLGEATHGAHE--VFTKHRIVKYLVSEKGFTNLVLEEGWDRALEL----------------------
2e85B           RLLIVDATDMGLNPGEIRIIDP------DDIAEMFMMTTHN-----------------------------
3cmvB           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
2cdnA           RADDTDDVILNRMKVYRDETAP----LLEYYRDQLKTVDA------------------------------
2a1fD           GEALQGEDGLGIDPAILDRMAVEIKELVEMGVEV-SVVLGGGNLF-RGAKLAKAGMNRVV----------
3dmdA           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3dymA           GHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRIDGSGQM-------------------
3dfqC           KGILAASESTGSIAKRLQSIGTENTEENRRFYR-QLLLTADDRVNPCIGGVIL-----------------
1e3mA           YSLVLDEIGRGTSTYDGLSLAWACAENLANKIKALTLFATHYFELTQLPEKEGVANVHLD----------
2czvB           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2a78A           QWNVNYVETSAKTRANVDKVFFDLMREIRARKME------------------------------------
2d2fA           TYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVITHYQRILNYIQ----------------------
1e9sA           ----------------------------------------------------------------------
2d4uB           ---FFDQPTQGYQDGFEKQYVAYMEQNDR-----------------------------------------
2bjbA           HIAMTAAMLRQAGVDIDDSTPNRWQVRPGPVAARRWDIEPDLTNA-------------------------
2aexA           ----------------------------------------------------------------------
3d3qB           LASFDKESAKDIHPNNRKRVLRAIEYYLK-----------------------------------------
5dfrA           NIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQF-------------------------
3e70C           ----------------------------------------------------------------------
1dekA           LGTDLIVNNFDRMYWVKLFALDYLDKFNSGYDYYIVPDTRQDHEMDA-ARAMGATVIHVVR---------
3dffA           LAVNDHSPDSDHDLVGE--VADDIRSIIDEFDPTLVVTCAA-----------------------------
3do6A           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
3ec1A           R-TKLEKADSLYANQLGELLSPPSKRYAA---EFPPLVPRSLS---------------------------
3dauA           NIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQF-------------------------
1e2iB           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
3a00B           ARFLFIAPPSGAHD--KVIVNDDLDKAYKELKD--FIFAE------------------------------
3dfoC           KGILAANESTGSIAKRLQSIGTENTEENRRFYR-QLLLTADDRVNPCIGGVIL-----------------
3cphA           ELGIPFIESSAKNDDNVNEIFFTLAKLIQEKIDS------------------------------------
3bb1H           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
3bjqB           --ILSTHARGYRQSTLIGKKLFPVAPVAQYGGKILTFGKEAFRLYNTKRNTKRIDFGYEGD---------
2aumA           DITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFADISV----------------------------
1eamA           ----------------------------------------------------------------------
1adoA           KGILAADESTGSIAKRLQSIGTENTEENRRFYR-QLLLTADDRVN-------------------------
1e1qB           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
1e9rB           DDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFSIRSWLEDPNGGNLFI------
3bb1D           ----------------------------------------------------------------------
1chdA           KLIAIGASTGGTEAI-----RHVLQPLPLSSPAVIITQHMPPGFTRSF-AERLNKLCQIS----------
3d1mA           DIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLR------VTEGWDEDGHHSEESLHYEGR--
1ek0A           ----------------------------------------------------------------------
3brwA           ESPAFVEFLEFLGQKVKLQDRGGLDVTHGQTGTESVYCNFRNKEI-------------------------
1e2kB           ----------------------------------------------------------------------
2a1fE           GEALQGEDGLGIDPAILDRMAVEIKELVEMGVEV-SVVLGGGNLFRGA----------------------
3bv4A           KGILAADESTGSIAKRLQSIGTENTEENRRFYR-QLLLTADDRVNPCIGGVIL-----------------
4dfrA           NIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQF-------------------------
1dyhA           NIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQF-------------------------
1e2nA           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
2aunA           DITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFSDISVLLSAFHRHGLP-----------------
1agpA           SYGIPYIETSAKTRQGVEDAFYTLVREIRQ----------------------------------------
3c7kA           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
1e2nB           VALIPPTLPGTNIVLGALPEDRHIDRLAKLDLAML-----------------------------------
2bhvC           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
2c5mD           -YINIDAGLTKDNNLTTGKIVINKERKGDYLGKTVQVVPHITDAIQ-EWVMRQALEPQVCVIEL------
2a1fC           GEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGAK----------------------
1drbA           NIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQK-------------------
1e2jA           VLAFVALIPPTLPGTNIVLGALPEDRRQRPGERLDLAMLAAIRRVYGLLANTVRYLQCGGS---------
3dofB           EDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRI-------------
3dvlD           TSVFQQY---DASSVVRRELFRLVARLKQIGAT-TVMTTERIEEY-------------------------
1e2lA           AVLAFVA---------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
2c1lA           RIQAAPGTTAGQGTQYFWLSKDSYDF--------------------------------------------
2dwuB           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
1bifA           GYKTFFVESICVDPEVIAANIVQVKLGSPDYVN-RDSDEAT-----------------------------
2c03A           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
2ccgA           INGLYPDLTIYLNVSAEVGRERIIKNSRDQN-RLDQEDLKFHEKV-IEGYQEIIHNESQR----------
2dr3A           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
2bdtA           ESKGIDERYFYNTSHLQPTNLNDIVKNLKTNPR-------------------------------------
2axzC           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
4dcgA           RLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQ----------------------
2ccjB           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
3cr7D           ANPEVHVKNYELPV--QDAVKQIIDYLDTKGYL-------------------------------------
3cr7C           ----------------------------------------------------------------------
2axpA           GLHTYSWDTGQWSSDEAKDIIFLVE---------------------------------------------
2a2zA           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2cckA           NEFAINGLYPDLTIYLNVSAEVGRERIIKNSRLDLKFHEKVIEGY-------------------------
1e98A           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
1av6A           YIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIV---------------
2a30A           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
1bglA           GHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRIDGS----------------------
3cioD           GTSLLVARFGLNT---AKEVSLSMQRLEQAGVNIKGAILN------------------------------
3dlbB           ----------------------------------------------------------------------
1e4yA           YVLEFDVPDELIVDRIVG---RRVHAPSGRVYHVKFNPPKVEGKDDVTGEE-------------------
2d0kA           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
3d3qA           HPNNRKRVLRAIEYYTKKLLRKKVQQFTENYDTLLIGIESRETLYLRINKR-------------------
1e9sB           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
3dyoA           GHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRI-------------------------
1dekB           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
1e3mB           YSLVLDEIGRGTSTYDGLSLAWACENLANKIKALTLFATHYFELT-------------------------
2bwjA           SSLPVDDTTKTIAKRLEAYYRASIPVIAYYETK-TQLHKINAEGTPE-----------------------
2d7vB           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
3dfpC           KGILAANESTGSIAKRLQSIGTENTEENRRFYR-QLLLTADDRVNPCIGGVIL-----------------
1e9sH           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2bv7A           YKSDFLKALSKGQNVTEEECLEKVRLFLVNYTA-TIDVIY------------------------------
3bwdD           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3dfnD           KGILAANESTGSIAKRLQSIGTENTEENRRFYR-QLLLTADDRVNPCIGGVIL-----------------
3cm0A           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
1akeA           HAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTYYSKEA--------------
1culC           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
1e2iA           PTLPGTNIVLGALPE-------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
2czvB           RRFLTSSAQEKWDVRYPRDLISLGVVIGMEIPQAKASISMYPEII-------------------------
2dpyA           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
2aexA           ELAHRCSSFMAPPVTDLGELRRRPG--DMKTKMELLILETQAQVCQAQVDGGANFSVD------------
3d3qB           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1e2iB           HPIALCYPAARYLMMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRERLDLA-----------
3c14C           ----------------------------------------------------------------------
1e4vA           VHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRMTAPLIGYYSKEA--------------
3a00B           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
1eamA           WIKDFYIPHGNKMLQPFAPSYSAMRLLSIYTGENMRLTRVTKSDA-------------------------
1adoA           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
2b0lC           VVQMAISSLSYSELEAIEHIFEELDGNEGLLVASKIADRVG-----------------------------
1chdA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           x
3cmvG           -
3cmvA           -
3czpB           -
3cmvC           -
3b5jA           -
3dmdC           -
2dwoA           -
2c03B           -
3dm5A           -
2d3wB           -
1d1cA           -
3b60A           -
2bifA           -
2akaA           -
3cmvH           -
3c95A           -
1aroP           -
2c04A           -
3eiuA           -
2dwpA           -
3czpA           -
1bifA           -
3b2qA           -
2c03A           -
3dmdB           -
2c61B           -
1e9sF           -
1bg0A           -
2czvA           -
1e69A           -
3b85A           -
2bbsA           -
2bc9A           -
3bo6B           -
2a5gA           -
2ccgB           -
2akaB           -
2ctsA           -
3bgwD           -
3eiuB           -
2ccgA           -
2dr3A           -
1e9sG           -
1e9rA           -
2b8wA           -
3a1wA           -
1e0jA           -
2c61A           -
3da4A           -
1e0jB           -
2d62A           -
2awnC           -
3b2qB           -
2bkiA           -
3cr7A           -
2bdtA           -
2axzC           -
3dt2A           -
2d4hA           -
1cr4A           -
2bkhA           -
2c9oC           -
4dcgA           -
2awnB           -
2ccjB           -
3d3kA           -
1dkiA           -
3d7wA           -
3dtbB           -
2a2zD           -
1e9sD           -
3dt4A           -
2a5jA           -
1e2dA           -
3cr7D           -
3cr7C           -
2c9gA           -
2axpA           -
2a2zA           -
2d4uA           -
1cr2A           -
421pA           -
1e9fA           -
1e9cA           -
2awnD           -
2cckB           -
1dg3A           -
1e6cA           -
3bh0A           -
2dftA           -
3dt4C           -
2cgtH           -
1e9rE           -
2b8tA           -
2cjwB           -
2b8tB           -
1d6jB           -
3adkA           -
2ahwD           -
2cckA           -
3bgwA           -
1e98A           -
2ahvA           -
3cmxA           -
3di4A           -
2a30D           -
1cfrA           -
2dr3E           -
2b8tC           -
2dr3B           -
1e2fA           -
3cddF           -
3cddC           -
2eg5G           -
2c9yA           -
2awoC           -
3clvA           -
1dhjA           -
3ch4B           -
1eilA           -
2a2zB           -
3bb1B           -
2a30B           -
2b92B           -
2dftC           -
2d3wA           -
2ausC           -
2cvfA           -
1av6A           -
3dt7A           -
2a30A           -
3cnlA           -
2bbsB           -
3bczC           -
1accA           -
3cddD           -
2ancF           -
2aunB           -
3bb1E           -
2d3wD           -
3cueF           -
3cr7B           -
1bglA           -
3bk7A           -
2awnA           -
3cioD           -
3czjA           -
3dlbB           -
2awoA           -
1e4yA           -
2d0kA           -
1e9rD           -
1e9sJ           -
3bb1A           -
1e3aB           -
3d31A           -
3dfnA           -
3bpbA           -
2c4rL           -
3d3qA           -
2c0bL           -
1e9sB           -
1cr0A           -
3dfqA           -
2c7cH           -
1aldA           -
3dfqD           -
1e9dA           -
1e9sI           -
1cjaA           -
3b9qA           -
6aldA           -
2d7vA           -
1d6jA           -
1cr1A           -
3dyoA           -
1dekB           -
1ai4B           -
2bhvD           -
1dhiA           -
1e3mB           -
2bwjA           -
1e2hB           -
2d7vB           -
3dfoD           -
3dfpD           -
3bb1F           -
3cmwC           -
2ck3C           -
3c8uA           -
3cbnA           -
3dftC           -
2d4hB           -
3dftD           -
2dr3F           -
1dvrA           -
1d8jA           -
3a00A           -
1e2kA           -
2bkeA           -
3cmtD           -
1dp0A           -
1draA           -
2b8wB           -
2boeX           -
2bx2L           -
2aumB           -
2bofX           -
2bhjA           -
3dfpC           -
1e9sH           -
3dhwC           -
3dfnC           -
2d3wC           -
3ed8A           -
1ckvA           -
3bb1C           -
1e9rF           -
3be4A           -
2a1fF           -
2bv7A           -
3bwdD           -
2dr3D           -
2bbtB           -
2drcA           -
3cmvE           -
2dr3C           -
2bhvA           -
3cnnA           -
3dfnD           -
2d2eA           -
3cm0A           -
1bmfC           -
1akeA           -
1culC           -
1d2zD           -
1e2gA           -
3bjdB           -
3b85B           -
1e9sL           -
3dm9B           -
1cs4C           -
3bb1G           -
2dpyB           -
2dflA           -
2awoD           -
1ak2A           -
1e59A           -
1cjtC           -
1c9kC           -
2c9oA           -
3crmA           -
1afrA           -
1b0uA           -
1e2mB           -
1e9rG           -
2bbtA           -
3cqcA           -
1e2lB           -
3b55A           -
2e85B           -
3cmvB           -
1e9sM           -
2cdnA           -
2a1fD           -
3dmdA           -
1e2iA           -
3dymA           -
3dfqC           -
1e3mA           -
2czvB           -
3dm5B           -
2dpyA           -
2a78A           -
2d2fA           -
1e9sA           -
2d4uB           -
2bjbA           -
2aexA           -
3d3qB           -
5dfrA           -
3e70C           -
1dekA           -
3dffA           -
3do6A           -
3e8aC           -
3ec1A           -
3dauA           -
1e2iB           -
3c14C           -
3cd9A           -
1e4vA           -
3a00B           -
3dfoC           -
3cphA           -
3bb1H           -
3c15C           -
1e9sE           -
2bwjB           -
3bjqB           -
2aumA           -
1eamA           -
1adoA           -
1e1qB           -
2b0lC           -
1e9rB           -
3bb1D           -
1chdA           -
3d1mA           -
1ek0A           -
3brwA           -
1e2kB           -
2a1fE           -
3bv4A           -
4dfrA           -
1dyhA           -
1e2nA           -
2ancD           -
2aunA           -
1agpA           -
3c7kA           -
2b8tD           -
2anbA           -
1cjuC           -
1azsC           -
2ancB           -
1e2nB           -
2bhvC           -
2bwjD           -
2c5mD           -
2a1fC           -
1drbA           -
1e2jA           -
3dofB           -
3dvlD           -
1e2lA           -
2axnA           -
1cjvC           -
3cmuA           -
3dkvA           -
2an9A           -
2c1lA           -
2dwuB           -
3b5jA           -
3dmdC           -
2dwoA           -
2c03B           -
3dm5A           -
2d3wB           -
3b60A           -
2bifA           -
3c95A           -
2c04A           -
2dwpA           -
1bifA           -
2c03A           -
3dmdB           -
2c61B           -
1e9sF           -
1bg0A           -
2czvA           -
1e69A           -
3b85A           -
2bbsA           -
2bc9A           -
3bo6B           -
2a5gA           -
2ccgB           -
2akaB           -
2ctsA           -
3eiuB           -
2ccgA           -
2dr3A           -
1e9sG           -
1e9rA           -
2b8wA           -
3a1wA           -
1e0jA           -
3da4A           -
1e0jB           -
2d62A           -
2awnC           -
3cr7A           -
2bdtA           -
2axzC           -
2d4hA           -
1cr4A           -
2bkhA           -
2c9oC           -
4dcgA           -
2ccjB           -
3d3kA           -
1dkiA           -
3d7wA           -
2a2zD           -
1e9sD           -
3dt4A           -
2a5jA           -
1e2dA           -
3cr7D           -
3cr7C           -
2axpA           -
2a2zA           -
2d4uA           -
1cr2A           -
421pA           -
1e9fA           -
1e9cA           -
2cckB           -
1dg3A           -
1e6cA           -
3bh0A           -
2dftA           -
2cgtH           -
1e9rE           -
2b8tA           -
2cjwB           -
2b8tB           -
1d6jB           -
3adkA           -
2ahwD           -
2cckA           -
1e98A           -
2ahvA           -
3cmxA           -
3di4A           -
2a30D           -
1cfrA           -
2dr3E           -
2b8tC           -
2dr3B           -
1e2fA           -
3cddF           -
3cddC           -
2eg5G           -
2c9yA           -
2awoC           -
3clvA           -
1dhjA           -
3ch4B           -
1eilA           -
2a2zB           -
3bb1B           -
2a30B           -
2b92B           -
2dftC           -
2d3wA           -
2ausC           -
2cvfA           -
1av6A           -
2a30A           -
3cnlA           -
2bbsB           -
3bczC           -
3cddD           -
2ancF           -
2aunB           -
3bb1E           -
2d3wD           -
3cueF           -
3cr7B           -
1bglA           -
3cioD           -
3dlbB           -
1e4yA           -
2d0kA           -
1e9sJ           -
1e3aB           -
3dfnA           -
3bpbA           -
2c4rL           -
3d3qA           -
1e9sB           -
1cr0A           -
3dfqA           -
2c7cH           -
1aldA           -
3dfqD           -
1e9dA           -
1e9sI           -
1cjaA           -
6aldA           -
2d7vA           -
1d6jA           -
1cr1A           -
3dyoA           -
1dekB           -
2bhvD           -
1dhiA           -
1e3mB           -
2bwjA           -
2d7vB           -
3dfoD           -
3dfpD           -
3cmwC           -
2ck3C           -
3c8uA           -
3cbnA           -
3dftC           -
2d4hB           -
3dftD           -
1dvrA           -
1d8jA           -
3a00A           -
1e2kA           -
3cmtD           -
1dp0A           -
1draA           -
2boeX           -
2bx2L           -
2aumB           -
2bofX           -
3dfpC           -
1e9sH           -
3dfnC           -
3ed8A           -
1ckvA           -
1e9rF           -
2a1fF           -
2bv7A           -
3bwdD           -
2dr3D           -
2bbtB           -
2drcA           -
3cmvE           -
2dr3C           -
2bhvA           -
3cnnA           -
3dfnD           -
3cm0A           -
1bmfC           -
1akeA           -
1culC           -
1e2gA           -
3bjdB           -
1e9sL           -
1cs4C           -
2dpyB           -
1ak2A           -
1e59A           -
1cjtC           -
1c9kC           -
3crmA           -
1afrA           -
1e9rG           -
1e2lB           -
3b55A           -
2e85B           -
1e9sM           -
2cdnA           -
2a1fD           -
1e2iA           -
1e3mA           -
2czvB           -
2dpyA           -
1e9sA           -
2bjbA           -
2aexA           -
3d3qB           -
1dekA           -
3dffA           -
3e8aC           -
1e2iB           -
3c14C           -
1e4vA           -
3a00B           -
3cphA           -
3c15C           -
2bwjB           -
3bjqB           -
2aumA           -
1eamA           -
1adoA           -
1e1qB           -
2b0lC           -
1chdA           -
3d1mA           -
1ek0A           -
2aunA           -
1cjuC           -
2bwjD           -
1e2jA           -
3cmuA           -