[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for sent8:ACF69275.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2dfuA.bssp"
#ERROR : Can't open dsspfile "2dfuD.bssp"
#ERROR : Can't open dsspfile "2dfuB.bssp"
#ERROR : Can't open dsspfile "2eb5E.bssp"
#ERROR : Can't open dsspfile "2eb4C.bssp"
#ERROR : Can't open dsspfile "2eb4D.bssp"
#ERROR : Can't open dsspfile "2eb5A.bssp"
#ERROR : Can't open dsspfile "2eb4A.bssp"
#ERROR : Can't open dsspfile "2eb4B.bssp"
#ERROR : Can't open dsspfile "2eb6A.bssp"
#ERROR : Can't open dsspfile "2eb6D.bssp"
#ERROR : Can't open dsspfile "2eb5B.bssp"
#ERROR : Can't open dsspfile "3dgsB.bssp"
#ERROR : Can't open dsspfile "3dgsA.bssp"
#ERROR : Can't open dsspfile "2bh0A.bssp"

## Summary of PDB Search
:292
    2e-56  34%  2dfuA  [x.x.x] PROBABLE 2-HYDROXYHEPTA-2,4-DIENE-1,7-DIOATE
    4e-56  35%  2dfuD  [x.x.x] PROBABLE 2-HYDROXYHEPTA-2,4-DIENE-1,7-DIOATE
    1e-55  36%  2dfuB  [x.x.x] PROBABLE 2-HYDROXYHEPTA-2,4-DIENE-1,7-DIOATE
    2e-48  15%  2eb5E  [x.x.x] 2-OXO-HEPT-3-ENE-1,7-DIOATE HYDRATASE
    2e-45  15%  2eb4C  [x.x.x] 2-OXO-HEPT-3-ENE-1,7-DIOATE HYDRATASE
    4e-45  14%  2eb4D  [x.x.x] 2-OXO-HEPT-3-ENE-1,7-DIOATE HYDRATASE
    1e-44  15%  2eb5A  [x.x.x] 2-OXO-HEPT-3-ENE-1,7-DIOATE HYDRATASE
    4e-44  15%  2eb4A  [x.x.x] 2-OXO-HEPT-3-ENE-1,7-DIOATE HYDRATASE
    6e-44  15%  2eb4B  [x.x.x] 2-OXO-HEPT-3-ENE-1,7-DIOATE HYDRATASE
    8e-44  15%  2eb6A  [x.x.x] 2-OXO-HEPT-3-ENE-1,7-DIOATE HYDRATASE
    2e-43  15%  2eb6D  [x.x.x] 2-OXO-HEPT-3-ENE-1,7-DIOATE HYDRATASE
    5e-40  15%  2eb5B  [x.x.x] 2-OXO-HEPT-3-ENE-1,7-DIOATE HYDRATASE
    1e-38  10%  3dgsB  [x.x.x] COAT PROTEIN A
    1e-27   9%  3dgsA  [x.x.x] COAT PROTEIN A
    2e-17  12%  2bh0A  [x.x.x] YOAJ
:292

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKLVQYLVNGGKRYGIMQEIGIIDLSQRLGDKYPTLKSLLCANALTDAALWCDEPADYYYQEVTFLPVID
2dfuA           MKILRF---NEGRWGVLEGELVLETDGPGGNP---------------------TGRRYDLASVTLLPPAT
2dfuD           MKILRF---NEGRWGVLEGELVLET---------------------DGPGGNPTGRRYDLASVTLLPPAT
2dfuB           MKILRF---NEGRWGVLEGELVLETDGPGGN-----------------------PTGRRYASVTLLPPAT
2eb5E           ---------------------HTLIAQRL---DQAEKQREQIRAISLDYPEITIEDAYAVQR--EWVRLK
2eb4C           ---------------------HTLIAQRLDQAEKQREQIR---AISLDYPEITIEDAYAVQRVRLKIAEG
2eb4D           ---------------------HTLIAQRLDQAEKQREQIR-AISLDYPEITIEDAYAVQREWVRLKIAEG
2eb5A           ----------------FDKHTHTLIAQRL---DQAEKQREQIRAISLDYPEITIEDAYAVQRVRLKIAEG
2eb4A           ---------------------HTLIAQRL---DQAEKQREQIRAISLDYPEITIEDAYAVQRVRLKIAEG
2eb4B           ----------------FDKHTHTLIAQRL---DQAEKQREQIRAISLDYPEITIEDAYAVQRVRLKIAEG
2eb6A           -------------------------------------------AISLDYPEITIEDAYAVQRVRLKIAEG
2eb6D           ---------------------HTLIAQRLDQAEKQREQIR---AISLDYPEITIEDAYAVQRVRLKIAEG
2eb5B           ----------------FDKHTHTLIAQRLDQAEKQREQIR---AISLDYPEITIEDAYAVQRVRLKIAEG
3dgsB           ------------------------------------ESSLAKSHIEGSFVWKDDKTLDWYANEGILWKAT
3dgsA           -------------------------------------------------------------VVVITGDET
2bh0A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DPQKIICVGMNYADKRIEFNETNPAPTLFVRFADSQTGHNGLLLKPENTNEFDYEGELAVVIGRRCSRVS
2dfuA           -PTKIVCVGRNYRLPKEPGLFLKGPALARPGNPRDPWGTAEPVPYPFFTEELHYEGELAVVVGDRMRHVP
2dfuD           -PTKIVCVGRNYEPG---LFLKGPNALARPGNPRDPWGTAEPVPYPFFTEELHYEGELAVVVGDRMRHVP
2dfuB           -PTKIVCVGRNYPKEPGLFLKG-PNALARPGNPRDPWGTAEPVPYPFFTEELHYEGELAVVVGDRMRHVP
2eb5E           IAEGRTLKGHKIGLTSKAMQASQIEPDYGALLDDMFFHDGSDIPTDRFI-VPRIEVELAFVLAKPLRNCT
2eb4C           RTLKGHKIGLTSKAMQASSQ--ISEPDYGALLDDMFFHDGSDIPTDRFI-VPRIEVELAFVLAKPLRNCT
2eb4D           RTLKGHKIGLTSKAMQASSQISEPDY--GALLDDMFFHDGSDIPTDRFI-VPRIEVELAFVLAKPLRNCT
2eb5A           RTLKGHKIGLTSKAMQASSQ--ISEPDYGALLDDMFFHDGSDIPTDRFI-VPRIEVELAFVLAKPLRNCT
2eb4A           RTLKGHKIGLTSKAMQASSQIS--EPDYGALLDDMFFHDGSDIPTDRFI-VPRIEVELAFVLAKPLRNCT
2eb4B           RTLKGHKIGLTSKAMQASSQIS--EPDYGALLDDMFFHDGSDIPTDRFI-VPRIEVELAFVLAKPLRNCT
2eb6A           RTLKGHKIGLTSKAMQASSQ--ISEPDYGALLDDMFFHDGSDIPTDRFI-VPRIEVELAFVLAKPLRNCT
2eb6D           RTLKGHKIGLTSKAMQASSQIS--EPDYGALLDDMFFHDGSDIPTDRFI-VPRIEVELAFVLAKRGPNCT
2eb5B           RTLKGHKIGLTSKAMQASSQISEP--DYGALLDDMFFHDGSDIPTDRFIV-PRIEVELAFVLAKPLRNCT
3dgsB           GVVVITGDETQVYAIWVPVGDTPIPGYIYINPLDGTYPPGTEQNPANPNPSLEESHPLNTFMFQGNRFRN
3dgsA           QVYAIWVPVGLAIPENEYGDTPIP-GYIYINPLDGTYPPGTEQNPANPNPSLEESHPLNTFMFQGNRFRN
2bh0A           -------------------------------------------------------------ITGNFTYRI


                         +         .         .         .         .         *         .:210
query           AEDALDYVAGYSCYMDGSVRDWQHSWFTAGKNWPSTGSFGPCLVTTDDIPDPQMLRLLTRLNGREVQNES
2dfuA           PEKALDHVLGYTVAVDITARDVQKKDWVRAKSADKFLPLGPWLETDL---NPQDTWVRTYVNGTLRQEGH
2dfuD           PEKALDHVLGYTVAVDITARDVQKKDWVRAKSADKFLPLGPWLETDL---NPQDTWVRTYVNGTLRQEGH
2dfuB           PEKALDHVLGYTVAVDITARDVQKKDWVRAKSADKFLPLGPWLET---DLNPQDTWVRTYVNGTLRQEGH
2eb5E           LFDVYNATDYVIPALELIDARCHVFDTISDNAANAGVILGGRPIKPDEL-DLRWISALMYRNGVIEETGV
2eb4C           LFDVYNATDYVIPALELIDARCHNFDTISDNAANAGVILGGRPIKPDEL-DLRWISALMYRNGVIEETGV
2eb4D           LFDVYNATDYVIPALELIDARCHNFDTISDNAANAGVILGGRPIKPDEL-DLRWISALMYRNGVIEETGV
2eb5A           LFDVYNATDYVIPALELIDARCHVFDTISDNAANAGVILGGRPIKPDEL-DLRWISALMYRNGVIEETGV
2eb4A           LFDVYNATDYVIPALELIDARCHVFDTISDNAANAGVILGGRPIKPDEL-DLRWISALMYRNGVIEETGV
2eb4B           LFDVYNATDYVIPALELIDARCHNIDTISDNAANAGVILGGRPIKPDEL-DLRWISALMYRNGVIEETGV
2eb6A           LFDVYNATDYVIPALELIDARCHNIDPRPRKVFDTISDLGGRPIKPDEL-DLRWISALMYRNGVIEETGV
2eb6D           LFDVYNATDYVIPALELIDARCHNIDPISDNAANAGVILGGRPIKPDEL-DLRWISALMYRNGVIEETGV
2eb5B           LFDVYNATDYVIPALELIDARCHNIDTISDNAANAGVILGGRPIKPD-ELDLRWISALMYRNGVIEETGV
3dgsB           RQGALTVYTGTVT--QGTDPVKTYYQYTPVSSKAMYDA--YWNGKFRDVAFHSGFNEDPLVAE---YQGQ
3dgsA           RQGALTVYTGT-VTQGTDPVKTYYQYTPVSSKAYWNGKFRDVAFHSGFNEDPLVAEYQGQLSY-------
2bh0A           KEGSSRWWAAIQVRNHKYPVKEYEKWINEKDYNHF----------VSTNLGTGSLKVRTDIRGK------


                         .         .         .         +         .         .         .:280
query           TANMIHPIASLIAYISTFTLLSPGDTILTGSPGGVGKKRVPPLFLHDGDVIEVEIEHIGTLRNVVRDSRx
2dfuA           TSQMIFSVAEILSYISTFMTLEPLDVVLTGTPEGVG-------ALRPGDRLEVAVEGVGTLFTLIGPKE-
2dfuD           TSQMIFSVAEILSYISTFMTLEPLDVVLTGTPEGVG-------ALRPGDRLEVAVEGVGTLFTLIGPKE-
2dfuB           TSQMIFSVAEILSYISTFMTLEPLDVVLTGTPEGVG-------ALRPGDRLEVAVEGVGTLFTLIGPKE-
2eb5E           AAGVLNHPANGVAWLANKLALEAGQIILGGSFTRPV-------PARKGDTFHVDYGNMGSISCRF-----
2eb4C           AAGVLNHPANGVAWLANKLALEAGQIILGGSFTRPV-------PARKGDTFHVDYGNMGSISCRF-----
2eb4D           AAGVLNHPANGVAWLANKVQLEAGQIILGGSFTRPV-------PARKGDTFHVDYGNMGSISCRF-----
2eb5A           AAGVLNHPANGVAWLANKVQLEAGQIILGGSFTRPV-------PARKGDTFHVDYGNMGSISCRF-----
2eb4A           AAGVLNHPANGVAWLANKVQLEAGQIILGGSFTRPV-------PARKGDTFHVDYGNMGSISCRF-----
2eb4B           AAGVLNHPANGVAWLANKVQLEAGQIILGGSFTRPV-------PARKGDTFHVDYGNMGSISCRF-----
2eb6A           AAGVLNHPANGVAWLANKVQLEAGQIILGGSFTRPV-------PARKGDTFHVDYGNMGSISCRF-----
2eb6D           AAGVLNHPANGVAWLANKLALEAGQIILGGSFTRPV-------PARKGDTFHVDYGNMGSISCRF-----
2eb5B           AAGVLNHPANGVAWLANKVQLEAGQIILGGSFTRPV-------PARKGDTFHVDYGNMGSISCRF-----
3dgsB           LSYLPQPPV-------------------------------------------------------------
3dgsA           ----------------------------------------------------------------------
2bh0A           --VVKDTIPKLPESGTSKAYTVPGHVQFP-----------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxx
2dfuA           ------------
2dfuD           ------------
2dfuB           ------------
2eb5E           ------------
2eb4C           ------------
2eb4D           ------------
2eb5A           ------------
2eb4A           ------------
2eb4B           ------------
2eb6A           ------------
2eb6D           ------------
2eb5B           ------------
3dgsB           ------------
3dgsA           ------------
2bh0A           ------------