[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for sent8:ACF69484.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "2dwoA.bssp"
#ERROR : Can't open dsspfile "3dmdC.bssp"
#ERROR : Can't open dsspfile "2dwpA.bssp"
#ERROR : Can't open dsspfile "3c95A.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "3cmvH.bssp"
#ERROR : Can't open dsspfile "3cmvG.bssp"
#ERROR : Can't open dsspfile "2ccgA.bssp"
#ERROR : Can't open dsspfile "2akaB.bssp"
#ERROR : Can't open dsspfile "1bifA.bssp"
#ERROR : Can't open dsspfile "2ccjB.bssp"
#ERROR : Can't open dsspfile "2bifA.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "2ccgB.bssp"
#ERROR : Can't open dsspfile "2czvA.bssp"
#ERROR : Can't open dsspfile "3dmdB.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "2c61B.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "3cmvC.bssp"
#ERROR : Can't open dsspfile "4dcgA.bssp"
#ERROR : Can't open dsspfile "3cmvA.bssp"
#ERROR : Can't open dsspfile "2dr3A.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "3eiuB.bssp"
#ERROR : Can't open dsspfile "1e9cA.bssp"
#ERROR : Can't open dsspfile "3czpB.bssp"
#ERROR : Can't open dsspfile "2a2zD.bssp"
#ERROR : Can't open dsspfile "1e9fA.bssp"
#ERROR : Can't open dsspfile "2b8wA.bssp"
#ERROR : Can't open dsspfile "2c03A.bssp"
#ERROR : Can't open dsspfile "1e98A.bssp"
#ERROR : Can't open dsspfile "2b8tA.bssp"
#ERROR : Can't open dsspfile "1d1cA.bssp"
#ERROR : Can't open dsspfile "2a30D.bssp"
#ERROR : Can't open dsspfile "3eiuA.bssp"
#ERROR : Can't open dsspfile "2cjwB.bssp"
#ERROR : Can't open dsspfile "2dr3E.bssp"
#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "2bc9A.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"
#ERROR : Can't open dsspfile "1e9sF.bssp"
#ERROR : Can't open dsspfile "3dm5A.bssp"
#ERROR : Can't open dsspfile "1e9sG.bssp"
#ERROR : Can't open dsspfile "2a2zA.bssp"
#ERROR : Can't open dsspfile "1cr4A.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "3d3kA.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "3bb1B.bssp"
#ERROR : Can't open dsspfile "3b2qA.bssp"
#ERROR : Can't open dsspfile "1e9dA.bssp"
#ERROR : Can't open dsspfile "3b85A.bssp"
#ERROR : Can't open dsspfile "3bpbA.bssp"
#ERROR : Can't open dsspfile "2c9oC.bssp"
#ERROR : Can't open dsspfile "2cgtH.bssp"
#ERROR : Can't open dsspfile "2c04A.bssp"
#ERROR : Can't open dsspfile "2b92B.bssp"
#ERROR : Can't open dsspfile "2a5gA.bssp"
#ERROR : Can't open dsspfile "2c61A.bssp"
#ERROR : Can't open dsspfile "1aroP.bssp"
#ERROR : Can't open dsspfile "2c9yA.bssp"
#ERROR : Can't open dsspfile "2d4hB.bssp"
#ERROR : Can't open dsspfile "3b2qB.bssp"
#ERROR : Can't open dsspfile "1ai4B.bssp"
#ERROR : Can't open dsspfile "3a1wA.bssp"
#ERROR : Can't open dsspfile "3cr7C.bssp"
#ERROR : Can't open dsspfile "2bdtA.bssp"
#ERROR : Can't open dsspfile "2axzC.bssp"
#ERROR : Can't open dsspfile "1e9sD.bssp"
#ERROR : Can't open dsspfile "1bg0A.bssp"
#ERROR : Can't open dsspfile "2a30B.bssp"
#ERROR : Can't open dsspfile "1e2fA.bssp"
#ERROR : Can't open dsspfile "3dt4A.bssp"
#ERROR : Can't open dsspfile "2ctsA.bssp"
#ERROR : Can't open dsspfile "3bb1E.bssp"
#ERROR : Can't open dsspfile "3dt2A.bssp"
#ERROR : Can't open dsspfile "421pA.bssp"
#ERROR : Can't open dsspfile "3d7wA.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "1e4yA.bssp"
#ERROR : Can't open dsspfile "1dg3A.bssp"
#ERROR : Can't open dsspfile "2d4hA.bssp"
#ERROR : Can't open dsspfile "1e9sJ.bssp"
#ERROR : Can't open dsspfile "1dkiA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "2axpA.bssp"
#ERROR : Can't open dsspfile "2b8tB.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "2dr3B.bssp"
#ERROR : Can't open dsspfile "3cr7A.bssp"
#ERROR : Can't open dsspfile "2b8tC.bssp"
#ERROR : Can't open dsspfile "2a5jA.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "2a30A.bssp"
#ERROR : Can't open dsspfile "3adkA.bssp"
#ERROR : Can't open dsspfile "3cddD.bssp"
#ERROR : Can't open dsspfile "1e3aB.bssp"
#ERROR : Can't open dsspfile "3cmtD.bssp"
#ERROR : Can't open dsspfile "3bo6B.bssp"
#ERROR : Can't open dsspfile "3cddF.bssp"
#ERROR : Can't open dsspfile "1e0jA.bssp"
#ERROR : Can't open dsspfile "3dm9B.bssp"
#ERROR : Can't open dsspfile "3da4A.bssp"
#ERROR : Can't open dsspfile "2c4rL.bssp"
#ERROR : Can't open dsspfile "1cr2A.bssp"
#ERROR : Can't open dsspfile "2ahwD.bssp"
#ERROR : Can't open dsspfile "2b8wB.bssp"
#ERROR : Can't open dsspfile "1e0jB.bssp"
#ERROR : Can't open dsspfile "3czpA.bssp"
#ERROR : Can't open dsspfile "3cmxA.bssp"
#ERROR : Can't open dsspfile "3dtbB.bssp"
#ERROR : Can't open dsspfile "2a2zB.bssp"
#ERROR : Can't open dsspfile "3bb1C.bssp"
#ERROR : Can't open dsspfile "1e9rE.bssp"
#ERROR : Can't open dsspfile "1av6A.bssp"
#ERROR : Can't open dsspfile "3bb1F.bssp"
#ERROR : Can't open dsspfile "2akaA.bssp"
#ERROR : Can't open dsspfile "2bjbA.bssp"
#ERROR : Can't open dsspfile "3cioD.bssp"
#ERROR : Can't open dsspfile "2d4uA.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "1e2kA.bssp"
#ERROR : Can't open dsspfile "2dr3F.bssp"
#ERROR : Can't open dsspfile "2c0bL.bssp"
#ERROR : Can't open dsspfile "1d6jB.bssp"
#ERROR : Can't open dsspfile "3cr7D.bssp"
#ERROR : Can't open dsspfile "3clvA.bssp"
#ERROR : Can't open dsspfile "1e59A.bssp"
#ERROR : Can't open dsspfile "3dfpC.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1e3mB.bssp"
#ERROR : Can't open dsspfile "1e9sB.bssp"
#ERROR : Can't open dsspfile "3dfnC.bssp"
#ERROR : Can't open dsspfile "1e3mA.bssp"
#ERROR : Can't open dsspfile "2eg5G.bssp"
#ERROR : Can't open dsspfile "2ahvA.bssp"
#ERROR : Can't open dsspfile "3dfoD.bssp"
#ERROR : Can't open dsspfile "3bgwA.bssp"
#ERROR : Can't open dsspfile "3dfqD.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"
#ERROR : Can't open dsspfile "2ausC.bssp"
#ERROR : Can't open dsspfile "1e9rD.bssp"
#ERROR : Can't open dsspfile "3cddC.bssp"
#ERROR : Can't open dsspfile "2bkiA.bssp"
#ERROR : Can't open dsspfile "3cmvE.bssp"
#ERROR : Can't open dsspfile "3dftD.bssp"
#ERROR : Can't open dsspfile "3dfpD.bssp"
#ERROR : Can't open dsspfile "3dt7A.bssp"
#ERROR : Can't open dsspfile "1cr1A.bssp"
#ERROR : Can't open dsspfile "3dfqA.bssp"
#ERROR : Can't open dsspfile "1dhjA.bssp"
#ERROR : Can't open dsspfile "1aldA.bssp"
#ERROR : Can't open dsspfile "2dr3C.bssp"
#ERROR : Can't open dsspfile "2dflA.bssp"
#ERROR : Can't open dsspfile "3ch4B.bssp"
#ERROR : Can't open dsspfile "3dfnA.bssp"
#ERROR : Can't open dsspfile "1cs4C.bssp"
#ERROR : Can't open dsspfile "1adoA.bssp"
#ERROR : Can't open dsspfile "3dfnD.bssp"
#ERROR : Can't open dsspfile "2bwjA.bssp"
#ERROR : Can't open dsspfile "6aldA.bssp"
#ERROR : Can't open dsspfile "3dftC.bssp"
#ERROR : Can't open dsspfile "2bx2L.bssp"
#ERROR : Can't open dsspfile "1cjtC.bssp"
#ERROR : Can't open dsspfile "2a1fF.bssp"
#ERROR : Can't open dsspfile "1e9sM.bssp"
#ERROR : Can't open dsspfile "3bh0A.bssp"
#ERROR : Can't open dsspfile "3dt4C.bssp"
#ERROR : Can't open dsspfile "3bb1A.bssp"
#ERROR : Can't open dsspfile "1ek0A.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "2bhjA.bssp"
#ERROR : Can't open dsspfile "3d3qA.bssp"
#ERROR : Can't open dsspfile "1bmfC.bssp"
#ERROR : Can't open dsspfile "3c8uA.bssp"
#ERROR : Can't open dsspfile "2c7cH.bssp"
#ERROR : Can't open dsspfile "3dfqC.bssp"
#ERROR : Can't open dsspfile "2d0kA.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"
#ERROR : Can't open dsspfile "3di4A.bssp"
#ERROR : Can't open dsspfile "1e9rF.bssp"
#ERROR : Can't open dsspfile "2czvB.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "3d3qB.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "3dfoC.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "3a00A.bssp"
#ERROR : Can't open dsspfile "3cmwC.bssp"
#ERROR : Can't open dsspfile "1e9sH.bssp"
#ERROR : Can't open dsspfile "2bkhA.bssp"
#ERROR : Can't open dsspfile "3bgwD.bssp"
#ERROR : Can't open dsspfile "3bjdB.bssp"
#ERROR : Can't open dsspfile "2cvfA.bssp"
#ERROR : Can't open dsspfile "3cnlA.bssp"
#ERROR : Can't open dsspfile "2bv7A.bssp"
#ERROR : Can't open dsspfile "3be4A.bssp"
#ERROR : Can't open dsspfile "3bczC.bssp"
#ERROR : Can't open dsspfile "3czjA.bssp"
#ERROR : Can't open dsspfile "2dr3D.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2bhvA.bssp"
#ERROR : Can't open dsspfile "1dw9A.bssp"
#ERROR : Can't open dsspfile "3dlbB.bssp"
#ERROR : Can't open dsspfile "1culC.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "3cm0A.bssp"
#ERROR : Can't open dsspfile "3dymA.bssp"
#ERROR : Can't open dsspfile "1cjaA.bssp"
#ERROR : Can't open dsspfile "1ak2A.bssp"
#ERROR : Can't open dsspfile "1dekB.bssp"
#ERROR : Can't open dsspfile "3bv4A.bssp"
#ERROR : Can't open dsspfile "1dhiA.bssp"
#ERROR : Can't open dsspfile "1eilA.bssp"
#ERROR : Can't open dsspfile "1e2gA.bssp"
#ERROR : Can't open dsspfile "3crmA.bssp"
#ERROR : Can't open dsspfile "1c9kC.bssp"
#ERROR : Can't open dsspfile "3c14C.bssp"
#ERROR : Can't open dsspfile "2ck3C.bssp"
#ERROR : Can't open dsspfile "1e9sL.bssp"
#ERROR : Can't open dsspfile "1bglA.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "3brwA.bssp"
#ERROR : Can't open dsspfile "3bb1G.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "2ccjA.bssp"
#ERROR : Can't open dsspfile "1e2hB.bssp"
#ERROR : Can't open dsspfile "3c15C.bssp"
#ERROR : Can't open dsspfile "2aunA.bssp"
#ERROR : Can't open dsspfile "1e2iA.bssp"
#ERROR : Can't open dsspfile "3cueF.bssp"
#ERROR : Can't open dsspfile "1akeA.bssp"
#ERROR : Can't open dsspfile "3ec1A.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "2aumA.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "2boeX.bssp"
#ERROR : Can't open dsspfile "1e9sI.bssp"
#ERROR : Can't open dsspfile "3dauA.bssp"
#ERROR : Can't open dsspfile "2aunB.bssp"
#ERROR : Can't open dsspfile "2bofX.bssp"
#ERROR : Can't open dsspfile "3bb1H.bssp"
#ERROR : Can't open dsspfile "3cmvB.bssp"
#ERROR : Can't open dsspfile "2dpyB.bssp"
#ERROR : Can't open dsspfile "3dvlD.bssp"
#ERROR : Can't open dsspfile "2d4uB.bssp"
#ERROR : Can't open dsspfile "1e9rG.bssp"
#ERROR : Can't open dsspfile "2bhvD.bssp"
#ERROR : Can't open dsspfile "3a00B.bssp"
#ERROR : Can't open dsspfile "2dpyA.bssp"
#ERROR : Can't open dsspfile "2drcA.bssp"
#ERROR : Can't open dsspfile "3dffA.bssp"
#ERROR : Can't open dsspfile "4atjA.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "1e9sE.bssp"
#ERROR : Can't open dsspfile "3dfdA.bssp"
#ERROR : Can't open dsspfile "2bkeA.bssp"
#ERROR : Can't open dsspfile "1cfrA.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "1eamA.bssp"
#ERROR : Can't open dsspfile "5dfrA.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "3d1mB.bssp"
#ERROR : Can't open dsspfile "4dfrA.bssp"
#ERROR : Can't open dsspfile "3d1mA.bssp"
#ERROR : Can't open dsspfile "3dyoA.bssp"
#ERROR : Can't open dsspfile "3cr7B.bssp"
#ERROR : Can't open dsspfile "2a1fD.bssp"
#ERROR : Can't open dsspfile "2ancF.bssp"
#ERROR : Can't open dsspfile "2dftA.bssp"
#ERROR : Can't open dsspfile "1draA.bssp"
#ERROR : Can't open dsspfile "1dyhA.bssp"
#ERROR : Can't open dsspfile "3ecpA.bssp"
#ERROR : Can't open dsspfile "2aumB.bssp"
#ERROR : Can't open dsspfile "3cbnA.bssp"
#ERROR : Can't open dsspfile "1e2nA.bssp"
#ERROR : Can't open dsspfile "3ed8A.bssp"
#ERROR : Can't open dsspfile "1e4vA.bssp"
#ERROR : Can't open dsspfile "1e2iB.bssp"
#ERROR : Can't open dsspfile "1d2zD.bssp"
#ERROR : Can't open dsspfile "3b55A.bssp"
#ERROR : Can't open dsspfile "3bwdD.bssp"
#ERROR : Can't open dsspfile "1e1qB.bssp"
#ERROR : Can't open dsspfile "3cnnA.bssp"
#ERROR : Can't open dsspfile "3c7kA.bssp"
#ERROR : Can't open dsspfile "2a1fC.bssp"
#ERROR : Can't open dsspfile "3cqcA.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "2b8tD.bssp"
#ERROR : Can't open dsspfile "1e2mB.bssp"
#ERROR : Can't open dsspfile "3cmuA.bssp"
#ERROR : Can't open dsspfile "3cphA.bssp"
#ERROR : Can't open dsspfile "2d7vA.bssp"
#ERROR : Can't open dsspfile "1dp0A.bssp"
#ERROR : Can't open dsspfile "3bb1D.bssp"
#ERROR : Can't open dsspfile "2anbA.bssp"
#ERROR : Can't open dsspfile "3bjqB.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "2d7vB.bssp"
#ERROR : Can't open dsspfile "1cjuC.bssp"
#ERROR : Can't open dsspfile "1cjvC.bssp"
#ERROR : Can't open dsspfile "1drbA.bssp"
#ERROR : Can't open dsspfile "2dftC.bssp"
#ERROR : Can't open dsspfile "3e8aC.bssp"
#ERROR : Can't open dsspfile "1e9sA.bssp"
#ERROR : Can't open dsspfile "1accA.bssp"
#ERROR : Can't open dsspfile "2ancD.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "3b85B.bssp"
#ERROR : Can't open dsspfile "2e85B.bssp"
#ERROR : Can't open dsspfile "1dvrA.bssp"
#ERROR : Can't open dsspfile "2a1fE.bssp"
#ERROR : Can't open dsspfile "3do6A.bssp"
#ERROR : Can't open dsspfile "1azsC.bssp"
#ERROR : Can't open dsspfile "3dm5B.bssp"
#ERROR : Can't open dsspfile "2a5vB.bssp"
#ERROR : Can't open dsspfile "2c9gA.bssp"
#ERROR : Can't open dsspfile "2cdnA.bssp"
#ERROR : Can't open dsspfile "2a5vA.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "3c7kC.bssp"
#ERROR : Can't open dsspfile "3c85A.bssp"
#ERROR : Can't open dsspfile "3bm2B.bssp"
#ERROR : Can't open dsspfile "2b0lC.bssp"
#ERROR : Can't open dsspfile "1chdA.bssp"
#ERROR : Can't open dsspfile "1e2nB.bssp"
#ERROR : Can't open dsspfile "1e9rB.bssp"
#ERROR : Can't open dsspfile "3cd9A.bssp"
#ERROR : Can't open dsspfile "1e2jA.bssp"
#ERROR : Can't open dsspfile "1d6aA.bssp"
#ERROR : Can't open dsspfile "3b9qA.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "2an9A.bssp"
#ERROR : Can't open dsspfile "1e2lA.bssp"
#ERROR : Can't open dsspfile "1e2mA.bssp"
#ERROR : Can't open dsspfile "3cbqA.bssp"
#ERROR : Can't open dsspfile "2aexA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "2ancB.bssp"
#ERROR : Can't open dsspfile "2a78A.bssp"
#ERROR : Can't open dsspfile "2c9oA.bssp"
#ERROR : Can't open dsspfile "2e85A.bssp"
#ERROR : Can't open dsspfile "1e9sK.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "1dwmA.bssp"
#ERROR : Can't open dsspfile "3ci2A.bssp"
#ERROR : Can't open dsspfile "1agpA.bssp"
#ERROR : Can't open dsspfile "3dkvA.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "1e2kB.bssp"
#ERROR : Can't open dsspfile "2bwjB.bssp"
#ERROR : Can't open dsspfile "2ax4B.bssp"
#ERROR : Can't open dsspfile "2bhvC.bssp"
#ERROR : Can't open dsspfile "3bs4A.bssp"
#ERROR : Can't open dsspfile "2cfsA.bssp"
#ERROR : Can't open dsspfile "1brwA.bssp"
#ERROR : Can't open dsspfile "3csuA.bssp"
#ERROR : Can't open dsspfile "2c5mD.bssp"
#ERROR : Can't open dsspfile "3cddA.bssp"
#ERROR : Can't open dsspfile "2axnA.bssp"
#ERROR : Can't open dsspfile "2ekbA.bssp"
#ERROR : Can't open dsspfile "2ax4A.bssp"
#ERROR : Can't open dsspfile "3dmdA.bssp"
#ERROR : Can't open dsspfile "2c95B.bssp"
#ERROR : Can't open dsspfile "3e70C.bssp"
#ERROR : Can't open dsspfile "1e2lB.bssp"
#ERROR : Can't open dsspfile "1dapA.bssp"
#ERROR : Can't open dsspfile "1e2jB.bssp"
#ERROR : Can't open dsspfile "3cddB.bssp"
#ERROR : Can't open dsspfile "3bb4A.bssp"
#ERROR : Can't open dsspfile "2c9oB.bssp"
#ERROR : Can't open dsspfile "3cr8B.bssp"
#ERROR : Can't open dsspfile "2bwjD.bssp"

## Summary of PDB Search
:648
    2e-47  29%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    4e-41   6%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    1e-39  14%  3dmdC  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    8e-39   7%  2dwpA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    1e-38  10%  3c95A  [x.x.x] EXODEOXYRIBONUCLEASE I
    2e-37  16%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-37  12%  3cmvH  [x.x.x] PROTEIN RECA
    6e-36  12%  3cmvG  [x.x.x] PROTEIN RECA
    5e-35  13%  2ccgA  [x.x.x] THYMIDYLATE KINASE
    5e-35  10%  2akaB  [x.x.x] DYNAMIN-1
    2e-34   6%  1bifA  [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/
    5e-34  10%  2ccjB  [x.x.x] THYMIDYLATE KINASE
    2e-33   6%  2bifA  [c.37.1 - c.60.1] PROTEIN
    5e-33  21%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-33  11%  2ccgB  [x.x.x] THYMIDYLATE KINASE
    9e-33  10%  2czvA  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    2e-32  13%  3dmdB  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    3e-32  18%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    5e-32   9%  2c61B  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    6e-32  17%  1e69A  [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN
    9e-32  10%  3cmvC  [x.x.x] PROTEIN RECA
    2e-31   8%  4dcgA  [x.x.x] VP39
    4e-31  12%  3cmvA  [x.x.x] PROTEIN RECA
    6e-31  12%  2dr3A  [x.x.x] UPF0273 PROTEIN PH0284
    7e-31  27%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN
    8e-31   9%  3eiuB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    1e-30   8%  1e9cA  [c.37.1] THYMIDYLATE KINASE
    2e-30  11%  3czpB  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    2e-30  12%  2a2zD  [x.x.x] DEOXYCYTIDINE KINASE
    3e-30   9%  1e9fA  [c.37.1] THYMIDYLATE KINASE
    8e-30  16%  2b8wA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    9e-30  16%  2c03A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    1e-29   7%  1e98A  [c.37.1] THYMIDYLATE KINASE
    2e-29  10%  2b8tA  [x.x.x] THYMIDINE KINASE
    2e-29   9%  1d1cA  [c.37.1 - b.34.3] MYOSIN
    3e-29  14%  2a30D  [x.x.x] DEOXYCYTIDINE KINASE
    3e-29   9%  3eiuA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    4e-29  13%  2cjwB  [x.x.x] GTP-BINDING PROTEIN GEM
    2e-28  13%  2dr3E  [x.x.x] UPF0273 PROTEIN PH0284
    3e-28   8%  1e2dA  [c.37.1] THYMIDYLATE KINASE
    3e-28  15%  2bc9A  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    5e-28  10%  2cckA  [x.x.x] THYMIDYLATE KINASE
    5e-28  13%  1e9sF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    7e-28  13%  3dm5A  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    2e-27  13%  1e9sG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-27  10%  2a2zA  [x.x.x] DEOXYCYTIDINE KINASE
    2e-27  12%  1cr4A  [c.37.1] DNA PRIMASE/HELICASE
    3e-27  16%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-27  24%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    3e-27  11%  3d3kA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
    4e-27  10%  1e9rA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-27  10%  3bb1B  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    5e-27  10%  3b2qA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    9e-27   8%  1e9dA  [c.37.1] THYMIDYLATE KINASE
    1e-26  11%  3b85A  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    1e-26   9%  3bpbA  [x.x.x] DIMETHYLARGININE DIMETHYLAMINOHYDROLASE
    3e-26  13%  2c9oC  [x.x.x] RUVB-LIKE 1
    4e-26   9%  2cgtH  [x.x.x] 60 KDA GROEL
    6e-26  16%  2c04A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    7e-26  13%  2b92B  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-25   9%  2a5gA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    2e-25   8%  2c61A  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    2e-25   7%  1aroP  [e.8.1] T7 RNA POLYMERASE
    2e-25   9%  2c9yA  [x.x.x] ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL
    3e-25  12%  2d4hB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    3e-25   9%  3b2qB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    3e-25  10%  1ai4B  [d.153.1] PENICILLIN AMIDOHYDROLASE
    3e-25  10%  3a1wA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    3e-25  14%  3cr7C  [x.x.x] ADENYLYL-SULFATE KINASE
    4e-25  11%  2bdtA  [x.x.x] BH3686
    6e-25  10%  2axzC  [x.x.x] PRGX
    9e-25  12%  1e9sD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-24  10%  1bg0A  [a.83.1 - d.128.1 (1m15A)] ARGININE KINASE
    2e-24  14%  2a30B  [x.x.x] DEOXYCYTIDINE KINASE
    2e-24   8%  1e2fA  [c.37.1] THYMIDYLATE KINASE
    3e-24   9%  3dt4A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    5e-24   9%  2ctsA  [x.x.x] CITRATE SYNTHASE
    9e-24   6%  3bb1E  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-23   8%  3dt2A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    1e-23  13%  421pA  [x.x.x] H-RAS P21 PROTEIN
    1e-23  12%  3d7wA  [x.x.x] BETA-GALACTOSIDE-SPECIFIC LECTIN 1
    2e-23  20%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-23  10%  1e4yA  [c.37.1 - g.41.2] ADENYLATE KINASE
    2e-23  13%  1dg3A  [c.37.1 - a.114.1] PROTEIN (INTERFERON-INDUCED
    2e-23  14%  2d4hA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    4e-23  13%  1e9sJ  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-23   9%  1dkiA  [d.3.1] PYROGENIC EXOTOXIN B ZYMOGEN
    6e-23  27%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    6e-23  11%  2axpA  [x.x.x] HYPOTHETICAL PROTEIN BSU20280
    8e-23   9%  2b8tB  [x.x.x] THYMIDINE KINASE
    9e-23  31%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    1e-22  11%  2dr3B  [x.x.x] UPF0273 PROTEIN PH0284
    1e-22  13%  3cr7A  [x.x.x] ADENYLYL-SULFATE KINASE
    2e-22  10%  2b8tC  [x.x.x] THYMIDINE KINASE
    2e-22  12%  2a5jA  [x.x.x] RAS-RELATED PROTEIN RAB-2B
    2e-22  21%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-22  14%  2a30A  [x.x.x] DEOXYCYTIDINE KINASE
    3e-22  10%  3adkA  [x.x.x] ADENYLATE KINASE
    4e-22   8%  3cddD  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    4e-22  10%  1e3aB  [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT
    6e-22  15%  3cmtD  [x.x.x] PROTEIN RECA
    1e-21   9%  3bo6B  [x.x.x] HYDROPHILIC PROTEIN, VIRA PROTEIN
    1e-21  11%  3cddF  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    1e-21  10%  1e0jA  [c.37.1] DNA HELICASE
    2e-21  16%  3dm9B  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    2e-21   9%  3da4A  [x.x.x] COLICIN-M
    2e-21   4%  2c4rL  [x.x.x] RIBONUCLEASE E
    3e-21  13%  1cr2A  [c.37.1] DNA PRIMASE/HELICASE
    3e-21   6%  2ahwD  [x.x.x] PUTATIVE ENZYME YDIF
    3e-21  13%  2b8wB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    3e-21  11%  1e0jB  [c.37.1] DNA HELICASE
    4e-21  11%  3czpA  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    4e-21  13%  3cmxA  [x.x.x] PROTEIN RECA
    4e-21   8%  3dtbB  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    4e-21  13%  2a2zB  [x.x.x] DEOXYCYTIDINE KINASE
    5e-21   7%  3bb1C  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    6e-21  13%  1e9rE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-21   9%  1av6A  [c.66.1] PROTEIN (VP39 PROTEIN (E.C.2.7.7.19))
    7e-21   7%  3bb1F  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    8e-21  13%  2akaA  [x.x.x] MYOSIN II HEAVY CHAIN
    9e-21  10%  2bjbA  [x.x.x] 3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE
    9e-21  10%  3cioD  [x.x.x] TYROSINE-PROTEIN KINASE ETK
    1e-20  11%  2d4uA  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    1e-20  32%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-20  12%  1e2kA  [c.37.1] THYMIDINE KINASE
    2e-20  12%  2dr3F  [x.x.x] UPF0273 PROTEIN PH0284
    2e-20   8%  2c0bL  [x.x.x] RIBONUCLEASE E
    2e-20  16%  1d6jB  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    2e-20  13%  3cr7D  [x.x.x] ADENYLYL-SULFATE KINASE
    2e-20  10%  3clvA  [x.x.x] RAB5 PROTEIN, PUTATIVE
    3e-20  10%  1e59A  [c.60.1] PHOSPHOGLYCERATE MUTASE
    3e-20  13%  3dfpC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-20  10%  1e6cA  [c.37.1] SHIKIMATE KINASE
    3e-20   6%  1e3mB  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    3e-20  10%  1e9sB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-20  15%  3dfnC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-20   6%  1e3mA  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    4e-20   6%  2eg5G  [x.x.x] XANTHOSINE METHYLTRANSFERASE
    4e-20   8%  2ahvA  [x.x.x] PUTATIVE ENZYME YDIF
    5e-20  13%  3dfoD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    6e-20   7%  3bgwA  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    6e-20  13%  3dfqD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    6e-20   7%  2cckB  [x.x.x] THYMIDYLATE KINASE
    8e-20  11%  2ausC  [x.x.x] PSEUDOURIDINE SYNTHASE
    8e-20  12%  1e9rD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    8e-20   9%  3cddC  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    9e-20   7%  2bkiA  [x.x.x] UNCONVENTIONAL MYOSIN
    9e-20  10%  3cmvE  [x.x.x] PROTEIN RECA
    1e-19  17%  3dftD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-19  13%  3dfpD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-19   8%  3dt7A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    1e-19  14%  1cr1A  [c.37.1] DNA PRIMASE/HELICASE
    2e-19  13%  3dfqA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-19  15%  1dhjA  [c.71.1] DIHYDROFOLATE REDUCTASE
    2e-19  13%  1aldA  [c.1.10 (2aldA)] ALDOLASE A
    2e-19  13%  2dr3C  [x.x.x] UPF0273 PROTEIN PH0284
    2e-19  12%  2dflA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    2e-19   9%  3ch4B  [x.x.x] PHOSPHOMEVALONATE KINASE
    3e-19  13%  3dfnA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-19  12%  1cs4C  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    5e-19  16%  1adoA  [c.1.10] ALDOLASE
    5e-19  15%  3dfnD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    5e-19  13%  2bwjA  [x.x.x] ADENYLATE KINASE 5
    6e-19  13%  6aldA  [c.1.10] FRUCTOSE-1,6-BIS(PHOSPHATE) ALDOLASE
    6e-19  13%  3dftC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    6e-19   9%  2bx2L  [x.x.x] RIBONUCLEASE E
    8e-19  12%  1cjtC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    1e-18  13%  2a1fF  [x.x.x] URIDYLATE KINASE
    1e-18  10%  1e9sM  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-18   7%  3bh0A  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    3e-18   9%  3dt4C  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    3e-18   9%  3bb1A  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    4e-18  11%  1ek0A  [c.37.1] PROTEIN (GTP-BINDING PROTEIN YPT51)
    4e-18  13%  1d6jA  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    5e-18   6%  2bhjA  [x.x.x] NITRIC OXIDE SYNTHASE
    6e-18   9%  3d3qA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    6e-18  10%  1bmfC  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    6e-18  14%  3c8uA  [x.x.x] FRUCTOKINASE
    7e-18  11%  2c7cH  [x.x.x] 60 KDA CHAPERONIN
    7e-18  12%  3dfqC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    7e-18  15%  2d0kA  [x.x.x] DIHYDROFOLATE REDUCTASE
    7e-18   9%  1dekA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    9e-18   7%  3di4A  [x.x.x] UNCHARACTERIZED PROTEIN DUF1989
    1e-17  13%  1e9rF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-17   4%  2czvB  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    1e-17  13%  1cr0A  [c.37.1] DNA PRIMASE/HELICASE
    2e-17  10%  3d3qB  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    2e-17  29%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-17  12%  3dfoC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-17  27%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    3e-17  16%  3a00A  [x.x.x] GUANYLATE KINASE
    3e-17  13%  3cmwC  [x.x.x] PROTEIN RECA
    3e-17  12%  1e9sH  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-17   6%  2bkhA  [x.x.x] UNCONVENTIONAL MYOSIN
    3e-17   7%  3bgwD  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    4e-17  13%  3bjdB  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)
    5e-17  10%  2cvfA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB
    5e-17  15%  3cnlA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    5e-17  13%  2bv7A  [x.x.x] GLYCOLIPID TRANSFER PROTEIN
    6e-17   6%  3be4A  [x.x.x] ADENYLATE KINASE
    7e-17   7%  3bczC  [x.x.x] PROTEIN MEMO1
    7e-17   7%  3czjA  [x.x.x] BETA-GALACTOSIDASE
    8e-17  12%  2dr3D  [x.x.x] UPF0273 PROTEIN PH0284
    9e-17  33%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-16  10%  2bhvA  [x.x.x] COMB10
    1e-16   7%  1dw9A  [a.35.1 - d.72.1] CYANATE LYASE
    1e-16   7%  3dlbB  [x.x.x] ARGONAUTE
    1e-16  14%  1culC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    1e-16  31%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    2e-16  15%  3cm0A  [x.x.x] ADENYLATE KINASE
    2e-16   5%  3dymA  [x.x.x] BETA-GALACTOSIDASE
    3e-16   8%  1cjaA  [d.144.1] PROTEIN (ACTIN-FRAGMIN KINASE)
    4e-16  11%  1ak2A  [x.x.x] ADENYLATE KINASE ISOENZYME-2
    4e-16   9%  1dekB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    5e-16  13%  3bv4A  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    5e-16  13%  1dhiA  [c.71.1] DIHYDROFOLATE REDUCTASE
    5e-16  12%  1eilA  [d.32.1 - d.32.1] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE
    5e-16   8%  1e2gA  [c.37.1] THYMIDYLATE KINASE
    5e-16   9%  3crmA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    7e-16  10%  1c9kC  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    9e-16  14%  3c14C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    9e-16  11%  2ck3C  [x.x.x] ATP SYNTHASE ALPHA CHAIN HEART ISOFORM
    1e-15  10%  1e9sL  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-15   5%  1bglA  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    1e-15  19%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-15  20%  2d2eA  [x.x.x] SUFC PROTEIN
    2e-15  12%  3brwA  [x.x.x] RAP1 GTPASE-ACTIVATING PROTEIN 1
    2e-15   7%  3bb1G  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-15  20%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-15  11%  2ccjA  [x.x.x] THYMIDYLATE KINASE
    2e-15  11%  1e2hB  [c.37.1] THYMIDINE KINASE
    2e-15  13%  3c15C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    3e-15   9%  2aunA  [x.x.x] HYPOTHETICAL PROTEIN
    3e-15   8%  1e2iA  [c.37.1] THYMIDINE KINASE
    4e-15  12%  3cueF  [x.x.x] GTP-BINDING PROTEIN YPT1
    7e-15  10%  1akeA  [c.37.1 - g.41.2] ADENYLATE KINASE
    7e-15  12%  3ec1A  [x.x.x] YQEH GTPASE
    9e-15  31%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-15  10%  2aumA  [x.x.x] HYPOTHETICAL PROTEIN
    9e-15  17%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-14  14%  2boeX  [x.x.x] ENDOGLUCANASE E-2
    1e-14  13%  1e9sI  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-14  14%  3dauA  [c.71.1 (1ddrA)] DIHYDROFOLATE REDUCTASE
    1e-14  14%  2aunB  [x.x.x] HYPOTHETICAL PROTEIN
    2e-14   9%  2bofX  [x.x.x] ENDOGLUCANASE E-2
    2e-14   7%  3bb1H  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    3e-14  11%  3cmvB  [x.x.x] PROTEIN RECA
    3e-14   9%  2dpyB  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    3e-14  14%  3dvlD  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    4e-14  12%  2d4uB  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    4e-14  15%  1e9rG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-14  11%  2bhvD  [x.x.x] COMB10
    5e-14  15%  3a00B  [x.x.x] GUANYLATE KINASE
    5e-14  10%  2dpyA  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    6e-14  14%  2drcA  [c.71.1] DIHYDROFOLATE REDUCTASE
    7e-14   9%  3dffA  [x.x.x] TEICOPLANIN PSEUDOAGLYCONE DEACETYLASES ORF2
    8e-14  10%  4atjA  [a.93.1] PROTEIN (PEROXIDASE C1A)
    9e-14  21%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-13   8%  1e9sE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-13   8%  3dfdA  [x.x.x] PROTEIN YQBN
    2e-13  12%  2bkeA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    2e-13  12%  1cfrA  [x.x.x] RESTRICTION ENDONUCLEASE
    2e-13  15%  1ckvA  [x.x.x] PROTEIN (PROTEIN B)
    3e-13  11%  1eamA  [c.66.1] PROTEIN (VP39)
    3e-13  15%  5dfrA  [x.x.x] DIHYDROFOLATE REDUCTASE
    3e-13  30%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-13  12%  3d1mB  [x.x.x] SONIC HEDGEHOG PROTEIN
    5e-13  18%  4dfrA  [c.71.1] DIHYDROFOLATE REDUCTASE
    6e-13  13%  3d1mA  [x.x.x] SONIC HEDGEHOG PROTEIN
    6e-13   5%  3dyoA  [x.x.x] BETA-GALACTOSIDASE
    7e-13  11%  3cr7B  [x.x.x] ADENYLYL-SULFATE KINASE
    7e-13  14%  2a1fD  [x.x.x] URIDYLATE KINASE
    8e-13  11%  2ancF  [x.x.x] GUANYLATE KINASE
    8e-13  15%  2dftA  [x.x.x] SHIKIMATE KINASE
    1e-12  12%  1draA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-12  17%  1dyhA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-12  13%  3ecpA  [x.x.x] TN5 TRANSPOSASE
    1e-12   9%  2aumB  [x.x.x] HYPOTHETICAL PROTEIN
    1e-12   6%  3cbnA  [x.x.x] CONSERVED PROTEIN MTH639
    2e-12  10%  1e2nA  [c.37.1] THYMIDINE KINASE
    2e-12  11%  3ed8A  [x.x.x] YELLOW FLUORESCENCE PROTEIN
    2e-12   8%  1e4vA  [c.37.1 - g.41.2] ADENYLATE KINASE
    3e-12  14%  1e2iB  [c.37.1] THYMIDINE KINASE
    3e-12   5%  1d2zD  [a.77.1] DEATH DOMAIN OF TUBE
    3e-12   8%  3b55A  [x.x.x] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN
    3e-12  12%  3bwdD  [x.x.x] RAC-LIKE GTP-BINDING PROTEIN ARAC6
    4e-12   8%  1e1qB  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    4e-12  16%  3cnnA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    6e-12  14%  3c7kA  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
    7e-12  13%  2a1fC  [x.x.x] URIDYLATE KINASE
    8e-12   9%  3cqcA  [x.x.x] NUCLEAR PORE COMPLEX PROTEIN NUP107
    9e-12  16%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-12   8%  2b8tD  [x.x.x] THYMIDINE KINASE
    1e-11  11%  1e2mB  [c.37.1] THYMIDINE KINASE
    2e-11  19%  3cmuA  [x.x.x] PROTEIN RECA
    2e-11  10%  3cphA  [x.x.x] RAS-RELATED PROTEIN SEC4
    2e-11  16%  2d7vA  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    2e-11   4%  1dp0A  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    3e-11   8%  3bb1D  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    4e-11  13%  2anbA  [x.x.x] GUANYLATE KINASE
    4e-11  17%  3bjqB  [x.x.x] PHAGE-RELATED PROTEIN
    5e-11   7%  1afrA  [a.25.1] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    5e-11  16%  2d7vB  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    6e-11  14%  1cjuC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    7e-11  14%  1cjvC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    8e-11  15%  1drbA  [c.71.1] DIHYDROFOLATE REDUCTASE
    8e-11  13%  2dftC  [x.x.x] SHIKIMATE KINASE
    9e-11  13%  3e8aC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    1e-10  10%  1e9sA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-10  11%  1accA  [x.x.x] ANTHRAX PROTECTIVE ANTIGEN
    2e-10  12%  2ancD  [x.x.x] GUANYLATE KINASE
    2e-10  11%  1bccF  [f.27.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    2e-10  13%  3b85B  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    4e-10  19%  2e85B  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    4e-10   7%  1dvrA  [c.37.1 - g.41.2] ADENYLATE KINASE
    4e-10  13%  2a1fE  [x.x.x] URIDYLATE KINASE
    5e-10  13%  3do6A  [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
    6e-10  12%  1azsC  [c.37.1 - a.66.1] GS-ALPHA
    6e-10  11%  3dm5B  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    6e-10   9%  2a5vB  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    7e-10   5%  2c9gA  [x.x.x] PENTON PROTEIN
    7e-10  14%  2cdnA  [x.x.x] ADENYLATE KINASE
    1e-09   9%  2a5vA  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    1e-09  19%  2d2fA  [x.x.x] SUFC PROTEIN
    1e-09  10%  3c7kC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
    1e-09  12%  3c85A  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    1e-09   7%  3bm2B  [x.x.x] PROTEIN YDJA
    2e-09  10%  2b0lC  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    2e-09  24%  1chdA  [x.x.x] CHEB METHYLESTERASE
    2e-09   7%  1e2nB  [c.37.1] THYMIDINE KINASE
    3e-09  15%  1e9rB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-09   5%  3cd9A  [x.x.x] GREEN FLUORESCENT PROTEIN
    3e-09  13%  1e2jA  [c.37.1] THYMIDINE KINASE
    1e-08   8%  1d6aA  [d.165.1] POKEWEED ANTIVIRAL PROTEIN
    2e-08  14%  3b9qA  [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT
    2e-08  14%  1d8jA  [a.4.5] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    2e-08  12%  2an9A  [x.x.x] GUANYLATE KINASE
    2e-08  15%  1e2lA  [c.37.1] THYMIDINE KINASE
    3e-08  10%  1e2mA  [c.37.1] THYMIDINE KINASE
    4e-08  16%  3cbqA  [x.x.x] GTP-BINDING PROTEIN REM 2
    5e-08   9%  2aexA  [x.x.x] COPROPORPHYRINOGEN III OXIDASE, MITOCHONDRIAL
    5e-08  21%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-08  12%  2ancB  [x.x.x] GUANYLATE KINASE
    7e-08  13%  2a78A  [x.x.x] RAS-RELATED PROTEIN RAL-A
    9e-08  11%  2c9oA  [x.x.x] RUVB-LIKE 1
    1e-07  11%  2e85A  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    2e-07  15%  1e9sK  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-07  30%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    6e-07  21%  1ckeA  [c.37.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    7e-07  16%  1dwmA  [d.40.1] LINUM USITATISSINUM TRYPSIN INHIBITOR
    9e-07  14%  3ci2A  [x.x.x] CHYMOTRYPSIN INHIBITOR 2
    1e-06  15%  1agpA  [x.x.x] C-H-RAS P21 PROTEIN
    1e-06  12%  3dkvA  [x.x.x] ADENYLATE KINASE
    1e-06  15%  1e2hA  [c.37.1] THYMIDINE KINASE
    2e-06  17%  1e2kB  [c.37.1] THYMIDINE KINASE
    2e-06  23%  2bwjB  [x.x.x] ADENYLATE KINASE 5
    3e-06  21%  2ax4B  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    7e-06  10%  2bhvC  [x.x.x] COMB10
    7e-06   7%  3bs4A  [x.x.x] UNCHARACTERIZED PROTEIN PH0321
    8e-06  16%  2cfsA  [x.x.x] PYRIDOXAL PHOSPHATE PHOSPHATASE
    1e-05  15%  1brwA  [a.46.2 - c.27.1 - d.41.3] PROTEIN (PYRIMIDINE NUCLEOSIDE
    1e-05  10%  3csuA  [c.78.1 - c.78.1] PROTEIN (ASPARTATE CARBAMOYLTRANSFERASE)
    2e-05  13%  2c5mD  [x.x.x] CTP SYNTHASE
    2e-05  12%  3cddA  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    2e-05  11%  2axnA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    5e-05  12%  2ekbA  [x.x.x] ALPHA-RIBAZOLE-5'-PHOSPHATE PHOSPHATASE
    6e-05  21%  2ax4A  [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
    7e-05  21%  3dmdA  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    8e-05  11%  2c95B  [x.x.x] ADENYLATE KINASE 1
    1e-04  15%  3e70C  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    1e-04  13%  1e2lB  [c.37.1] THYMIDINE KINASE
    1e-04  23%  1dapA  [c.2.1 - d.81.1] DIAMINOPIMELIC ACID DEHYDROGENASE
    2e-04  16%  1e2jB  [c.37.1] THYMIDINE KINASE
    2e-04   9%  3cddB  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    2e-04  19%  3bb4A  [x.x.x] T7I23.11 PROTEIN
    2e-04  19%  2c9oB  [x.x.x] RUVB-LIKE 1
    8e-04   5%  3cr8B  [x.x.x] SULFATE ADENYLYLTRANFERASE, ADENYLYLSULFATE
    8e-04  27%  2bwjD  [x.x.x] ADENYLATE KINASE 5
:648

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKPTSGTYRVAGR
3b5jA           ---DITFRNIRFRYKPDSPVI--LDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGH
2dwoA           --TQSRVQKIWVPVDHR-----PSLPRSCGPNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNV
3dmdC           ----AVKEAVSEILETSR--RIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAAS
2dwpA           -----------------ELTQSRVQKIWVPVDHRNVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNV
3c95A           --------NRNAVIMVDLAGD--ISPLLELDSDTLRAVPVKLVHINKCPVLAQANTLRPEDADRLGINRQ
2d3wB           ---MLSIKDLHVSVEDKA----ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFK
3cmvH           ----DRSMDVETIS--TGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDA
3cmvG           ------VETISTGSLSLD-----IALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDA
2ccgA           ----------------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREP
2akaB           ------MEDLIPLVNRLQD---AFSAIGQNADLLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRR
1bifA           ---------------------------------PTLIVMVGLPARGKTYISKKLTRYLNFIGVPTREFNV
2ccjB           ----------------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREP
2bifA           ---------------------------------PTLIVMVGLPARGKTYISKKLTRYLNFIGVPTREFNV
2bbsA           -TTEVVMENVTAFWEEGFGELFVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR
2ccgB           ---------------------------------SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREP
2czvA           ----------------------GVKFIEMDIRDKEAYELAKEWFDEVVVSIKFNEEVDKEKLREARKEYG
3dmdB           EEAVKEAVSEILETSR----RIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAAS
2c03B           ----VILATVYEALKE----ALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAA
2c61B           -----ARLPPKDFIQTGI----STIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVV
1e69A           ----------------------SFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSE
3cmvC           ----DRSMDVETISTGSLSLD--IALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDA
4dcgA           -----SANEVAKKLPYQGQLKLLLGELKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLI
3cmvA           ----MDVETISTGSLSLD-----IALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDA
2dr3A           -------------VKTGIPGV--DEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVAL
3b60A           -TGDLEFRNVTFTYPGREVPA--LRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGH
3eiuB           AMNPYARLPPKDFIQTGI----STIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVV
1e9cA           ---------------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRF
3czpB           ----LDKDAYKEQLAAEQARLAGLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAA
2a2zD           ---------------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVAR
1e9fA           ---------------------------------GALIVLEGVDGAGKSTQSRKLVEALCAAGHRAELLRF
2b8wA           MTPMCLIENTNGRLMANPE---ALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSH
2c03A           ----VILATVYEALK----EALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAA
1e98A           -------------------------------RRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRF
2b8tA           ---------------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKP
1d1cA           ----------------------VAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQAGVL
2a30D           ---------------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVAR
3eiuA           AMNPYARLPPKDFIQTGI----STIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVV
2cjwB           ---------------------------------YYRVVLIGEQGVGKSTLANIFAGVEDTYERTLMVDGE
2dr3E           ----------TRRVKTGIPGV--DEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVAL
1e2dA           ---------------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRF
2bc9A           --PMCLIENTNGRLMANPE---ALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSH
2cckA           ----------------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREP
1e9sF           IVSGGKLKRMTREKAKQV----TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDP
3dm5A           ---KEHIIKIVYEELTKFLGT--EAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCS
1e9sG           IVSGGKLKRMTREKAKQV----TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDP
2a2zA           ---------------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVAR
1cr4A           --HLSSEESVGLLFSG----CTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAM
2awnD           --ASVQLQNVTKAWGEVV----VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEK
2d62A           IGAEVKLINIWKRFGDVT----AVKDLSLEIKDGEFLVLLGPSGCGKTTTLRIAGLEEPTRGQIYIEDNL
3d3kA           -----------PSISYELHKKLLSVAEKHGLTLERRLEMTGVCASQMALTLLGGPQRPTVALLCGPHVKG
1e9rA           IVSGGKLKRMTREKAKQV----TVAGVPMPRDAERHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDP
3bb1B           --GWSGINTFAPATQTKLLEL--LGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSGPR
3b2qA           AMNPYARLPPKDFIQTGI----STIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVV
1e9dA           -------------------------------RRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRF
3b85A           ----------------------GQKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIILTR
3bpbA           -----IARTPARSLVDGLT-SSHLGKPDYAKALEQHNAYIRALQVDITLLPPDERFPDSVFVEDPVLCTS
2c9oC           -----AASGLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGS
2cgtH           --------------------VSVAREIELEDKFNMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGL
2c04A           ----VILATVYEALKEAL----GGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAA
2b92B           MTGMCLIENTNGRLMANPE---ALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSH
2a5gA           ---------------------------------EMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNV
2c61A           AMNPYARLPPKDFIQTGI----STIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVV
1aroP           ----------------------------------------------------------------------
2c9yA           ---------------------------------GIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLR
2d4hB           MTGMCLIENTNGRLMANPEALKILSAITQP---MVVVAIVGLYRTGKSYLMNWMWCVPHPKKPGHILVLL
3b2qB           ------RLPPKDFIQTGI----STIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVV
1ai4B           SLLAWTHQMKAKNWQQWTQQAAK-QALTINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGKWDWK
3a1wA           ------------------------------------VALAGCPNVGKTSLFNALTGTKQYVANWPGVTVE
3cr7C           -------------------------------QRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLD
2bdtA           ----------------------------------KLYIITGPAGVGKSTTCKRLAAQLDNSAYIEGDIIN
2axzC           ----------------------------------------------------------------------
1e9sD           IVSGGKLKRMTREKAKQV----TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDP
1bg0A           LTKDVFDSIKNKKTGMG--ATLLDVIQSGVENLDSGVGIYAPDAESYRTFGPLFDPIIDDYHGGFKLTDK
2a30B           ---------------------------------IKKISIEGNIAAGKSTFVNILKWEVVPEPVARWCNVQ
1e2fA           -------------------------------RRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRF
3dt4A           -CFALRIASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIA
2ctsA           ------------ASSTNLKDI--LADLIEQARIKTFRQQHGNTAVGQITVDMMYGGMRGMKGLVYETSVL
3bb1E           --GWSGINTFAPATQTKLLEL--LGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGP
3dt2A           -CFALRIASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIA
421pA           ---------------------------------EYKLVVVGARGVGKSALTIQLIQNHFVDEYDPTIEDS
3d7wA           -----YVSSGSFSNNIP-----LLRQSTVPVSEGQRFVLVELTNAGGDTITAAIDVTNLYVVAYEAGNQS
2bbsB           ------TEVVMENVTAFW----VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR
1e4yA           ------------------------------------IILLGALVAGKGTQAQFIMEKYGIPQISTGDMLR
1dg3A           MTPMCLIENTNGRLMANPE---ALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKHTKGIWMWCVPH
2d4hA           MTGMCLIENTNGRLMANPE---ALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQKG
1e9sJ           IVSGGKLKRMTREKAKQV----TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDP
1dkiA           VKSLLDSKGIHYNQGNPYN-LLTPVIEKVKPGEQSFVGQHAATGSVATATAQIMKYHNYPNKGLKDYTYT
2awnB           --ASVQLQNVTKAWGEVV----VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEK
2axpA           -----------------------------------LIILEGPDCCFKSTVAAKLSKELKYPIIKGSSFEL
2b8tB           ---------------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKP
3dhwC           ---MIKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQ
2dr3B           ----------TRRVKTGI--PGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVAL
3cr7A           ---------------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLD
2b8tC           ---------------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKP
2a5jA           ------------------------------------YIIIGDTGVGKSCLLLQFTDKRFQPIGVEFGARM
2bbtB           -TTEVVMENVTAFWEEGFGNTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR
2a30A           ---------------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVAR
3adkA           --------------------------MEEKLKKSKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLR
3cddD           ----------------------YQGWTKIGITRSDLETYKFNDAQYKAFIEPIKQGQACTVDIGGER---
1e3aB           ----------KAKNWQEWTQQAAKQALTINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGKWDWK
3cmtD           ------------------------------LPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDA
3bo6B           ---FHSLHNQMRQMP----MSHFREALDAPDYSGMRQSGFFAMSQGFQLESHGGDVFMHAHRENPQCKGD
3cddF           ----GYVDDWVPSYD-ESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTD
1e0jA           ----HLSSSVGLLFSG----CTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAM
3dm9B           -------EAVSEIL---ETSRRIDLIEEIRKAEKPYVIFVGFNGSGKTTTIAKLANWLKNHGFSVVIAAS
3da4A           ---LVLHPGISVYDAYH-------FAKPAPSQYDYRSMNMKQMSGNVTTPIVALAHYLWGNGAERSVNIA
2c4rL           ----------------------GGISRRIELKEALASLELPEGMGLIVRTAGVGKSAEALQWDLSFRLKH
1cr2A           --HLSSEESVGLLFSG----CTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLA-
2ahwD           ------VKPPRINGRVP---VLSAQEAVNYIPDEATLCVLGGILEATTLITALADKYKQPTGLGDRADRG
2b8wB           MTPMCLIENTNGRLMANPE---ALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSH
1e0jB           --HLSSEESVGLLFSG----CTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAM
3czpA           ----------------------GLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAA
3cmxA           ------------------------------LPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDA
3dtbB           ------RLAKEEGWLAE---HMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIA
2a2zB           ---------------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVAR
3bb1C           --GWSGINTFAPATQTKLLEL--LGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGP
1e9rE           IVSGGKLKRMTREKAKQV----TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDP
1av6A           -----ESANEVAKKLPYQGQLKLLLGSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLI
3bb1F           --GWSGINTFAPATQTKLLEL--LGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGP
2akaA           MVDIFKGRRRNEVAPHIFAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQANGS
2bjbA           MLDALQTLGLRVDG---VGSELTVSGRIEPGPGARVD--CGLAG----TVLRFVPPLAALGSVPVTFDGD
3cioD           -----------------RALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDA
2d4uA           --------------------------------------PLGSGGLFFNALKNCKENFTVLQTIRQQQSTL
2awnC           ----------------------VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAG--------------
1e2kA           ------------------------------MPTLLRVYIDGPHGMGKTTTTQLLVADDIVYVPEPMTYWR
2dr3F           -------------VKTGIP--GVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVAL
2c0bL           -----------------------LVLMPNNPRAGGISRRIELKEALASLELPLIVRTAGVGKSAEALQWD
1d6jB           --------------------LTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRAYRLDGD
3cr7D           -------------------------------QRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLD
3clvA           ----------------------------MEKKSSYKTVLLGESSVGKSSIVLRLTKDTFHENTNTTIGAS
1e59A           -----------------------VTKLVL-VRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEE
3dfpC           ----------------------------------------------------------------------
1e6cA           ----------------------------------EPIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQ
1e3mB           -------------------------------------------------------------AYTLNYTCP
1e9sB           -----KLKRMTREKAKQV----TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDP
3dfnC           ----------------------------------------------------------------------
1e3mA           -----------------ALEKQLYEELFDLLLPHLEALQQSASLVNLAERAYTLNYTCPTFIDKPGIRIT
2eg5G           ---AYNQLVLAKVKPVLEQCRELLRANLPNINKCIKVADLGCASGPNTLIVQSIDKVGQLERPTIQIFLN
2ahvA           ------VKPPRINGRVP---VLSAQEAVNYIPDEATLCVLGGILEATTLITALADKYKQPTGLGDRADRG
3dfoD           ----------------------------------------------------------------------
3bgwA           ------------TGVPSGFTE--LDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSL
3dfqD           ----------------------------------------------------------------------
2cckB           ------------------------------------ITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREP
2ausC           ----------------------------------------------------------------------
1e9rD           IVSGGKLKRMTREKAKQV----TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDP
3cddC           -----------------------------------VLKAGGKIYQGWTKIGITRS-LEASGAFDLETYKF
2bkiA           TIKSYQGKSLGTMPPHVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDD
3cmvE           -GSIMRLGEDRSMDVSTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDA
3dftD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
3dt7A           -CFALRIASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIA
1cr1A           --HLSSEESVGLLFSG----CTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMG-KKVGLA
3dfqA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2dr3C           ----------TRRVKTGIPGV--DEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVAL
2dflA           ALEVKKERMNVKKISTGSQAL--DGLLAGGIETRTMTEFFGEFGSGKTQLCHQLSVNVQLPPEKGGLSGK
3ch4B           -------------------------MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSG
3dfnA           ----------------------------------------------------------------------
1cs4C           --------------------------------ATHRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIK
1adoA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
2bwjA           --------------------------FMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHL-------
6aldA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
1cjtC           --------------------------------ATHRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIK
2a1fF           ----------------------------------------------------------------------
1e9sM           IVSGGKLKRMTREKAKQV----TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDP
3bh0A           ----SADGNITGVPSG----FTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSL
3dt4C           ----LRIASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIA
3bb1A           --GWSGINTFAPATQTKLLEL--LGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGP
1ek0A           ------------------------------------LVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAA
1d6jA           --------------------LTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLD
2bhjA           --------------------------------------------------------IKNWGSGEILHDTL
3d3qA           ---------------------------------PFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVY
1bmfC           APGIIPRISVREPMQTGI----KAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKK
3c8uA           ------------TLAALCQGV--LERLDPRQPGRQLVALSGAPGSGKSTLSNPLAAALSAQGLPAEVVPD
2c7cH           --------------------VSVAREIELEDKFENMGAMVKEVASKANDAAGDGTTTATVLAQAIITEGL
3dfqC           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
1dekA           -----------------------------------LIFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIK
3di4A           ----------SARKTGEVL-VPPREGRCFEVKAGQFFRISSVEGPQVGDLNLHNLHDLTERFFSGKTRAL
1e9rF           -----KLKRMTREKAKQV----TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDP
2czvB           ----------------------DKEAYELAKEWFEVVVSIKFNEEVDKEKLREARKEYGKVAILLSNPKP
1cr0A           --HLSSEESVGLLFSG----CTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAM
3d3qB           ---------------------------------PFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVY
2awoC           ----------SVQLQN----VTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEK
3dfoC           ----------------------------------------------------------------------
3d31A           ---MIEIESLSRKWKN-----FSLDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGK
3a00A           ----------------------------------RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTP
3cmwC           -------------------------LGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDA
1e9sH           -----KLKRMTREKAKQV----TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDP
2bkhA           TIKSYQGKSLGTMPPHVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDD
3bgwD           ----------------------ELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSL
3bjdB           ------------------------------------------------RNFSLPQ-LQNLPIEEARIVAD
2cvfA           -------------LSTGTKSL--DSLLGGGFAPGVLTQVYGPYASGKTTLALQTGLLSGKKVAYVDTEGG
3cnlA           ----------------------KVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAKGIQWFSLENG
2bv7A           -----ETGPFLEAVSHLPPFFDCLGSPVFTPIKADIKAVYDTNPTKFRTLQNILEVEKEMYGAEWPKVGA
3be4A           ------------------------------NSKKHNLILIGAPGSGKGTQCEFIKKEYGLAHLSTGDMLR
3bczC           -----------------------VCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGY
3czjA           ----------------------VFPSENGLRCGTRELNYGPHQWRGDFQFNISRYSQQQLMETSHNIDGF
2dr3D           ----------TRRVKTGIPGV--DEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVAL
2awoA           --ASVQLQNVTKAWGEVV----VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEK
2bhvA           ----------------------------------------------------------------------
1dw9A           ------------------------AILLSKAKKDLFAEIADGTGLAEAFVTAALLGQQALPADAARLVGA
3dlbB           ----------------------------VWVEGLAVYRREHARGPGWRVLGGAVLDLWVSDSGAFLLE--
1culC           --------------------------------ATHRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIK
1b0uA           ---KLHVIDLHKRYGGHE----VLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQ
3cm0A           ---------------------------------GQAVIFLGPPGAGKGTQASRLAQELGFKKLSTGDILR
3dymA           ----------------------------------------------------------------------
1cjaA           -----------------------------NILLMELVRGITLNKLTTTSAPEVLTKSTMQQLGSLMALDV
1ak2A           ---------------------------------GVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLR
1dekB           -----------------------------------LIFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIK
3bv4A           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
1e2gA           ---------------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRF
3crmA           ---------------------------------PPAIFLMGPTAAGKTDLAMALADALPCELISVDSALI
1c9kC           -----------------------------------MILVTGGARSGKSRHAEALIGDAPQVLYIATSQIL
3c14C           --------------------------------ATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDI
2ck3C           APGIIPRISVREPMQTGI----KAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKK
1e9sL           -----KLKRMTREKAKQV----TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDP
1bglA           ----------------------------------------------------------------------
2d3wA           ---MLSIKDLHVSVEDKA----ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFK
2d2eA           --SQLEIRDLWASIDGET----ILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLD
3brwA           --VKLECNPTARIYRKHFLGKEHFNYYSLDTALGHLVFSLKYDVIGDQEHLRLLLRTKCRTYHDVIPISC
3bb1G           --GWSGINTFAPATQTKLLEL--LGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGP
2d3wD           ---MLSIKDLHVSVEDKA----ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFK
2ccjA           ----------------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREP
1e2hB           ------------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPM
3c15C           ------------------------------YRATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDI
2aunA           ----------------------------------------------------------------------
1e2iA           ------------------------------MPTLLRVYIDGPHGMGKTDDIVYVPEPMTYWRVLGASETI
3cueF           -----------------------------EYDYLFKLLLIGNSGVGKSCLLLRFSDDYISTIGVDFKIKT
1akeA           -----------------------------------RIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLR
3ec1A           ----------------------KVMEAINRYREGGDVYVVGCTNVGKSTFINRIIEEATGKGNVITTSYF
2awnA           --ASVQLQNVTKAWGEVV----VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEK
2aumA           ----------------------------------------------------------------------
2d3wC           ---MLSIKDLHVSVEDKA----ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFK
2boeX           ----------------------------------------------------------------------
1e9sI           IVSGGKLKRMTREKAKQV----TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDP
3dauA           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
2bofX           -----------------------------------------------------------PNMSSAEWVRN
3bb1H           --GWSGINTFAPATQTKLLEL--LGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGP
3cmvB           ------VETISTGSL-------SLDIALGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDA
2dpyB           PFNPLQRTPIEHVLDTGV----RAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIGE
3dvlD           -----EHQAIAK-MRTMIE--GFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVT
2d4uB           ----------------------------------------------------------------------
1e9rG           -----KLKRMTREKAKQV----TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDP
2bhvD           ----------------------------------------------------------------------
3a00B           ----------------------------------RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTT
2dpyA           PFNPLQRTPIEHVLDTGV----RAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIGE
2drcA           ----------------------------------------------------------------------
3dffA           -----------------------------------------------TRLLAIS---PHLDDAVLSFGA-
4atjA           ----------------------------------------------------------------------
2bbtA           ---EVVMENVTAFWEEGFGELFVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR
1e9sE           -----KLKRMTREKAKQV----TVAGVPMPRDAEPHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDP
3dfdA           ----IDAEEVEVPISKRFVDKEGNVPFIFKAITTDRIDELEKENTTKELDSQR-------FYARIAVETT
2bkeA           ALEVKKERNVKKISTG----SQALDGLLAGGIETRTTEFFGEFGSGKTQLCHQLSVNVQLPPEKGGLSGK
1cfrA           -------------------------------------DIISKSGEGNKYTINSAIAFVAYASHIDINTTE
1ckvA           MSVNSNAYMGLKGKDFADQ---FFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVYWWIKAN
1eamA           -------PAKKLPY-QGQLKL-LLGELKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLI
5dfrA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
3cr7B           ---------------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLD
2a1fD           ----------------------------------------------------------------------
2ancF           ---------------------------------GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQV
2dftA           -----------------------------------KAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIE
1draA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3ecpA           --------------------------------------------------------LHRAADWAKSVFSS
2aumB           ----------------------------------------------------------------------
3cbnA           ------------------------------------------------------------LRYTLRARGH
1e2nA           ------------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDI--VYVPE
3ed8A           ----IELKGTDFKED-----GNILGHKLEYNFNSHNVYITATRGTQKNGIKANFTVRHNVEDGSVQLADH
1e4vA           ------------------------------------IILLGAPVAGKGTQAQFIMEKYGIPQISTGDMLR
1e2iB           ------------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDI--VYVPE
1d2zD           ----PAEIKKGFKYTAQDVFQ--IDEAANRLPPDQSKSKTSGKLNERPTVGVLLQLLELFSAADFVALDF
3b55A           ----------------------------------------------------------------------
3bwdD           ---------------------------------FIKCVTVGDGAVGKTCLLISYTSNTFPFSANVVLGLW
1e1qB           -------ISVREPMQTGI----KAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKK
3cnnA           ----------------------KVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAGIQWFSLENGV
3c7kA           ------------------------------------LLLLGAGESGKSTIVKQMKIIFSGEDVKQYKPVV
2a1fC           ----------------------------------------------------------------------
3cqcA           -EALKQGNAIMRKFLASKKHEA-AKEVFVKIPQDSIAEIYLPAEDDNAIREHLCIRAYLEAHETFNEWFK
2awoD           --ASVQLQNVTKAWGEVV----VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEK
2b8tD           ---------------------------------GWIEFITGPMFAGKTAELIRRHRLEYADVKYLVFKPK
1e2mB           ------------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRYVPEPMTYWR
3cmuA           ------------------------ALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDA
3cphA           ------------------------------------ILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGID
2d7vA           ---VAALSSCHLVFLS----IAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPTLQ
1dp0A           ----------------------------------------------------------------------
3bb1D           ----SGINTFAPATQTKLLEL--LGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGP
2anbA           ---------------------------------GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHT
3bjqB           ----------------------------------------------------------------------
1afrA           --------------------REVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDP
2d7vB           ---VAALSSCHLVFLS----IAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPTLQ
1cjuC           --------------------------------ATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDI
1cjvC           --------------------------------ATHRLLLLGAGESGKSTIVKQMRILHVEKATKVQDIKN
1drbA           ----------------------------------------------------------------------
2dftC           ------------------------------------AVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIE
3e8aC           --------------------------------ATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDI
1e9sA           -----KLKRMTREKAKQV----TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDP
1accA           -----NWSEVLPQIQETTARI--IFNGKDLNLVERRIAAVNPSTTKPDMTLKEALKIANEPNGNLQYQGK
2ancD           ---------------------------------GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHT
1bccF           ----------------------------------------------------------------------
3b85B           -----------------RPKTLGQKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIILTR
2e85B           ----------------------------------------------------------------------
1dvrA           ---------------------------------SIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLR
2a1fE           ----------------------------------------------------------------------
3do6A           KDDILYPYGHYIAKI----DHRFLKSLENHEDGKLILVTATPAGEGKTTTSIGLSSLNRIGKKSIVTLRE
1azsC           ------------------------------YRATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDI
3dm5B           ISKKEHIIKIVYEELTKFLGT--EAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCS
2a5vB           ---MFVVRTAGHVIDSAV--LGSI-EYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGY---VRD
2c9gA           KARVMVSRSLTKDKQ----VELKYEWVEFTLPEGNYSETMTIDLMNNAIVEHYLKVGRQNGVLES-----
2cdnA           --------------------------------SHMRVLLLGPPGAGKGTQAVKLAEKLGSTGELFRRNIE
2a5vA           ---MFVVRTAGHVIDSAV--LGSI-EYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYV---RD
2d2fA           --SQLEIRDLWASIDGET----ILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLD
3c7kC           ------------------------------------LLLLGAGESGKSTIVKQMKIIHEDGFSGED----
3c85A           --------------------------------------------------------LINPGHAQVLILGG
3bm2B           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
1e2nB           ------------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDI--VYVPE
1e9rB           -----KLKRMTREKAKQV----TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDP
3cd9A           ----IELKGIDFKEDGNILGH--KLEYNYNCESNVYIMADKQKNGIKANFKTRHNIEDGSVQLADHYQQN
1e2jA           ------------------------------MPTLLRVYIDGPHGMGKTTTTQLLDDIVYVPEPMTYWRVL
1d6aA           -----SRSQVQLGIQILDSNIGKISGVMSFTEKTEAEFLLVAIQMVSEAARFKYIENQ-VKTNFNRAFNP
3b9qA           GSEIKDALKESVLEMLAK----SKTELQLGFRKPAVIMIVGVNGGGKTTSLGKLAHRLKNEGTKVLMAAG
1d8jA           ----------------------------------------------------------------------
2an9A           ---------------------------------GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHT
1e2lA           ------------------------------MPTLLRVYIDGPHGMGKTTTTQLLDIVYVPEPMTYWRVLG
1e2mA           ---------------------------------LLRVYIDGPHGMGKTTTTQLL-------RDDIVYVPE
3cbqA           ------------------------------------VMLVGESGVGKSTLAGTFGGLQGDSAHEPENPED
2aexA           ----------------------------------------------------------------------
2bboA           -TTEVVMENVTAFWEEGLGTPV-LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR
2ancB           ---------------------------------GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHT
2a78A           ------------------------------------VIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADS
2c9oA           -----AASGLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGS
2e85A           ----------------------------------------------------------------------
1e9sK           -----KLKRMTREKAKQV----TVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDP
2cbzA           ----ITVRNATFTWARSDPPT--LNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDK----------
1ckeA           ---------------------------------APVITIDGPSGAGKGTLCKAMAEWHLLDSGAYRVLAH
1dwmA           ----------------------------------------------------------------------
3ci2A           ----------------------------------------------------------------------
1agpA           ------------------------------------LVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDS
3dkvA           ------------------------------------IVLMGLPGAGKGTQAERIVE--KYGIPHISTGDM
1e2hA           ------------------------------MPTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRV
1e2kB           ------------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYMTYWR
2bwjB           ---------------------------MEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTG----
2ax4B           -------------------------------FRGCTVWLTGLSGAGKTTIFALEEYLVSHAIPCYSLDGD
2bhvC           ----------------------------------------------------------------------
3bs4A           ------------------------------KKHSLILIHEEDASSRGKDILFYILSRKLKSDNLVGMFSI
2cfsA           ----------------------------------------------------------------------
1brwA           --------------------------------VGVPVAKMSGRGGHTGGTIDKLESVP----------GF
3csuA           ---------------------------------------------------HIIS-INDLSRDDLNLVLA
2c5mD           ----------------------------------------------------------------------
3cddA           --------------------TKIGITRSL-EASGAFDLETYKFLGNDAQYKAFI--EPIKQGQACTVDIG
2axnA           --TQSRVQKIWVPVD-----HRPSLPRSCGPNSPTVIVMVGLPARGKTYIS-------------------
2ekbA           ----------------------------------------------------------------------
2ax4A           -------------------------------FRGCTVWLTGLSGAGKTTIFALEEYLVSHAIPCYSLDGD
3dmdA           EEAVKEAVSEILETS----RRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLAN--------------
2c95B           ----------------------------EKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTTGDLLRSEV
3e70C           ---KEAVSEILETS--RRI---DLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAAS
1e2lB           ------------------------------MPTLLRVYIDGPHGMGKTTTTQLL----------VALGSR
1dapA           -----------------------FDSEHTGMPHGGHVITTGDTGGFNHTVEYIL----------------
1e2jB           ---------------------------------LLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPM
3cddB           --------------------LKAGGKIYQGWTKIGITRSLEASGAFDLETYKFLGNDAQYKAFIEPIKQG
3bb4A           ----------------------------------EWVGFQQFPAATQEKLIEFFLKQKDMNSMTVLVLGK
2c9oB           ---ESGLAKQAASGLVGQENAVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGS
3cr8B           ----------------------------------------------------------------------
2bwjD           ------------------------------LRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHL-------


                         .         .         *         .         .         .         .:140
query           DVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDY
3b5jA           DLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGE
2dwoA           GEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAK--------------------EGGQI
3dmdC           DTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQ---------------------HAKARGIDV
2dwpA           GEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAK--------------------EGGQI
3c95A           HCLDNLKILREAESDNVDAQLYNGFFSDADRAAMKIVLETEPRNL--PALDITFVDKRIEKLLFNYRARN
2d3wB           GKDLLALSPEDRAGE-GIFMAFQYPVEIPGVSNQFFLQTALNAVRRFDFQDLMEEKIALLKMPEDLLTRS
3cmvH           EHALDPI------YARKLGVDIDNLLCSQPDTGEQALEICDALARVIVVDSVAALTPKAEIEGEIGDSHM
3cmvG           EHALDPI------YARKLGVDIDNLLCSQPDTGEQALEICDALARVIVVDSVAALTPKAEIEGEIGDSHM
2ccgA           GGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIP------------ALKEGKVVLCDRYIDS
2akaB           PLVLQLVNSTTEYAEFFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVP
1bifA           GQYRRDMVKTYKSFEFFLPDNEEGLK--IRKQCALAALNDVRKFLS------------------EEGGHV
2ccjB           GGVPTGEEIRKIVL------EGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCD------RYIDS
2bifA           GQYRRDMVKTYKSFEFFLPDNE--EGLKIRKQCALAALNDVRKFLS------------------EEGGHV
2bbsA           ISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISK-------------------FAEKDNI
2ccgB           GGV--------PTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLC----DRYIDS
2czvA           KVAILLSNPKPQKFKSYLIYVESNDLRVIRYSIEKGVDAIPWVNRKDPGIDHVLAKLMVKKNVALGFSLR
3dmdB           DTFRAGAIEQLEEHA--KRIGVKVIKHSYGADPAAVAYDAIQ-------------------HAKARGIDV
2c03B           DTQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARL---------------------EARDL
2c61B           FAAMGITN---EEAQYFMSDFEKTGALERAVVFLNLADDPAVERITNYAEALRQMGYPGYMYTDLATLYE
1e69A           NLPPAGSAYVELVFEENGEEITVAREGQIDRIVNAYQRVNESFNRFISLLFFGGEGRLEISIRKPGRRDQ
3cmvC           EHALDPI------YARKLGVDIDNLLCSQPDTGEQALEICDALARS-GAVDVIVVDSVAALTPKAEIEGL
4dcgA           DGRHHDPILNGLRDLVTRFVDEEYLRSIKKQLHPSKILLSNYALQNVMISILNPVASSLKWRCPFPAQWI
3cmvA           EHALDPIY------ARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAAL----TPKAEI
2dr3A           EEHPVQV----RQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGK---------------------EYEKYI
3b60A           DLREYTLASLRNQVALVSQNVHFNDTVANNIAYARTEEYSREQIEEAARMAYAMDFINKMDNGLDTIIGE
3eiuB           FAAMGITN---EEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVEALRQMGAAGYPGYMYTDLATLYE
1e9cA           PERSTE-------IGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAY
3czpB           PTEEERAQPYLWRFWRHIPARRQFTIFDRSWRVLVERIEGFCAPADWLRAYGEINDFEEQLSEYGIIVVK
2a2zD           WCNVQSTNVLQMMKPERWSFTFQTYACLSRIRAQLASLNEKPVLFFERSVYSDRYIFASNLYESECMNET
1e9fA           PERSTEI-------GKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAF
2b8wA           TKGIWMWCVPHPKKP-GHILVLLDTEGLGDVEKGDNQNDSWVYNSIGTINQQAMDQLYYVTELTHRIRSK
2c03A           DTQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKAR---------------------LEARDL
1e98A           PERSTE-------IGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAF
2b8tA           KIDTRSIRN----IQSRTGTSLPSVEVESAPEILNYIMSNSFNDETRICEVANILAENGFVVIISGLDKN
1d1cA           EQQILQANPILEAFG--NAKTTRNNNSSRFGKFIEIQFNNAGFISGASIQSYLLEKSRVVFQSETERNYH
2a30D           WCNVQSTNVLQMMYEERWSFTFQTYACLSRIRAQLASLNGKPVLFFERSVYSDRYIFASNLYESECMNET
3eiuA           FAAMGITN---EEAQYFMSDFEKTGALERAVVFLNLADDPAVERDITNYAEALRQMGPGYMYTDLATLYE
2cjwB           SATIILL----DMWENHDHMQVGDAYLIVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVR
2dr3E           EEHPVQV----RQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGK---------------------EYEKYI
1e2dA           PERSTEI------GKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFT
2bc9A           TKGIWMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAV------------------LLSSTF
2cckA           GGVPTGEEIRKIVLEDMDIRTEAMLFAASRREHLVLKVIPALKEGK------------------VVLCDR
1e9sF           NGDMLSK------FGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQR-------------------YALSV
3dm5A           DTWRPGAYHQLRQLLDRYHIEVFGNPQEKDAIKLAKEGVDYFK---------------------SKGVDI
1e9sG           NGDMLSK------FGRDKDIILNPYDQRTKGWSFFNEIRN-------------------DYDWQRYALSV
2a2zA           WCNVQSTNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKEKPVLFFERSVYSDR-------YIFAS
1cr4A           LEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDT----------------FHLYD
2awnD           RMNDTPPA---ERGVGMVEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLAD
2d62A           VA---DPEKGVFVPPKERDVAVFQSYALYPHTVYDNI-AFPLKLRKVPKQEIDKRVREVAELGLTELLNR
3d3kA           AQGISCGRHLANHDVQVILFLPNFVKMLESITNELSLFSKTQGQQV---SSLKDLPTSPVDLVINCLDCP
1e9rA           NGDMLSK------FGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLL
3bb1B           PVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAIT
3b2qA           FAAMGITNE----EAQYFMSDFEKTGALERAVVFLNLADPAVERIVTPRMALTAAEYLAYEHGMHVLVIL
1e9dA           PERSTE-------IGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAY
3b85A           PAVEAGEKLGFLPGDPYLRPLHDALRDV-EPEVIPKLEAGIVEVAPLAYRGRTLNDAFVILDEAQNTTPA
3bpbA           RCAIITRPGAESRRGETEIIEETVQRFYPGKVERIEAPGTVEAGDIMMVGDHFYIGE-------SARTNA
2c9oC           EVYSTEIKK----TEVLMENFRRAIGLRIKETKKKEIVTLHDLDVAGEINKVVNKYIDQGIAELVPGVLF
2cgtH           KAVAAGMNPMDLKRDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQF
2c04A           DTQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKAR---------------------LEARDL
2b92B           TKGIWMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWITFVYNSIGTINQQAMDQLYYVTELTHRIR
2a5gA           ETVTYKNVKFNVWDVGGLDKIRPHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFAN
2c61A           FAAMGITN---EEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAYEHGMHVLVIL
1aroP           -----------------------------------------------------------------ESYEM
2c9yA           AMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEK
2d4hB           DTEGLGQNDSWIFAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRSKSSDSADFVSFFPDFVWTLRDFS
3b2qB           FAAMGITNE----EAQYFMSDFEKTGALERAVVFLNLADDPAVERYAEALRQMGRGYPGYMYTDLATLYE
1ai4B           GLLPFEMNNSPQKDYPASDLFAFLWGGADRVTEIDRLLEQKPRLTADQAWDVIRQTSRQDLNLRLFLLQA
3a1wA           KKEGVFTYKGYTINL-IDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEME
3cr7C           GDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVTGLPDPKGL
2bdtA           HVVGGYRPPLLALTWKNITDLTVNFLLAQNDVVLDYIAFPDEAEALAQTVQAKVDDVEIRFIILWTNREE
2axzC           -----------------------------------------------------------------NLLNV
1e9sD           NGDMLSK------FGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRY-------------------ALSV
1bg0A           HPPKQWGDINTLVGLDPAGQFIISTRVRCGRSLQGYPFNPCLTAEQYKEMEEKVSSTLSSMEDELKGTYY
2a30B           STNVLQMM---YEKPERWSFTFQTYACLSRIRAQLASLNDAEKPVFERSVYSDRYIFASNLYESECMNET
1e2fA           PERSTE-------IGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAF
3dt4A           WMKFDAQGNLRAINPENGFFGVAPGT--SVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPGV
2ctsA           DPDEGIRFRGYSIPE--CQKMLPKAKGGEEPLPEGLFWLLVTGQIQVSWLSKEWAKRAALPSHVVTMLDN
3bb1E           RPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDLLYVDRLDAYRVDNLDKLVAKAIT
3dt2A           WMKFDAQG-----NLRAINPENGFFGVAPGTSVKTNPNAIKTIQKFTNVAETSDGGVYWEGIDEPLAPGV
421pA           YRKQVVIDGETCLLDILDTAGQEEYSDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMV
3d7wA           YFLSDAPAGAETQDFSGTTSSSQPFNGSYPDLERYAGHRDQIPLGI-------------------DQLIQ
2bbsB           ISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKF-----------------AEKDNIVL
1e4yA           AAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQED-------------------------CRNGF
1dg3A           PKKPGHILV----LLDTEGLGDVEKGDNQNDSWIFALAVFVYNSIGTINQQAMDQLYYVTELTHRIRSKS
2d4hA           IWMWCVPH---PKKPGHILVLLDTEGLGDVENQNDSWIFALAVLLYNSIGTINQQAMDQLYYVTELTHRI
1e9sJ           NGDMLSK------FGRDKDIILNPYDQRTKGWSFFNEIRND-------------------YDWQRYALSV
1dkiA           LSSNNPY-------FNHPKNLFAAISTRQYNWNNILPTYSGRESNV--QKMAISELMADVGISVDMDYGP
2awnB           RMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQL------AHLLDR
2axpA           AKSGNEKLFEHFNKLADEDNVIIDRFVYSNLVYAKKFKDYSILEDKIKAKAKVVYLHADPSVIKKRLRVR
2b8tB           KILPSVEVESAPEILNYIMSNSFNDETKVI------GIDEVQFFDDRICEVANILAENGFVVIISGLDKN
3dhwC           ELTTLSESELTK-ARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELLSLVGLGDKHDS
2dr3B           EEHPVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGEK----------------------------YI
3cr7A           GDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVTGLPDPKGL
2b8tC           KIDSRTGTSLPSVEVESAPEILNYIMSNSFNDETKVIIDEVQFFDDRICEVANILAENGFVVIISGLDKN
2a5jA           VNIDGKQIKLQI-WDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIML
2bbtB           ISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFA------------------EKDNIV
2a30A           WCNVQSTNVLQMMKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEERSVYSDRYIFASNLYESECMNET
3adkA           AEVSSGSA---RGKMLSEIMEKGQLVPLETVLDMLRDAMVAKVDTSKGFLIDGYPREVKQGEEFERKIGQ
3cddD           VITGYVDDWVPSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNGEPF
1e3aB           GLLPFEMNPKVYNPQKDYPASDLFAFLWGGADRVTEIDRLLEQKPRLTADQAWDVIRQTSRQDLNLRLFL
3cmtD           EHALDPI------YARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEMGLLI
3bo6B           FAGDKFHI---SVQREQVPQAFQALSGLLFSVDSPIDKWKVTDMERVDQQSRVAVGAQFTLYVKPDENSQ
3cddF           VGQRIQIEQGETPHELLARLAKQRGVLLTSDTFGNLVITRASKTKAGVSLILGDNVKAARGRFSWRQRFS
1e0jA           LEESVE-----ETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWF----DELFGNDTFHLYDSFAEAET
3dm9B           DTFRAGAIEQLEEKRIGVKVIKHSYGADPAAVAYDAIQHA-------------------------KARGI
3da4A           NIGLKISPQIKDIIKSGVVGTFPVSTKFTHATGDYNVITGAYLGNVRSYDDKYDFNASTHRGIIGESLTR
2c4rL           WEAIKKAA-----ESRPAPFLIHQESNVIVRAFRDYLRQDIGEILIDNPKVLELARQHIAALGRPSKIKL
1cr2A           -----MLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQW-----------FDELFGNDTFHLY
2ahwD           ISPLAQEGL----VKWALCGHWGQSPRISDLAEQNKIIAYNYPQGQTLRAAAAHQPGIISDIGIGTFVDP
2b8wB           TKGIWMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAV------LLSSTFVYNSIGTINQQA
1e0jB           LEESVEE------TAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSF---AEAET
3czpA           PTEEERAQPYLWRFWRHIPARRQFTIFDRSWYGRVLVIEGFCAPADWLRAYGEINDFEEQLSEYGIIVVK
3cmxA           EHAL------DPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEARLLI
3dtbB           WMKFDAQG--NLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPGV
2a2zB           WCNVQSTNVLQMMYEKPWSFTFQTYACLSRIRAQLASLNGEKPVFFERSVYSDRYIFASNLYESECMNET
3bb1C           RPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLDKTIDVLLYVDRLDAYRVDNLDKLVAKAIT
1e9rE           NGDMLSK------FGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQR-------------------YALSV
1av6A           DGRHHDPI-----LNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMIS
3bb1F           RPVMVSRSRAGFTLNIIDTPGLIEGGYNDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAIT
2akaA           GVLEQQIL---QANPILEAFGNAKTTRNNNSSRFGKFIEIQFISGASIQSYLLEKSRVVFQSETERNYHI
2bjbA           QARGRPIAPLLDALR-ELGVAVDGTGLPFRVRGNGSLAGGTVA---------------IDASASSQFVSL
3cioD           DLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLANDHY
2d4uA           NGSWVALQTRNTLNRAGIRYMMDQNNIGSGSTVAELMESSLKQAEKNWADYEALPRDPRQSTAAAAEIKR
2awnC           ---------------LGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDR
1e2kA           VLGASET------IANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYA---------------VTDAV
2dr3F           EEHPVQVRQ----NMAQFGWDVKPYEEKGMFAMVDAFTAGIGKSKE-------------------YEKYI
2c0bL           LSFRLKHWEAIKKAAESAPFLIHQESNVIVRAFRDYLRQDIGEILIDNPKVLELARQHIAALGRSSKIKL
1d6jB           NIRFGLNKDLGFSEADRNENIRRIAE--VAKLFADSNSIAITSFISPYRKDRDTARQLHEVATPGEETGL
3cr7D           GDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNQLHEVAEETGLPFVEVYVDVPVEVAEQRDPKGL
3clvA           FCTYVYNENLCNIKF-DIWDTAGQERYASIVPLYYRGTCAIVVFDISNSNTLDRAKTWVNQLKISSNYII
1e59A           GYSFDFAYTSVLKRAIHTLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVT
3dfpC           --------------------------------------------------------------------HS
1e6cA           HTSGMTVADVVAAEGWPGFRRRESEALQAVATPNRVVATGGGMVLRAHGTVVYLFAPAEELALRLQASLQ
1e3mB           TFIDKPGIRITEGRHPVVEQVLNEPFIANPLNLSPQRRLIITGPNGGKSTYRQTALIALAYIGSYVGPID
1e9sB           NGDMLSKFGR------DKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLL
3dfnC           --------------------------------------------------------------------HS
1e3mA           EGRHPVVE-----QVLNEPFIANPLNLSPQRRLIITGPNGGKSTYRQTALIALAYIGSYVPAQKVEIGPI
2eg5G           DLFPNDFN---SVFKLLPSFYRKLEK-ENGRKIGSCLIGAMPGSFYFLHSCYCLQWLSQVPSGLVTEIGT
2ahvA           ISPLAQEGLV----KWALCGHWGQSPRISDLAEQNKIIAYNYPQGVTLRAAAAHQPGIISDIGIGTFVDP
3dfoD           ----------------------------------------------------------------------
3bgwA           EMGKKENIKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNSNI---------------NIFDK
3dfqD           ----------------------------------------------------------------------
2cckB           GGVPTGEEIRKIVLEGDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYAGVEEV
2ausC           ------------------------------------------------------------------NLDK
1e9rD           NGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQR-------------------------YALSV
3cddC           QYKIKQGQACTVDIGGERVITGYVDDWVPSYDECSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTDPF
2bkiA           RI--------VEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNVGGFVSHYLLEKSRICVQGKEERNYHI
3cmvE           EHALDPIY------ARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPK-AEIEGL
3dftD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
3dt7A           WMKFDAQG-----NLRAINPENGFFGVAPGTSVKTNPNAIKTIQKFTNVAETSDGGVYWEGIDEPLAPGV
1cr1A           MLEESVEETAEDLIGNRVRLRQSDSLKREIIENGKFDQWFDELFGN-------------------DTFHL
3dfqA           ----------------------------------------------------------------------
1dhjA           -----------------------------------------------------------------FKRNT
1aldA           ----------------------------------------------------------------------
2dr3C           EEHPVQVRQ----NMAQFGWDVKPYEEKGMFAMVDAFTAGIGE----------------------YEKYI
2dflA           AVYIDTEGTFRWERIENMAKALGLDIDNVMNNIYYIRAINTD--------------------HQIAIVDD
3ch4B           PLKEQYAQE----HGLNFQYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDRQQR
3dfnA           ----------------------------------------------------------------------
1cs4C           NNLKEAIETIVAAMS-NLVPPVELANPENQFRVDYILSVM------------------------------
1adoA           ----------------------------------------------------------------------
3dfnD           --------------------------------------------------------------------HS
2bwjA           STGELLREELASERSKLIRDIMERGDLVPSGIVLELLKEAMVASLTRGFLIDGYPREVKQGEEFGRRIGD
6aldA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2bx2L           ------------------------------------------------------------------KIKL
1cjtC           NNLKEAIETIVAAMS-NLVPPVELANPENQFRVDYILSVMN-----------------------------
2a1fF           ----------------------------------------------------------------------
1e9sM           NGDMLSK------FGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLL
3bh0A           EMGKKEN---------IKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNSNINIFDKAGQSVN
3dt4C           WMKFDAQG-----NLRAINPENGFFGVAPGTSVKTNPNAIKTIQKFTNVAETSDGGVYWEGIDEPLAPGV
3bb1A           RPVMVSRSRAGFTIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITD
1ek0A           FLTQRVTINEHTVKFEIWDTAGQERFASLAPYYRNAQAALVVYQSFIKARHWVKELHEQASKDIIIALVG
1d6jA           GDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDR-------------DTARQ
2bhjA           HHKATSCLG-SIMNPKSLTRGPRDKPTPLEELLPHAIQYYGSFKEAKIEEHLARLEAVTKEIETTGTYQL
3d3qA           QGDIGTAKVTTEEHYIDILPPDASFSAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYNYAFEIS
1bmfC           LYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSA----------------------------TASDAA
3c8uA           -------------GFHLDNRLLEPRGLLPRKGAPETFDFEGFQRLC--------HALKHQERVIYPLFDR
2c7cH           KAVAAGMNPMDLKRDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQF
3dfqC           ----------------------------------------------------------------------
2d0kA           -----------------------------------------------------------------FKRNT
1dekA           DALAYAWGVFAANTKEFEGIDYDRETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVA
3di4A           HGTHVTTGERLWSNLPYLRPATIIGWYGIDQYGGSVHDVIGTRCDPYTGNLLAGGHYHHCCHSNLTRALA
1e9rF           NGDMLSKFGRILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGK----------TDEAEEWASYGRLL
2czvB           SLVRDTVQKF----KSYLIYVESNDLRVIRYSIEKGVDAIISPWRKDPGIDHVLAKLMVKKNVALGFSLR
1cr0A           LEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGN------------------DTFHL
3d3qB           QGDIGTAKVTT--EEEGIPHYIDILPPDASFSAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQYNYAF
2awoC           RMNDTPPAERGVGMVALYPHLSVAENMSFGLKLAGAKKEVINQ----------RVNQVAEVLQLAHLLDR
3dfoC           ----------------------------------------------------------------------
3d31A           DVTDLSPEKHDIAFVYQNYSLFPHMNVKKNLEFGMRMKKIKDPK---------RVLDTARDLKIEHLLDR
3a00A           RAGEVNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASVK-------------------QVSKS
3cmwC           EHALDPI------YARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEI
1e9sH           NGDMLSK------FGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLL
2bkhA           RIVEANPL---LEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHI
3bgwD           EMGKKENI---KRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIG------EISNSNINIFDKAGQSVN
3bjdB           A---LAVHALAALAEAGLKGDRQAYAAYQQLL---------YVLSLSDDVATAQTRRWLARAIYRVEERF
2cvfA           FSPERLV------QMAETRGLNPEEALSRFILFTPSDDSNFALVVVDSITAHYRAEENRSGLIAELSRQL
3cnlA           VKILDTPG---ILYKNIFSEDLAAKLLLVGSLPVERIEDQRIFERAFEIFARSIGIESSFSEFFEDFARK
2bv7A           TLAL---------MWLKRGLRFIQVFLQSICDGERDENHPNLIRVNAT-----------------KAYEM
3be4A           EAIKNGIG---LEAKSIIESGNFVGDEIVLGLVKEKFDLGVCVNGFVLDGFPRTIPQAEGLAKILSEIGD
3bczC           TYCGSCAAHAYKQVDPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGFERSL
3czjA           HMGIGGDDSWSPSVSAEFQLSAGRYHY-----------------------------------------LD
2dr3D           EEHPVQV----RQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGKSKE-------------------YEKYI
2awoA           RMNDTPP------AERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDR
2bhvA           ------------------LRTITADKMIPALITPISSQIAGKVIAQVESDIFAHMGKAVLIPKGSKVIGY
1dw9A           KLDLDEDSILLLQIPLRRIPTDPTYRFYELQVYGTTLKALVHEKFGDGIISAINFKLDVKKVADPEGGER
3dlbB           -----------VDPAYRILCEMSLEAWLAQGHPLPKRVRNAYDRRTWELLRLGEEDPKELPLPGGLSLLD
1culC           NNLKEAIET----IVAAMSNLVPPVELANPENQFRVD---------------------------------
1b0uA           NINLVRDKDGQLKVADKNQLRLLRTRLTMVMTVLENVMEAPIQVLGLSKHDARERALKYLAKVGIRAQGK
3cm0A           DHVARGTP-----LGERVRPIMERGDLVPDDLILELIREELAERVIFDGFPRTLAQAEALDRLL-SETEV
3dymA           -----------------------------------------------------------------FTRAP
1cjaA           IVNNSDRLPIATNEGNLDNIMLSERGATVVPIDSKIIPLDASHPHGERVRELLRTLIAHPGHESSQFHSI
1ak2A           AMVASGSELGKKLKATMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEK
1dekB           ---------------DALAYAWGVFAANTDYPLTRKEFEGIDYDRETNLNLTKLEVI--------TIMEQ
3bv4A           ----------------------------------------------------------------------
1dhiA           --------------------------ISLIAALAVDRVIGM----------ENAMPWNLPASLAWFKRNT
1eilA           -----------------------------------------------------------------HFLTK
1e2gA           PERS-------TEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAF
3crmA           YRGMDIGTA----KPSRELLARYPHRLIDIRDPAESYSAAEFRADALAAMAKATARGRIPLL---VGGTM
1c9kC           HHK--------DGRPAHWRTARHLDTLITADLAPDDAILLECITTMVTNLLFALGD---------PEQWD
3c14C           KNNLKEAIETIVAAMSNLVPPVELAN--------------------------------------------
2ck3C           LYCIYVAIG----QKRSTVAQLVKRLTDADAMKYTIVVSATASD------------------------AA
1e9sL           NGDMLSK------FGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLL
1bglA           ----------------------------------------------------------------------
2d3wA           GKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKDLLTRS
2d2eA           GENILELSP-DERARKGLFLAFQYPVVPGVTIANFLRLALQAKLGREVGVAEFWTKVKKALELLDWDESY
3brwA           LTEFPNVVQMAKLVCEDVNVDRFYPVLYPKASRLIVTFDE-----------------------HVISNNF
3bb1G           RPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAI
2d3wD           GK-DLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRS
2ccjA           G------------GVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDS
1e2hB           TYWRVLGASETTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTDRHPIA
3c15C           KNNLKEAIETIVAAMSNLVPPVELANPENQ----------------------------------------
2aunA           ------------------------QTWQPIDGRVALIAPASAIATEVLEATLRQLEVHGVDYHLGRHVEA
1e2iA           ANIYTTQHRLDQGEIAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGPPPALTLIFDRHPIAALLCY
3cueF           VELDGKTVKLQI-WDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLL
1akeA           AAVKSGSELGKQAKDIMDAGKLVTDELVIA----LVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGIN
3ec1A           PGTTLDMIEIPL----ESGATLYDTPGIINHHQMAHFVDARDLKIITPKREIHPRVYQLNEGQTFFGGLA
2awnA           RMNDTPPAERGVGMVFQSYALEVINQ--------------------------------------------
2aumA           -----------------------DQTWQPIDGRVALIAPASAIATEVLEATLRQLEVHGVDYHLGRHVEA
2d3wC           GKDL-LALSPEDRAGEGIFMAFQYPVEIPGVSNQFFSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRS
2boeX           --------------------------------------------------------------------HH
1e9sI           NGDMLSK------FGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQ-------------------RYALSV
3dauA           --------------------------ISLIAALAVDRVIGMENAMPWNLPADLAW----------FKRNT
2aunB           ----------------------------------------------------------------GRHVEA
2bofX           NPNDPRTPVI-----------RDRIASVPQGTWFAHHNPGQITGQVDALMSAAQAAGKIPILVVSNAPGR
3bb1H           RPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDK----------------TIDVLLYVDRL
3cmvB           EHALDPI------YARKLGVDIDNLLCSQPDTGEQALEICDALARS-----GAVDVIVVDSVAALTPKAE
2dpyB           RGREVKDFIENI-LGPDGRARSVVIAAPADVSPLLRMQGAAYATRIAEDFRDRGQHVLLIMDSLTRYAMQ
3dvlD           FEETPQDI---IKNARSFGWDLAKLVDEGKLFILDASPDP--------------------------EGQE
2d4uB           ------------LNRAGIRYMMDQNNIGSGSTVAELMESSLKQAEKNWADYEALPRDPRQSTAAAAEIKR
1e9rG           NGDMLSK------FGRDKDIILNPYDQRTKGWSFFN----------------------------------
2bhvD           ------------------LRTITADKMIPAFLITPISQIAGKVIAQVESDIFAHMGKAVLIPKGSKVIGY
3a00B           RTPRAGEVNGKDYSVDEFKSMIKNNEFIEWAQFSGNYYGSTVAS-------------------VKQVSKS
2dpyA           RGREVKDFIENI-LGPDGRARSVVIAAPADVSPLLRMQGA------------------------------
2drcA           --------------------------ISLIAALAVDRVIGM----------ENAMPFNLPADLAWFKRNT
3dffA           --------GLAQAAQDNVLVYTVFAGAAQPPAAQRHTIWGLAPDDDAVLYRRKEDIAALDHLRVAHHGRF
4atjA           -----------------SILLDNTTSFRTEKDAFGNANSARGFIDRMKAAVESACPRTVSCADLLTIAAQ
2bbtA           ISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFA-----------------EKDNIVL
1e9sE           NGDMLSK------FGRDKDIILNPYDQRTKGWSFFNE---IRNDYDWQRYALSVVPRGKTDEAEEWASYG
3dfdA           VYPTFKAKE----LREAYKTEDPVEVAKRVLSVGGEYA--------------------------------
2bkeA           AVYIDTEGTFRWERIENAKALGLDIDNVNNIYYIRAINTDHQI----------------------AIVDD
1cfrA           FSKVLSGDEAIRLGGKISDGSFNKCNWYEWLIGIRAIEFETNFIVVKMPNATSFDVMSIYKSCLSEFIYN
1ckvA           GKIEVDCDEI----SELLGRQFNVYDFLVDVS--------------------------------------
1eamA           DGRHHDPILNLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISD---------VRSPSTADLLSNYALQNV
5dfrA           -----------------------------------------------------------------FKRNT
3bk7A           -------------------------------------------------------------------LDR
3d1mB           -----------------------------------------------------------------EKTLG
4dfrA           -----------------------------IAALAVDRVIGMENAMPWNLPADLAW----------FKRNT
3d1mA           ----------------------------------------------------------------AEKTLG
3dyoA           ------------------------------------------------------------------APLD
3cr7B           GDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVETGLPFVEV
2a1fD           ----------------------------------------------------------------------
2ancF           LATGVDVFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAN
2dftA           QRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAVRRT
1draA           --------------------------ISLIAALAVDRVIGM----------ENAMPWNLPAELAWFKRNT
1dyhA           -----------------------------IAALAVDRVIGMENAMPWNLPADLAW----------FKRNT
3ecpA           AALGDPR------RTARLVNVAAQLAKYSGKSITISSGSKA--------------AQEGAYRFIRNPNVS
2aumB           -----------------------DQTWQPIDGRVALIAPASAIATEVLEATLRQLEVHGVDYHLGRHVEA
3cbnA           PN--------VTAGHRTTFEVTVDPEI----GETADCIIGVSSSDSISTLPDEKRAIARESLVRDEIRGY
1e2nA           PMTYWRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPAL
3ed8A           YQQNTPIGDGPVLLPD-NHYLSYQTVLSKDPNEKRDHM--------------------------------
1e4vA           AAVKSGSE-----LGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGI
1e2iB           PMT----------YWRVLGASETIANIYTTQHRLDQGEI------SAGDAAVVMTSAQITMGMPYAVTDA
1d2zD           LNESTPARPVDGPGA-LISLELL-----------------------------------------------
3b55A           -----------------------------------------------------------------HAKPL
3bwdD           DTAGEDYN-----RLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDD
1e1qB           LYCIYVAIG----QKRSTVAQLVKRLTDADAMKYTIVSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLL
3cnnA           K----ILDTPGILYKNIFSEDLAAKLLLVGSLPVERIEDQRIFERAFEIFARSIGIESSFSEFFEDFARK
3c7kA           YSNTIQSLAAIVRAMDTLGVEYGDKERKTDSKMVCDVVSR------------------------------
2a1fC           ----------------------------------------------------------------------
3cqcA           HMNSVPQKPALIPQPTFTEKVAHEHKEKKYEMDFGIWKGHLDALTA-------------------DVKEK
2awoD           RMNDTPPAERGVGMVEPSVFLLDEPLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLD
2b8tD           SIRNIQSRTGTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDFDDRICEVANILAENGFVVIISGLDKN
1e2mB           VLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTLAPHIGGEAGSPPALTLIFDRHPI
3cmuA           EHALDPI------YARKLGVDIDNLLCSQPDTGEQALEI-------------------------------
3cphA           FKIKTVDINGKKVKLQLWDTAGQERFRTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLL
2d7vA           QLEKHH-------LAHENCFIAN-----------------------------------------------
1dp0A           ---------------------------------------------------------------------D
3bb1D           RPVMVSRSRAFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAIT
2anbA           TRQP-------RPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDI
3bjqB           ----------------------------------------------------------------------
1afrA           A---------------------------------------------------------------------
2d7vB           QLEKHH-------LAHENCFIAN-----------------------------------------------
1cjuC           KNNLKEAIETIVAAMSNLVPPVELAN--------------------------------------------
1cjvC           NLKEAIETIVAAMSNLVPPVELANPE--------------------------------------------
1drbA           -----------------------------------------------------------------FKRNT
2dftC           QRTGRSIADIFA-TDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEG
3e8aC           KNNLKEA------IETIVAAMSNLVPPVELANPENQ----------------------------------
1e9sA           NGDMLSK------FGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLL
1accA           DITEFDFN-------------FDQ-------QTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIR---
2ancD           TRQPRPGEVHGEHYFFVNHDEFKEMI-------SRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDI
1bccF           -------RWLEGIRKWYYNAGFNKYGLMRDDTIYENDDVKEAIRRLPENLYDDRMFRIKRALDLNMRQQI
3b85B           PAVE---------AGEKLGFLPDPYLRPLHDALRDVEPEVIPKLEAGIVEVAPLAYRGRT-----LNDAF
2e85B           ----------------------------------------------------------------------
1dvrA           SQIAKGTQ-----LGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPILVGFPRTIPQAEKLDQMLKEQGTP
2a1fE           ----------------------------------------------------------------------
3do6A           PS--------------------------------------------------------------------
1azsC           KNNLKEAIETIVAAMSNLVPPVELANPENQFR--------------------------------------
3dm5B           DTWRPGAYHQLRQLLDRYHIEVFGNPQEKDAIKLAKEGVDYFK----------------------SKGVD
2a5vB           VVERVAPS---------VLLGRRDGLSRVDEFEQRHVH--------------------------------
2c9gA           ----------------------------------------------------------------------
2cdnA           EG-----TKLGVEAKRYLDAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGT
2a5vA           VVERVAPS---------VLLGRRDGLSRVDEFEQRHVH--------------------------------
2d2fA           GENI-LELSPDERARKGLFLAFQYPVEVPGVTIANFLRLALQAKGVAEFWTKVKKALELLDWDESYLSRY
3c7kC           -------------VKQYKPVVYSNTIQSLAAIVRAMDTLGVEYGDKERKTDSKMVCDVVSRMEDTEPFSA
3c85A           RIGTGAYDELRARYGKIS-LGIEIREEAAQQHRSEGRNVISGDATDPDFWERILDTGHVKLVLLAPHHQG
3bm2B           ---------------------ALELLI-NRRSASRLAEPAPTGEQLQNILRAGRAPDWHFFVIEGEGRER
2b0lC           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
1e2nB           PMTYWRVLGASETIANIYQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALHP
1e9rB           NGDMLSK------FGRDKDIILNPYDQRTKGWSFFN----------------------------------
3cd9A           TPIGDGP-------VLLPDNHYLSTCSALSKDPNEKRD--------------------------------
1e2jA           GASETIANIYTTQHRLDQGEISAGDAAVVMTSANITMAVLAPHIGGEAGSPPPALTLIFDRHPIAALLCY
1d6aA           NPKVLNLQETTAIHDAKNGVLPKPLELVDASGAKWIVL--------------------------------
3b9qA           DTFRAAASDQLEIWAERTGCEIVVAEKAKAATVLSKAVKRGKEEGY-----------DVVLCDTSGRLHT
1d8jA           -----------------------------------------------------------------DEILD
2an9A           TRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSR-------EAIEQVLATGVDVFLDI
1e2lA           ASETIANIFTTQHRL-DQGEISAGDAAVVMTSAQITMGMPVTDAVLAPHIGGEAGSPPPALTLIFDRHPI
1e2mA           PMTYWRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAV-----------LAPH
3cbqA           TYERRIMVDKEEVTLVVYDIWEQGDAGGWLRDHCLQTGDAFLIVFSVTDRRSFSKVPETLLRLRAGRPHH
2aexA           ----------------------------------------------------------------------
2bboA           ISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKF--------------AEKDNIVLGE
2ancB           TRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYG-------TSREAIEQVLATGVDVFLDI
2a78A           YRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENV
2c9oA           EVYSTEIKKTEVLMENFRRAIGLRIK-----ETKEVYEGEVTELTPCHVIIGLKTAKGTKQLKLDPSIFE
2e85A           -----------------------------------------------------------------AAPKG
1e9sK           NGDMLSK------FGRDKDIILNPYDQRTKGWSFFN----------------------------------
2cbzA           ----------------------------------------------------------------------
1ckeA           HVDVASEDALVPLAS-HLDVRFVSTNGNLEV----ILEGEDVSGEIRTQEVANAASQVAAFPRVREALLR
1dwmA           ----------------------------------------------------------------------
3ci2A           ----------------------------------------------------------------------
1agpA           YRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDV
3dkvA           FRAAMKEETPLGLEA---KSYIDKGELVPDEVTIGIVRERLSKSD-------------------------
1e2hA           LGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQ-----------------------------------
1e2kB           VLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVT-------------------DAV--
2bwjB           ----------------------------------------------------------------------
2ax4B           NVRHGLNRNLGFSPGDREENIRRIAEVAKLFADAGLVCITS-----------------------------
2bhvC           ------------------LRTITADKMIPALITPISSQIAGKVIAQVESDIFAHMGKAVLIPKGSKVIGY
3bs4A           SYP---LQLIIR-ILSRFGVDVIKYLENHRLAIVDTFGSFHGIMPGVWYLEGMLSSETLPIKYAKAVEDH
2cfsA           ----------------------------------------------------------------------
1brwA           HVEISKDEFIRLVNENGIAIIGQTGDLTPADKKLYALR--------------------------------
3csuA           TAAKLKANPPELLKHKVIASCFFEASTRTRLSFETSMHRLGASVVGFSDSGKKGETLADTISVISTYVEG
2c5mD           ----------------------------------------------------------------------
3cddA           GITGYVDDWVPSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNDVGE
2axnA           ----------------------------------------------------------------------
2ekbA           ------------------------------------------------------------------RLYP
2ax4A           NVRHGLNRNLGFSPGDREENIRRIAEVAKLFADAGLVCITS-----------------------------
3dmdA           ----------------------------------------------------------------------
2c95B           SSGSARG------KKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQ
3e70C           DTFRAGAIEQLEEHAKRIGVKVIKHS--------------------------------------------
1e2lB           DDIVYVPEPMTYWRVL--GASETIANIFTTQHRLDQGEISAGDAAV--VMTSAQITMGMPYAVTDAVLAP
1dapA           ----------------------------------------------------------------------
1e2jB           TYWRVLGAS----ETIANIYTTQHRLDQGEISAGDAAVVMT-----------------------------
3cddB           QACTVDIGGERVITGYVDDWVPSYDESTITISVSGRDKTADLVDCLTQIADIVCKPFGIKVIVNTDVGEP
3bb4A           ----------------------------------------------------------------------
2c9oB           EVYSTEIKKTEVLMENFRRAIGLRIK--------------------------------------------
3cr8B           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           PPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSGEEVMAILRQLRDRGHTVIIVTHDPLIAAQA
3b5jA           QGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKIC-KGRTVIIIAHRLSTVKNA
2dwoA           AVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRI
3dmdC           VLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFEAVKIDGIILTKLDDARGGA
2dwpA           AVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAM-DDFMKR
3c95A           FPGTLDYAEQQRWLEHRRQV--FTPEFLQGYADELQMLVDKEKVALLKALWQYADEIV------------
2d3wB           VNVGFSGGEKKRNDILQMAVLEPELCILDESDSLDIDALKVVADGVNSLRDGKRSFIIVTHYRILDYIKP
3cmvH           GLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNQ
3cmvG           GLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNK
2ccgA           SLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQEDLKFEKVIEGY
2akaB           VGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGT
1bifA           AVFDATNTTRERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATEDFMRRE
2ccjB           SLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNNRLDQEDLKFHEKVIEGYQEI
2bifA           AVFDATNTTRERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATEDFMRRE
2bbsA           VLITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKA
2ccgB           SLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSDQEDLKFHEKVIEGIIHNES
2czvA           PLLYSNPYERANLAWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISLGVVI---GMEIPQAKAS--ISMYP
3dmdB           VLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFEAVKIDGIILTKLDDARGGA
2c03B           ILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFEKVGVTGLVLTKLDGDARGA
2c61B           RAGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELHR----KGIYPPINVLPSLSRLM
1e69A           KLSLLSGGEKALVGLALLFAKPSPFYVLDEVDSPLDDYNAERFKRLLKENS-KHTQFIVITHNKIVMEAA
3cmvC           AARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGSETRVKVVKNKIAAPFKQ
4dcgA           KDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPN
3cmvA           GLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNK
2dr3A           VHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMAILQLKRVLAGTGCTSIFVSQVSGVEHGV
3b60A           NGVLLSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQ-AALDELQKNRTSLVIAHRLSTIEQA
3eiuB           RAGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYI----TEGQIVVARELHRKGIYPPINVLPSLSRLM
1e9cA           TGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHE----RYENGAFQERALRCFQLMKDTT
3czpB           FWLAIDKQTQERF-KEREKTPYKRYKITEEDWRNRDKWD-----QYVDAVGDVDRTSTEIAPWTLVEARF
2a2zD           EWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRYLEKLHYKHESWLLHRTLKTNFDYLE
1e9fA           TGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRYENGAFQERKDTTLN-WKMVDASKSIEAVHED
2b8wA           SVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSKDETFNLPRLCIRKFFPKKKCFVFDRV
2c03A           ILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFEKVGVTGLVLTKLDGDARGA
1e98A           TGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAF---QERALRCFHQLMKDTT
2b8tA           FKGEPFGPIAKLFTYADKITKLTAICNECGAE------ATHSLRKIDGKHADYNDDIVKIGCQEFYSAVC
1d1cA           IFYQLLAGATAEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFKITRQA-MDIVGFSQEEQMSIFKII
2a30D           EWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLNEEQGIPLEYLEKLYKHESWLLHRTLKTFDYLQE
3eiuA           RAGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVAREL-----HRKGIYPPINVLPSLSRM
2cjwB           REVSVSEGRAAVVFDCKFIET-------------------SAAVQHNVKELFEGIVRQVRLRRDSKEKNE
2dr3E           VHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYIAMARSIILQLKRVLAGTGCTSIFVSQVPGVEHGV
1e2dA           GAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAF----QERALRCFHQLMKDTT
2bc9A           VYNSIGTINQQAMDQLYYVTELTHRIRSKSDFVSFFPDFVWTLRDFSLDLEADGQPLTPDEY--------
2cckA           YIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDLKFHEKVIGYQEII
1e9sF           VPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFTLAESLFAGSNEASKAL
3dm5A           IIVDTAGRHKEDKALIEEMKQISNVIHPHEVILVIDGTIGQQAYNQALAFKEAPIGSIIVTKLDGSAKGG
1e9sG           VPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEAESLFAGSNEASKAL
2a2zA           NLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGREEQGIPLEYLEKLHY
1cr4A           SFAEAETDRLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGFA--KSTGVVLVVICHLKALRQLS
2awnD           KIVVLDAGRVAQVGKPLELYHYPADRFVAPKMNFLPVKVTATAIDQVQVELPMPNQQVWLPVESRDVQVA
2d62A           KPRELSGGQRQRVALGRAII-RRPKVFLDEPLSNLDAKLRVKRAELKKLQRQLGVTTIYVTHDQVEA--T
3d3kA           ENVFLRDQPWYKAAVAWANQNRAPVLSIDPPVH-IDAKWSLALGLPLPLGEHAGRIYLCDIGIPQVFQEV
1e9rA           LRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASALTSARFVLSDKLPEHVTM
3bb1B           DSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLASDIPVVLIENSGCNSDEKVL
3b2qA           TDITNYAEALRQMGAARNEV---PGRRGYPGYMYTDLATLYERAGIVKGAKGSVTQIPILSMPGDDITHP
1e9dA           TGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHE----RYENGAFQERALRCFQLMKDTT
3b85A           QKFLTRLGFGSKVVTGDGLRL-VRHILRGVDDVHFSELTSSDVVQLVGHIVDA-----------------
3bpbA           EGARQMIAILEKHGLSGSVVRLEKVLGLKTGLAYLEHNNLLAAGEFVSKPEFQDFNIIEIPEEE---SYA
2c9oC           VDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPDLLDRVMIIRTMLYTPQEM
2cgtH           DRGYLSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKLLIIAEDVEGEALATLVVNM
2c04A           ILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGTGLVLTKLDGDARGA
2b92B           SKSSFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSTFNLPRLCIRKFFPKKCFVFDRP
2a5gA           KQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSN--------------------
2c61A           TDITNYAEALRQMGAARNEVPGRRGYPGYMYTDLATLYERAGIVKGAKGSVTQIPILSMPGDDITHPIPD
1aroP           GEARFRKMFERQLLITTLLPKMIARINDWFEEVKAKRGKRPTAFQFLQEIKPEAVAYITIKTTLCLTSAD
2c9yA           LDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIR-RSDDNEKALKIRLQAY
2d4hB           LDLEADGQPLTPDEYLTYSFPKKKCFVFDRPVHRRKLAQLEKLQDEELDPEFVQQVADFCSYIFKTKTLS
3b2qB           RAGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVA----RELHRKGIYPPINVLPSLSRLM
1ai4B           ATSGLTQSDPRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSMLKRTVVAAVPMPFDKWYSASY
3a1wA           KKVILAMTAIDEAKKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEY--------------------
3cr7C           YKKAREGVIKEFTGISAPYEA-PANPEVHVKNYELPVQ--DAVKQIIDYLDTKG----------------
2bdtA           LLRRDALRKKGERCLELVEEF--ESKGIDERYFYNTSHLQPTNLNDIVKNLKTNPRFI------------
2axzC           LPYEEVSSIIKPYPIVDSFGKDYDLTIQTVLKNALTISINRNLKEAQYYINQFKNISINGYYDLEINYLK
1e9sD           VPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDGFLEGTLAESLFAGSNEASKAT
1bg0A           PLTGMSKATQQQLIDDHFLFKEGDRFLQTANACRYWPTGRGIFHNDAKTFNEEDHLRIISMQKGGDLKTL
2a30B           EWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCRNEEQGIPLEYLEKLYKHESWLLHRTLKTFDYLQE
1e2fA           TGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHE---RYENGAFQERALRCFHQLMKDTT
3dt4A           TITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGRRPAGVPLVYEALSWQHGGAA
2ctsA           FPTNLHPMSQLSAAITALNSESNFARAYA-----------------------------------------
3bb1E           DSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKKASDIPVVLIENSGRCNKND
3dt2A           TITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGRRPAGVPLVYEALSWQHGGAA
421pA           LVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVRE--------------------
3d7wA           SVTALRFPGGQTKTQAR--SILILIQMISEAARFNP------ILWRARQYINSGASFLPDVYMTSWGQQS
2bbsB           GGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKA
1e4yA           LLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVK-FNPPKVEGKDDVTG
1dg3A           DSADFVSFFPDFVWTLRDFSLDLQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLC-IRKFFPKKKCFVFD
2d4hA           RSKSSPDESADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLFNLPRLCIRKFFPKKKCFVFDRP
1e9sJ           VPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGGTLAESLFAGSNEASKAT
1dkiA           SSGSAGSSRVQRALKENFGYNQSVHQINRGDF------SKQDWEAQIDKELSQNQPVYYQGVG----KVG
2awnB           KPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLKRLGRTMIYVTHDQVEAMTA
2axpA           GDEYIEGKDIDSILELYREVSNAGLHTYSWDTGQWSS---DEIAKDIIFL--------------------
2b8tB           FKGEPFGPIAKLFTYADKITKLTAICNECGAEATHS-------LRKIDGKHADYNDDIVKIGCQEFYSAV
3dhwC           YPSNLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRILELLKDINRRLGLTILLITHEMVVKRIC
2dr3B           VHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQVLAGTGCTSIFVSQVSVGERGF
3cr7A           YKKAREGVIKEFTGISAPYEAPAPEVHVKNYELPVQ----DAVKQIIDYLDTKGYLP-------------
2b8tC           FKGEPFGPIAKLFTYADKITKLTAICNECGAEATHS------LRKIDGKHADYNDDIVKIGCQEFYSAVC
2a5jA           IGNKSDLESRRDVKREEGEAFAREHGLIFMETSAKTACNVEEAFNTAKEIYRKIQQGL------------
2bbtB           LGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKA
2a30A           EWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLNEEQGIPLEYLEKLYKHESWLLHRTLKTFDYLQE
3adkA           PTLLLYVDAGPETMTKRLLKRGETSGRVDDNEETIKKRLEYKATEPVIAFYEKRGIVRKVNAEGSVDDVF
3cddD           QRIQIEQGETPHELLARLAKQRG-VLLTSDTFGNLVITRASKTKAGVS--LILGDNVKAARGRFSWRQRF
1e3aB           ATSGLTQSDPRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSMLKRTVVAAVPMPFDKWYSASY
3cmtD           FINQIRMKNPETTTGGNALKFYASVRLDIRRIGAVK----EGENVVGSETRVKVVKNKIAAPFKQAEQIL
3bo6B           YSASSLHNTRQFIECLESRLSESGLMPGQYPESDVHPENWKYVSYRNELRSGRD-GGEMQSQALREEPFY
3cddF           KFTIKAAGIKADVTDSEIGRYRPLIIVNEEVTTAEGAAKRGQWERQRSI-GKSNAEYTVTGWRIPQTGKL
1e0jA           DRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGAKSTGVVLVVICHLKPDKGKA
3dm9B           DVVLIDTAGRSETNRNLDEKKIARVTKPNLVIFVGDALAGNAIVEQARQFEAVKIDGIILTKLDADARGA
3da4A           LGAMFSGKEYQILLPGEIHIK-------------------------------------------------
2c4rL           YTGEIPLFSHYQIESQIESAFQSGGSIVIDSTEALTAIDINSARGDIEETFNTNLEAADEIARQLRLRDL
1cr2A           DSFEAETDRLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGF--AKSTGVVLVVICHLGALRQLS
2ahwD           RQQGGKLNEVTKEDLIKLVEFDNKEYLYYKAIAPDIAFIRATTCDSEGYATFEDEVMYLDALV-------
2b8wB           MDQLYYVTELTHRIRSKSSVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSKLKKGTSQKDETFNLPL
1e0jB           DRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGAKSTGVVLVVICHLKNPDKGS
3czpA           FWLAIDKQTQERF-KEREKTPYKRYKITEEDWRNRDKWDQDAVGDVDRTSTEIAPWTLVEAND----KRF
3cmxA           FINQIRNPETTTGGNALKFYAS-VRLDIRRIGAVKEGENVVGSETRVKVV-----KNKIAAPFKQAEFQL
3dtbB           TITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGRRPAGVPLVYEALSWQHGVFV
2a2zB           EWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETGRNEEQGIPLEYLEKLHYKESWLLHRTLKTNFDLQE
3bb1C           DSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVR-SGASLKSDIPVVLIENSGRCNKNDS
1e9rE           VPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEAS
1av6A           ILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSNYEKKMYY
3bb1F           DSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKKD-IPVVLIENSGRCNKNDS
2akaA           FYQLLAGATAEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFKITRQ---AMDIVGFSQEEQSIFKII
2bjbA           LSAASFTDGLTVQHTGSSLPSAPHIAMTAAMLRQAGDIDDSTPNRWQVRPGPVAARRWDIEPDLTNAVAF
3cioD           DLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIK------
2d4uA           NYDIYHNALAELIQLLGAGK---INEFFDQPTQGYQDGFEKQYVAYMEQNDRLHDIAVSDNN--------
2awnC           KPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEIRLHKRLGRTMIYVTHDQVEAMTA
1e2kA           LAPHIGGEAGPPPALTLIFDRHPIAALLCYPAMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDA
2dr3F           VHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPRSIILQLKRVLAGTGCTSIFVSQVSGVEHGV
2c0bL           YTGEIPLFSHYQIESQIESAFQREVRLPSGGSIVIDSTEALTAIDINSARAADEIARQLRLRDLIVIDFI
1d6jB           PFVEVYVDVPVEVAEQRAPYEAPANPEVHVKNYELPVQ--DAVKQIIDYLDTKG----------------
3cr7D           YKKAREGVIKEFTGISAPYEA-PANPEVHVKNYELPVQ--DAVKQIIDYLDTKGYLP-------------
3clvA           ILVANKIDKNFQVDILEVQKYAQDNNLLFIQTSAKTGTNIKNIFYMLAEEIYKN----------------
1e59A           PPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVIIAAHGNSLRALV
3dfpC           HPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDVNPCIG
1e6cA           AHQRPTLTGRPIAEEMEAVLREREALYQDVAHYVVDATPAAIVCELMQTMR-------------------
1e3mB           RIFTRVGTFVETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWACNLANKIKALTLFATHYFLTQLPE
1e9sB           LRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKATSARFVLSDKLPEHVTM
3dfnC           HPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDVNPCIG
1e3mA           DRIFTRVGFVETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWACAENNKIKALTLFATHYFLTQLPE
2eg5G           NKGSIYSSKASRLPVQKAYLDQFTKDFTTFLRIHSEELFSHG---RMLLTCICKGVELDARNAIDLLEMA
2ahvA           RQQGGKLNEVTKEDLIKLVEFDNKEYLYYKAIAPDIAFIRATTCDSEATFEDEVMYLDALVIAQAVHNNG
3dfoD           HPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDVNPCIG
3bgwA           AGQSVNYIWSKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQARELDVVVIALSQLSQVEQRQ
3dfqD           HPALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDVNPCIG
2cckB           RALNEFAINGLYPDLTIYLNVSAEVGRERIIKNRLDQEDLKFHEKVIEGYQEIRFKSVNADQPLNVVEDT
2ausC           PPGPTSHEVVAWIKRILNLEKAGHGGTLDPKVSGVLPVALERATRVVQALLPAGKEYVALMHLHGDVPED
1e9rD           VPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEAESLFAGSNASKALT
3cddC           QRIQIEQGETPHELLARLAKQRG-VLLTSDTFGNLVITRASKTKAGVSLI--LGDNVKAARGRFSWRQRF
2bkiA           FYRLCAGASEDIRERLHLSSPDNFRYLNRGCTRYFANKETDKQILQNRKSPEYLKAGSLKDPLLDDHGDF
3cmvE           AARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGVKEGENVVGSETRVKVVKNKIAP
3dftD           HPALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDVNPCIG
3dfpD           HPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDVNPCIG
3dt7A           TITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIRPAGVPLVYEALSWQHGGAA
1cr1A           YDSFAEAETDRLLAKLAYMRSGLGVIILDHIS--IRKMIDNLMTKLKGFAKSTGVVLVVICHLKALRQLS
3dfqA           HPALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDVNPCIG
1dhjA           LDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACDVPEIMVIGGGRVYQFLPKA
1aldA           YPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDVNPCIG
2dr3C           VHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPASIILQLKRVLAGTGCTSIFVSQVSGVEHGV
2dflA           LQELVSKDPSIKLIVVDSVTSHFRAEYPGRENLAVRQQKLNHLHQLTRLAEVYDIAVIITNQVMHTLYHP
3ch4B           GWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRS---------------------
3dfnA           HPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDVNPCIG
1cs4C           ----------------------------------------------------------------------
1adoA           HPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDVNPCIG
3dfnD           HPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDVNPCIG
2bwjA           PQLVICMDCSADTMTNRLLQMSRSSLPVDDTTKTIAKRLEAYYRASIPVIAYYETKTQLHKINAEGTVFL
6aldA           HPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDVNPCIG
3dftC           HPALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDVNPCIG
2bx2L           YTGEIPLFSHYQIESQIESAFQREVRLPSGGSIVIDSTEALTAIDINSARGDIEETAFNTNLE-AADEIA
1cjtC           ----------------------------------------------------------------------
2a1fF           -----SQPIYKRILLKLSG-----EALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGK
1e9sM           LRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEAKALTSARFVLSDKLPEHVTM
3bh0A           YIWSKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISRDLKARELDVVVIALSQLSQVEQRQ
3dt4C           TITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGIIFGGRRPAGVPLVYEALSWQHGGAA
3bb1A           -SFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEA-LLQVVRSGASLKSDIPVVLIENSGRCNKNDS
1ek0A           NKIDLQEGGERKVAREEGEKLAEEKGLLFFETSAKTGENVNDVFGIGEKIPLK-----------------
1d6jA           LHEVATPGEETGLPFVEVYVDVPVEAPYEAPANPNYELPVQDAVQIIDYLDTKG---YLPAK--------
2bhjA           TLDELIFATKMAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHILYTNNGNIRSAITVFPQRSD
3d3qA           EDKKQVKLKEYLASFDKESAKDIHPNNRKRVLRAIEYYLKTKKLKVQQFTENYDTLLIGIESRELYLRIN
1bmfC           PLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYR-QMSLLLRRPPGREAYPGDVFYLHSLLERAA
3c8uA           ARDIAIAGAAEVGPECRVAIIEGNYLLFDAPGWRDLTAISIRLEVPADLEARLVQRWLDHGLNHDAAVAA
2c7cH           DRGYLSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEAAKAGKPLLIIAEDVEGEALALVVNTM
3dfqC           HPALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDVNPCIG
2d0kA           LNKPVIYGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAAADVPEIFVIGGGRVYQFLPKA
1dekA           FNKITDVINNIEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFALDYLDKFNSGYDYYIVPDTRQDHEMDR
3di4A           DHTGLPLHEAELVHDVLNVFRDTGQYFKASPVRPGDYLEFFAEIDLLGNLSACPGGDCSSEASC----HP
1e9rF           LRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSD-------
2czvB           PLLYSNPYERANLLWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISLGVVI---GMEIPQAKASISMYPE-
1cr0A           YDSFAEAETDRLLAKLAYMRSGLGVIILDHIS--IRKMIDNLMTKLKGFAKSTGVVLVVICHLKALRQLS
3d3qB           EDKKQVKLKLKELELNNNKLHEYLASFDKESAKDIHPNNRKRVLRAIEQFTENYDTLLIGIESTLYLRIN
2awoC           KPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEIRLHKRLGRTMIYVTHDQVEAMTA
3dfoC           HPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDVNPCIG
3d31A           NPLTLSGGEQQRVALARALVTNPKILLLDEPLSALDPRTQENAEMLSVLHKKNKLTVLHITHDQEARIMA
3a00A           GKTCILDIDMQGVKSVKAIPELNARFLFIAPPSVTGAHDKVIVNDDLDKAY-KELKDFIFAE--------
3cmwC           GDSHMGLAARMMSQAMRKLAGNLKQSNTL------LIFINQIRMKIGVMFGNPETTTGGNALKFYASRLD
1e9sH           LRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVT
2bkhA           FYRLCAGASEDIRERLHLSPDNFRYLNRGCTRYFANKETDKQILRKSPEYLKAGSLKDPLLDDGDFIRMC
3bgwD           YIWSKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQIDLKKMARELDVVVIALSQLSQVEQRQ
3bjdB           PAADLSRALEQEIAAQSRERHPQYVFSGSASRAQLQVFLRHQWFRTFRLYR-DAADLLVNLTDVDEAAAL
2cvfA           QVLLWIARKHNIPVIVINQVHFDSRTEMTKPVAEQTLGYRCKDILRLDKLPKPGLRVAVLERHRFRPGLM
3cnlA           RGLLKKGGVPDIERALMLFFTEVARVSFERPE--------------------------------------
2bv7A           ALKKYHG-WIVQKIFQAALYAAPYKSDFLKALSKGQNVTEEECLEKVRLFLVNYTATIDVIYEMYTRMNA
3be4A           SLTSVISGRCTHPASGRIYHVKYNPPKQPGIDDVTGEPLVWRDDDNAEAVKVRDVFHKQTAPLVFYEDLG
3bczC           QTDEDEHSIEHLPYTAKAESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDESQGEIY
3czjA           NDIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHWQHQGKTLFISRKTYRIDGG
2dr3D           VHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYIAMARSIILQLKRVLAGTGCTSIFVSQVSGERGFG
2awoA           KPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMREISRLHKRLGRTMIYVTHDQVEAMTA
2bhvA           YSNNNKMGEYRDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRYGSAFGDYLLMQLMRQSGMGINQV
1dw9A           AVITLDGK--------------------------------------------------------------
3dlbB           YHASKGRLQGREGGRVAWVAD---PKDPRKPIPHLTGLLVPVGSLALSLPWERRRRTREIASWIGRRLGG
1culC           ----------------------------------------------------------------------
1b0uA           YPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEGFARHVS
3cm0A           PEEELVRRILRRAELEGRSD------DNEETVRRRLEVYREKTEPLVGYYEARGLKRVDGLGTPEVYARI
3dymA           LDNDIGVSEATRIDPNAWVERWKGHYQAEAALLQCTADTLADAVLITTAHWQHQGKTLFISRKTYRIDGS
1cjaA           RD-IITLYTGYDVGTEGSISMQEGFLATVRECASFDLDAFERELLSWQESSISPQAIPFILRM-------
1ak2A           LDSVIEFSIPDSLLIRRITGRLIHPQSGRSYHEEFNPPKEPMKDDITGEPRRSDDNKKALKIRLAYHTQT
1dekB           AFCYLNGKSPIKGVFVFDDEG-KESVNFVAFNKITDVINNIEDQWSVRRLMQALGDLIVNNFDRMYWVKL
3bv4A           -PALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDVNPCIG
1dhiA           LDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACDVPEIMVIGGGRVYQFLPKA
1eilA           SVGLMAAGSAGDAALYRADQRAWRIAVQPGELDDLAYAGLEVDDALERMADKLRQAGVAFTRGD-EALMQ
1e2gA           TGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGERYENGAF--------QERALRCFQLMKDTT
3crmA           LYYKALLEGLPYTVAQLAIAPEQRQVLHARIAQRFRQMLEQGFIAEVEALHARSHAGLPSIRAVGYRQVW
1c9kC           YAAMERAIDDEIQILIAACQRCPAKVVLVTNEVGMGIVPENRLARHFRDIAGRVNQRLAAAAD-------
3c14C           ----------------------------------------------------------------------
2ck3C           PLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYR-QMSLLLRRPPGREAYPGDVFYLHSLLERAA
1e9sL           LRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEAKALTSARFVLSDKLPEHVTM
1bglA           ----VSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHWQHQGKTLFISRKTYRIDGS
2d3wA           VNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYP
2d2eA           LSRYLNEGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVITHYQLNYIQP
3brwA           KFGVIYQKLGATSEEELFSTN-EESPAFVEFLEFLGQKVKLQDFKGFRGHGQTGTESVYCNFRNLPYTEG
3bb1G           DSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVR---SGASLSDIPVVLIENSGRCNKND
2d3wD           VNVGFSGGEKKRNDILQMAVLEPELCILDESDGLDI-DALKVVADGVNSLRDGKRSFIIVTHYQRILDYP
2ccjA           SLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGREIIKNSNRLDQEDLKFHEKVIEGYQEI
1e2hB           ALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRDLAMLAAIRR-VYGLLA
3c15C           ----------------------------------------------------------------------
2aunA           RYRYLAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPIGFSDISVLLSAFH
1e2iA           PAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPPGERLDLAMLAAIRRVYGLLANTVRLQCGGSWR
3cueF           VGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMS--------------
1akeA           VDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTHQMTAPLIGYYSEAEAGN
3ec1A           RLDYIKGGRRSFVCYMANELTVHRTK-LEKADSLYANQLGELLSPPSKRYAA--EFPPLVPRSLSVKERK
2awnA           ----------------------------------------------------------------------
2aumA           RYRYLAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFADI-----SV
2d3wC           VNVGFSGGEKKRNDILQMAVLEPELCILDESDDIDALKVVADGVNSLRD-GKRSFIIVTHYQRILDYIKP
2boeX           NPGQITGQVDALMSAAQAAGKIPILVVSNAPGRDCGGGAPSWIDEFAAGLKNRPAYIIVEPDLSLMSSCM
1e9sI           VPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEAS
3dauA           LNKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIACGDVPEIMVIGGGRVYQFLPKA
2aunB           RYRYLAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFSDIS----VL
2bofX           CGAPSHSAYRSWIDEFAAGLKNRPAYIIVEPDLISLMSSCMQHVQQEVLETMAGSSQARIYFDAGHSSPA
3bb1H           DAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFRSEALLQVVRSGASLKKDSDI
3cmvB           IEGEISHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQ
2dpyB           RIALAIGEPPATKGYPPSVFAKLPALVERAGNGIHGGGSITAFYTVLTEGDDQQD---------------
3dvlD           VVGGFDLSALIERINYAIQKYRARRVSIDSVTSVFSSVVRRELFRLVARLKQIGATTVMTTEREEYGPIA
2d4uB           NYDIYHNALAELIQLLGAGK---INEFFDQPTQGYQDGFEKQYVAYMEQND-------------------
1e9rG           ----------------------------------------------------------------------
2bhvD           SNNNKMGEYRLDIVWSRIITPHGINIMLTNGYNGLVGELIERNFQRYGVPFGDYLLMQLMRQSGMGINQI
3a00B           GKTCILDIDMQGVKSVKAIPELNARFLFIAPPSGAHDK--VIVNDDLDKAY-KELKDFIFAE--------
2dpyA           ----------------------------------------------------------------------
2drcA           LDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPIMVIGGGRVYQFLPKA
3dffA           LDSIYRKLPDGRWLTAHVEGRQKLAVNDHSPDSDHDLVG-EVADDIRSIIDEFDPTLVVTCAA--IGEHP
4atjA           QSVTLAGGPSWRVPLGRRDSLQAFNANLPAPFFTLPQLKDSFRNVGLNRSSDLVALSGGHTFGKNQCRFI
2bbtA           GGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKA
1e9sE           RLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARF--------
3dfdA           ----------------------------------------------------------------------
2bkeA           LQELVSKDPSIKLIVVDSVTSHFRAEYPGRENLAVRQQKLNKHLHQLTRLEVYDIAVIITNQVVPGIRI-
1cfrA           NVNLITSNPDFSIIDIRGRREELKSMLKDISFSNISLSTISEIDNLYKNFIDYELEHIKSFLSVKTTFRP
1ckvA           ----------------------------------------------------------------------
1eamA           MISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNA
5dfrA           LDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVEAIAACGDVPEIMVIGGGRVYQFLPKA
3bk7A           ELHQLSGGELQRVAIAAALLRKAHFYFFDEPSSYLDIRQRLKVARVIRRLANEGKAVLVVEHDLAVLDYS
3d1mB           ASGRYEGKITRNSERFKELTYNPDIIFKDEENTGADRLMTQRCKDKLNAMNQWPGVKLRVTEGWDEDGHH
4dfrA           LDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRTWVKSVDEAIAACGDVPEIMVIGGGRVYQFLPKA
3d1mA           ASGRYEGKITRNSERFKELTYNPDIIFKDEENTGADRLMTQRCKDKLNALAIPGVKLRVTEGWDEDGHHS
3dyoA           NDIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAQHQGKTLFISRKTYRIDGG
3cr7B           YPVEVQRDPKGLYKKAREGVIKEFTGISAPYEAPANPEVHVKNY---------ELPVQDAVKQIIDYLDT
2a1fD           -----------QPIYKRILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGNLFRGAK
2ancF           DDFDTALTDLKTIIRAERLRMSRQKQRHDALISKLLA---------------------------------
2dftA           GGNDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPG----AVVRHILSRL--------------------
1draA           LDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACDVPEIMVIGGGRVYQFLPKA
1dyhA           LDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIACGDVPEIMVIGGGRVYQFLPKA
3ecpA           AEAIRKAGAMQTVKLAQEFPE----LLAIEDTTSLSYRHQVAEE-LGKLGSIQDKSRGWWVHSVLLEATT
2aumB           RYRYLAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFADSVLLSAFH
3cbnA           GHPELTLDHPTDIVCRKSDYICSRTLIRADKAAFDLDENLVRDL--------RKGRELKVEIIVEYEG--
1e2nA           TLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGPEDRHIDRLAKRQRPGERLDL
3ed8A           ----------------------------------------------------------------------
1e4vA           NVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEEYHQMTAPLIGYYSKEAEAN
1e2iB           VLAPHIGGEAHAPPPALTLIFDRHPILLCYPAARYLMGSMQAVLAFVALIPPTLPGTNIVLGALPEDRHI
1d2zD           ----------------------------------------------------------------------
3b55A           KTTNPTASLNDLKPLKNVG--SASIVGLGEATHGAHEVFTKHRI-VKYLVSEKGFTNLVLEEGWDRALEL
3bwdD           KQFFIDHAVPITTVQGEELKKLIGAPAYIECSSKSQENVKGVFDAAIRVVL-------------------
1e1qB           LRRPPGREAYPGDVFYLHSRL------LERAAKMNDAFGGGSLTALPVIETQAGDVSAYIPTNVISITDG
3cnnA           RGLLKKGGVPDIERALMLFFTEVARVSFERPE--------------------------------------
3c7kA           ----------------------------------------------------------------------
2a1fC           -----SQPIYKRILLKLSG-----EALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGNLFRGAK
3cqcA           MYNVLLFVDGGWMVDVREDAKEDH---------ERTHQMVLLRKLCLPMLCFLLHTILHSTGQYQECLQL
2awoD           AGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESDVQVGA
2b8tD           FKGEPFGPIAKLFTYADKITKLTAICNECGAEATHSLRK------IDGKHADYNDDIVKIGCQEFYSAVC
1e2mB           AALCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRDLAMLAAIRRVYGLANT
3cmuA           ----------------------------------------------------------------------
3cphA           LVGNKSDMETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKIDSNKLVG--------
2d7vA           ----------------------------------------------------------------------
1dp0A           NDIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADALITTAHAWQHQGKTLFISRKTYRIDGG
3bb1D           DSFGKGIWNKAIVALTHAQFSPPKDAASDIPVVLIENSGRCNDEKVLPNGIAQTITEVALNKSESIFVDK
2anbA           DWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAHYAEYDYLIVNDDFDTALTL
3bjqB           ---------QARVVD---------PILSTHARGYRQSTLIGKKLFPVAPVAQYGGKILTFGKEAFRLYNT
1afrA           ----------SFQERATFISHGNTARQAKEHGDIKLAQICGTIA------ADEKRHETAYTKIVEKLFED
2d7vB           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
1drbA           LDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDAIAACGDVPEIMVIGGGRVYQFLPKA
2dftC           VGGDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPG----AVVRHILSRL--------------------
3e8aC           ----------------------------------------------------------------------
1e9sA           LRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNESKALTSARFVLSDKLPEHVTM
1accA           DKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIV-----EIEDTEGLKEVIN
2ancD           DWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQSHYAEYDYLIVNDDFDTALTL
1bccF           LPKE---QWTKYEEDVPYLEPYLKEVI-------------------------------------------
3b85B           VILDEAQNTTPAQKFLTRLGFGSKVVTGDSGLRLVRHILRGVDDVHFSELTSSVVRHQLVGHI-------
2e85B           ----IDGGSAPENDIVARELRPTRLLIVDATDMGLNPGEIRII-----DPDDIAEMFMMTTHNMLIDQLK
1dvrA           LEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQISDDNADAL--------
2a1fE           -----------QPIYKRILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGK
3do6A           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
3dm5B           IIIVDTAGRHKEDKALIEMKQISNVIHPHEVILVIDTIGQQAYNQALAFKEATPIGSIIVTKLDSAKGGG
2a5vB           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
2cdnA           DIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQ-LKTVDAVGTMEVFARA
2a5vA           ----------------------------------------------------------------------
2d2fA           LNEGFSGGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVAMRGPNFGALVITHYQRILNYIP
3c7kC           ELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAGDYQPTEQDILRTRVKTTVETHFTFKN
3c85A           NQTALEQYKGQIAAIAEYPDQL-EGLLESGVDAAFNIYGSGFARHVCKQLE-PQFTSI------------
3bm2B           FSAIAAGSDDKAIDKARNAPFRAPLIITVVAKVPRWEQE-SAGCAVAQAAVAQGFGGIWRSGALTESPVV
2b0lC           -----------------HHMSKAVVQMAISSLSYSELEAIEHIFEELDGNEGLLRVGITRSVIVNALRKL
1chdA           ------------------LLSSEKLIAIGASTGGTEA-----IRHVLQPLPLSSPAVIITQHMPPTRSFA
1e2nB           IAALLCYPAARYLMMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKLDLAMLAAIRRVYGLL-A
1e9rB           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
1e2jA           PAARYLMGSMTPQ-AVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRAAIRRVYGLLANTVRYLQC
1d6aA           ----------------------------------------------------------------------
3b9qA           NYSLMEELIACKKAVGKIVSGAPNEILLVLDGNTGLNM----LPQAREFNEVVGITGLILTKLDSARGGC
1d8jA           ETQHLDIGLKQKQWLMTEALNNPKIEVIDGKYAFKPKYN-------------------------------
2an9A           DWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQSHYAEYDYLIVNDDFDTALTL
1e2lA           ----AALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALIDRLAKRQRPGERLDLAMLAAIRR
1e2mA           IGGEAGSPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRH--I
3cbqA           DLPVILVGNKSDLSLEEGRHLAGTLSCKHIETSAALHHNTRELFGAVRQIRLR-----------------
2aexA           -----------------------ELAHRCSSFMAPPVTDLGELRRRPETQAQVCQALAQVDGGANFSVDW
2bboA           GGITLSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKA
2ancB           DWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAMSHYAEYDYLIVNDDFTALTDL
2a78A           PGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKM--------------
2c9oA           SLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKEIIQDVTLHD------L
2e85A           NWVVIDGGSAPENDIVAIELRPTRLLIVDATDMGLNPGEIRIIDP-----DDIAEMFMMTTHNMPLNYLE
1e9sK           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
1ckeA           RQRAFRELPGL---IADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQVKGFSVNFRLLAKLVPAAD
1dwmA           --------------------------------------SGNMAAATVERENRNVHAIVLKEGSAMTKDFC
3ci2A           --------------------------------------SVEEAKKVILQDKPEAQIIVLPVGTIVTMEYI
1agpA           PVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFTLVREIR-------------------
3dkvA           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1e2kB           -LAPHIGGEAHAPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPE
2bwjB           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
2bhvC           YSNNNKMGEYLDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRYG----------------------
3bs4A           KMDLNLFEGRELYGFAISMSGYLEVFTPEETLRYLETS-AEVRYGHPAYKKYPRGTNFWLWEGVKDKRVL
2cfsA           ----MARCERLRGAALRDVLGRAQGVLFDDGVLWNGERAVPGAPELLERLARAGKAALFVSNNSRRPELA
1brwA           ----------------------------------------------------------------------
3csuA           AARLATEFSGNVPVLNAGDGSNLDLFTIQETQGRLDLKYGRTVHSLTQALKFDGNRFYFIAPDAAMPQYI
2c5mD           ---------KSCGLHVTSIKI-DPYINIDAGLTKDNNLTTGKIYQYVIKGDYLGKTVQVVPHITAIQEWV
3cddA           PFIQIEQGETPHELLARLAKQRG-VLLTSDTFGNLKAGVSLILGDNVKAARGRFSWRQRFSKFTIKAAKA
2axnA           ----------------------------------------------------------------------
2ekbA           ELREIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQEVFRFLEGLKAPAVLFTHGGVVRAVL
2ax4A           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
2c95B           PTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRL-ETYYKATEPVIAFYVRKVNAEGSVSVFSQV
3e70C           ----------------------------------------------------------------------
1e2lB           HIGGEAGSPPALTLIFDRHPIAALLCY-PAARYLMGSMTPQAVLAFVALIPPPGTNIVLGALPEDRHDRL
1dapA           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
3cddB           FQRIQIEQGETPHELLARLAKQRGVLLTSDTFGNLVITRASKTKAGVSLILG--DNVKAARGRFSWRQRF
3bb4A           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3cr8B           ----------PSLDLDWQQQCELEM-LMTGAYSPLTGFMTRAAQQLDDGSFWPSPITLTSRDRALADRRP
2bwjD           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ERIIEIHDGKIVHNPPAEEKKREQGVDAAVVNTAPGWRQFASSFREALSMAWLAMAANKMRTLLTMLxxx
3b5jA           DRIIVMEKGKIVEQGKHKE---------------------------------------------------
2dwoA           SCYEASYQPLD-----------------------------------------------------------
3dmdC           ALSISYVIDAPIFVGVGQGYDDLRP---------FEKEWFLERI--------------------------
2dwpA           ISCYEASYQPLDPDKCDRDLSLIKVIDV------------------------------------------
3c95A           ----------------------------------------------------------------------
2d3wB           DYVHVLYQGRIVSGDFTLVKQLEE----------------------------------------------
3cmvH           AEFQILYGEGIN----------------------------------------------------------
3cmvG           IAAPFKQAEFQILYGEGINFYGELV---------------------------------------------
2ccgA           QEIIHNESQRFKSVNADQP---------------------------------------------------
2akaB           DARDVLENKLLPRRGYIGVVNRSQ----------------------------------------------
1bifA           CYENSYESLDEEQDRDLSYIKIMDVG--------------------------------------------
2ccjB           QRFKSVNADQPLENVVEDTYQ-------------------------------------------------
2bifA           CYENSYESLDEEQ---------------------------------------------------------
2bbsA           DKILILHEGSSYFYGTFSELQNLRPDFSS-----------------------------------------
2ccgB           QRFKSVNADQPL----------------------------------------------------------
2czvA           EIILK-----------------------------------------------------------------
3dmdB           ALSISYVIDAPIFVGVGQGYDDLRPFEK---------EWFLERI--------------------------
2c03B           ALSARHVTGKPIYFAGVSE---------------------------------------------------
2c61B           NSGIGAGKTREDHKAVSDQ---------------------------------------------------
1e69A           DLLHGV----------------------------------------------------------------
3cmvC           AEFQILYGEGINFYGELVDLGVKEKL--------------------------------------------
4dcgA           QEYDYFHMYFMLRTVYCNK---------------------------------------------------
3cmvA           IAAPFKQAEFQILYGEGINFYGELV---------------------------------------------
2dr3A           DGIIRLDLDEIDGELKRSL---------------------------------------------------
3b60A           DEIVVVEDGIIVERGTHSELLAQHGVYAQLHK-----MQFG-----------------------------
3eiuB           NSGIGAGKTREDHKAVSDQMYAGYA---------------------------------------------
1e9cA           LNWKMVDASKSIEAVHEDIRVLSEDA--------------------------------------------
3czpB           ARVKVLRT--INDAIEAAYKKDK-----------------------------------------------
2a2zD           VPILTLDVNEDFKDKYESLVEK------------------------------------------------
1e9fA           IRVLSEDAIATATEKPLGE---------------------------------------------------
2b8wA           HRRKLAQLEKLQDEELDPEFVQQVAD--------------------------------------------
2c03A           LSARHVTGKPIYFAGVSEKPEGLEPFYP---------ERLAGRI--------------------------
1e98A           LNWKMVDASKRIEAVHEEIRVLSEDAIRTATE--------------------------------------
2b8tA           RHHH-KVPNRPYLNSNSEE---------------------------------------------------
1d1cA           AGILHLGNIKFEKGAGEGAVLKDKTA--------------------------------------------
2a30D           VPILTLDVNEYE----------------------------------------------------------
3eiuA           NSGIGAGKTREDHKAVSDQMYAGYA---------------------------------------------
2cjwB           RRLAYQKRKE------------------------------------------------------------
2dr3E           DGIIRLDLDEIDG---------------------------------------------------------
1e2dA           LNWKMVDASKSIEAVHEDIRVLSEDAIATATE--------------------------------------
2bc9A           ----------------------------------------------------------------------
2cckA           RFKSVNADQPLE----------------------------------------------------------
1e9sF           TSARFVLSDKL-----------------------------------------------------------
3dm5A           ALSAVAATGAPIKFIGTGEKIDD-----------------------------------------------
1e9sG           TSARFVLSDKLP----------------------------------------------------------
2a2zA           KHESWLLHRTLKTNFDYLQEVPILTLDV------------------------------------------
1cr4A           DTIIALERNQLVVRILKCRFTGDTGIAGYMEYNKETGWLEPSSY--------------------------
2awnD           NMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNET-----------------------------------
2d62A           GDRIAVNKGELQQVGTPDE---------------------------------------------------
3d3kA           GINYHSPFCKFV----------------------------------------------------------
1e9rA           PDGDFSIRSWLED---------------------------------------------------------
3bb1B           PNGIAWIPHLVQTITEVALNKSESIVDKNLID--------------------------------------
3b2qA           IPDLSGYITEGQIVVARELH--RKGIYPPINVLPSLSRLMNSGIGAGKTREDHKAVSDQMYAGY------
1e9dA           LNWKMVDASKSIEAVHEDIRVLSED---------------------------------------------
3b85A           ----------------------------------------------------------------------
3bpbA           ANCIWVNERVIMPAGYPRTREKIARLGYRVI---------------------------------------
2c9oC           KQIIKIRAQTEGINISEEALNHLGEIGT-----KTTLRYSVQLLTPANLLAKIN----------------
2cgtH           RGIVKVAAVKAPGFGDRRK---------------------------------------------------
2c04A           LSARHVTGKPIYFAGVSEKPEGLEPFYP------------------------------------------
2b92B           VHRRKLAQLEKLQDEELDPEFVQQ----------------------------------------------
2a5gA           ----------------------------------------------------------------------
2c61A           LSGYITEGQIVV-----ARELHRKGIYPPINVLPSLSRLMNSGIGAGKTREDHKAVSDQMYAGYAE----
1aroP           NTTVQAVASAIG----------------------------------------------------------
2c9yA           HTQTTPLIEYYRKRGIHSAIDASQTPDVV-------FASILAAFSKA-----------------------
2d4hB           GGIQVNGPRLESLVLTYVNAISSGDL--------------------------------------------
3b2qB           NSGIGAGKTREDHKAVSDQ---------------------------------------------------
1ai4B           ETTQDGPTGSLNISVGAKILYEAVQGDK------------------------------------------
3a1wA           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2axzC           QIYQFLTDKNIDS---------------------------------------------------------
1e9sD           SARFVLSDKLPEH---------------------------------------------------------
1bg0A           VTAVDNIESKLPFSHDDRF---------------------------------------------------
2a30B           VPILTLDVNEYE----------------------------------------------------------
1e2fA           LNWKMVDASKSI----------------------------------------------------------
3dt4A           MRAAAEHKGKVIMHDPFAMRPFFGYNFGKY-----LAHWLSMAHRPAAKLPK------------------
2ctsA           ----------------------------------------------------------------------
3bb1E           SDEKVLPNGIAWIPHLVQTTEVALNKSESIF---------------------------------------
3dt2A           MRAAAEHKGKVIMHDPFAMRPFFGYNFGKYL---------------------------------------
421pA           ----------------------------------------------------------------------
3d7wA           TQVQHSTDGVFNNPIALAIAPGVIVT--------------------------------------------
2bbsB           DKILILHEGSSYFYGTFSELQNLRDSFDQFSA--ERRNSILTETLHRFS---------------------
1e4yA           EELTTRKDDQEETVRKRLVEYHQMTA--------------------------------------------
1dg3A           RPVHELDPEFVQQ---------------------------------------------------------
2d4hA           VHRRKLAQLEKL----------------------------------------------------------
1e9sJ           SARFVLSDKLPEH---------------------------------------------------------
1dkiA           GHAF-VIDGADG----------------------------------------------------------
2awnB           DKIVVLDAGRVAQVGKPLELYHYPAD--------------------------------------------
2axpA           ----------------------------------------------------------------------
2b8tB           CRHHHKVPNRPYLNSNSEEFIK------------------------------------------------
3dhwC           DCVAVISNGELIEQDTVSE---------------------------------------------------
2dr3B           PGVEHGVDGIIRLDLDEIDGELKRSLIVW-----------------------------------------
3cr7A           ----------------------------------------------------------------------
2b8tC           RHHHKVPNRPYLNSNSEEFIK-------------------------------------------------
2a5jA           ----------------------------------------------------------------------
2bbtB           DKILILHEGSSYFYGTFSELQNLRPDFSS-----------------------------------------
2a30A           VPILTLDVNEYE----------------------------------------------------------
3adkA           SQVCTH----------------------------------------------------------------
3cddD           SKFTIKDSAGLPTVGGIKADVTDS----------------------------------------------
1e3aB           ETTQDGPTGSLNISVGAKILYEAV----------------------------------------------
3cmtD           YGEGINFYGELVDLGVKEKLIEKAGAWYKGEKIGQGK----ANATAWLK---------------------
3bo6B           RLMAE-----------------------------------------------------------------
3cddF           WNIPVIDEIGLDEELIASISEDDAGRLAVISVVRPD----------------------------------
1e0jA           HEEGRPVSITDLRGSGALRQLSDT----------------------------------------------
3dm9B           ALSISYVIDAPIL---------------------------------------------------------
3da4A           ----------------------------------------------------------------------
2c4rL           GGLIVIDFIDMTP---------------------------------------------------------
1cr2A           DTIIALERNNLV----------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2b8wB           CIRKFFPKKKCFVFDRPVH---------------------------------------------------
1e0jB           DTIIALERNQQGDMPNLVLVRILKCRFTGDTGIAG-----------------------------------
3czpA           ARVKVLRT--INDAIEAAYKKDK-----------------------------------------------
3cmxA           YGEGINFYGELVDLGVKEKLIEKAGAW-------------------------------------------
3dtbB           GAAMRSEAKVIMHDPFAMR---------------------------------------------------
2a2zB           VPILTLDVNEDF----------------------------------------------------------
3bb1C           DEKVLPNGIAWIPHLVQTITEVALNKSES-----------------------------------------
1e9rE           KARFVLSDKLPEHVTMPDG---------------------------------------------------
1av6A           LNKIVRNKVVVNFDYPNQEYDYF-----------------------------------------------
3bb1F           DEKVLPNGIAWIPHLVQTITEVALNKSES-----------------------------------------
2akaA           AGILHLGNIKFEKGAGEGA---------------------------------------------------
2bjbA           LSAAVVSGGTVR----------------------------------------------------------
3cioD           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
2awnC           DKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNF------------------------------
1e2kA           KRQRPGERLDL-----------------------------------------------------------
2dr3F           DGIIRLDLDEIDGELKRSLIVWKM----------------------------------------------
2c0bL           DMTPVRHQRAVENRLREAVR--------------------------------------------------
1d6jB           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
1e59A           KYLDNMSEEEILELNIPTG---------------------------------------------------
3dfpC           GVILFHETLYQKA---------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1e3mB           KEGVANVHLDALEHGDTIAFHS------------------------------------------------
1e9sB           PDGDFSIRSWLEDPNG------------------------------------------------------
3dfnC           GVILFHETLYQKARPFPQVIKSKGGV--------------------------------------------
1e3mA           KEGVANVHLDALEHGDTI----------------------------------------------------
2eg5G           INDLVVEGHLEEEKLDSFN---------------------------------------------------
2ahvA           GIVMMQVQKMVKKATLHPKSVRIPGYLVDIVVVDPDQSQL------------------------------
3dfoD           GVILFHETLYQKA---------------------------------------------------------
3bgwA           DKRPMLSDLRESGQDADIIEFLYRD---------------------------------------------
3dfqD           GVILFHETLYQKA---------------------------------------------------------
2cckB           YQTIIKYLEK------------------------------------------------------------
2ausC           KIRAVMKEFEGEIIQRTRKVYYIEIL--------------------------------------------
1e9rD           SARFVLSDKLPEHVTMPDGDFSIRS---------------------------------------------
3cddC           SKFTIKADSAGLPTVGGIK---------------------------------------------------
2bkiA           IRMCTAMKKIGLDDEEKLD---------------------------------------------------
3cmvE           FKQAEFQILYGEGINFYGE---------------------------------------------------
3dftD           GVILFHETLYQKARPFPQVIKSKGGVDKGVVPLAGTNGETTTQGLDGL----------------------
3dfpD           GVILFHETLYQKA---------------------------------------------------------
3dt7A           MRAAAEHKGKVIMHDPFAMRPFFGYNFGKYL---------------------------------------
1cr1A           DTIIALERNQLV----------------------------------------------------------
3dfqA           GVILFHETLYQKA---------------------------------------------------------
1dhjA           QKLYLTHIDAEVEGDTHFP---------------------------------------------------
1aldA           GVILFHETLYQKA---------------------------------------------------------
2dr3C           DGIIRLDLDEIDGELKRSL---------------------------------------------------
2dflA           GIRIQLKKSRGNRRIARVVDAPHLPEGEVV----------------------------------------
3ch4B           ----------------------------------------------------------------------
3dfnA           GVILFHETLYQKA---------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
1adoA           GVILFHETLYQKGRPFPQVIKSKGGV--------------------------------------------
3dfnD           GVILFHETLYQKADPFPQVIKSKGGV--------------------------------------------
2bwjA           QLCTAIDSIFL-----------------------------------------------------------
6aldA           GVILFHETLYQKA---------------------------------------------------------
3dftC           GVILFHETLYQKA---------------------------------------------------------
2bx2L           RQLRLRDLGGLIVIDFIDMTPV------------------------------------------------
1cjtC           ----------------------------------------------------------------------
2a1fF           LAKAGMNRVVGDHMGMLAT---------------------------------------------------
1e9sM           PDGDFSIRSWLEDPNGG-----------------------------------------------------
3bh0A           DKRPMLSDLRELEQDADIIEFLYRD---------------------------------------------
3dt4C           MRAAAEHKGKVIMHDPFAM---------------------------------------------------
3bb1A           DEKV-LPNGIAWIPHLVQT---------------------------------------------------
1ek0A           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
2bhjA           GKHDFRLWNLIRYAGYQMPDGTI-----------------------------------------------
3d3qA           KRVDILGHGLFNEVQHLVEQGFEASQSQAI-----GYKELVPVIKGNISENAVEKLKQHSRQY-------
1bmfC           KMNDAFGGGSLTALPVIET---------------------------------------------------
3c8uA           QGNDLANARAIEAARLPAD---------------------------------------------------
2c7cH           RGIVKVAAVKAPGFGDRRK---------------------------------------------------
3dfqC           GVILFHETLYQKADDGRPFPQ-------------------------------------------------
2d0kA           QKLYLTHIDAEVEGDTHFP---------------------------------------------------
1dekA           AMGATVIHVVRPSNDHITEAGLPIRDGDLVITN-------------------------------------
3di4A           LLVEIFAPAEGLGDWPSPSVNGYDR---------------------------------------------
1e9rF           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
1cr0A           DTIIALERNQLVVRILKCRFTGDTGI--------------------------------------------
3d3qB           KRVDILGHGLFNEVQHLVEQGFEASQSQAI-----GYKELVPVIKGNISENAVEKLKQHSRQY-------
2awoC           DKIVVLDAGRVAQVGKPLELYHYPA---------------------------------------------
3dfoC           GVILFHETLYQKADDGRPFPQ-------------------------------------------------
3d31A           DRIAVVMDGKLIQVGKPEEIFEK-----------------------------------------------
3a00A           ----------------------------------------------------------------------
3cmwC           IRRIGAVKENVVGSETRVKVVKN-----------------------------------------------
1e9sH           MPDGDFSIRSWLEDP-------------------------------------------------------
2bkhA           TAMKKIGLDDEEKLDLFRV---------------------------------------------------
3bgwD           DKRPMLSDLRESGQDADIIEFLYRD---------------------------------------------
3bjdB           ARYLYGELGEEDEKGSHPRLLAKLLEAIGL----------------------------------------
2cvfA           AYFRITERG-------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
2bv7A           ELNYKV----------------------------------------------------------------
3be4A           ILKRVNAKLPP-----------------------------------------------------------
3bczC           RSIEHLDKGSIIEQLDPVSFSN------------------------------------------------
3czjA           QMAITVDVEVASDTPHPARIGLNCQLAQVAERVNWLGLGPQENYPDRL----------------------
2dr3D           GPGVEGVDGIIRLDLDEIDGELKRSL--------------------------------------------
2awoA           DKIVVLDAGRVAQVGKPLELYHYPAD--------------------------------------------
2bhvA           NQILRSKIAPIVVIREGS----------------------------------------------------
1dw9A           ----------------------------------------------------------------------
3dlbB           TPEAVRAQAYRL----------------------------------------------------------
1culC           ----------------------------------------------------------------------
1b0uA           SHVIFLHQGKIEEEGDPEQVFGNPQS--------------------------------------------
3cm0A           RAALGI----------------------------------------------------------------
3dymA           GQMAITVDVEVA----------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
1ak2A           TPLVEYYSKRGIHSAIDASQTPDV-----------VFASILAAFSKATS---------------------
1dekB           FALDYLDKFNSGY---------------------------------------------------------
3bv4A           GVILFHETLYQKA---------------------------------------------------------
1dhiA           QKLYLTHIDAEVEGDTHFP---------------------------------------------------
1eilA           QRKVMGLLCLQDPFGLPLE---------------------------------------------------
1e2gA           LNWKMVDASKSI----------------------------------------------------------
3crmA           DYLDGKLSYAEM-----TERGIIATRQLA-----------------------------------------
1c9kC           -EVWLVVSGIGV----------------------------------------------------------
3c14C           ----------------------------------------------------------------------
2ck3C           KMNDAFGGGSLTALPVIET---------------------------------------------------
1e9sL           PDGDFSIRSWLEDPNGGN----------------------------------------------------
1bglA           GQMAITVDVEVAS---------------------------------------------------------
2d3wA           DYVHVLYQGRIVKSGDFTLVKQLEEQGYG-----------------------------------------
2d2eA           DKVHVMMDGRVVATGGPELALELEAKGYE-----------------------------------------
3brwA           DAQQLQRKRHIGNDIVAVVFQDEN----------------------------------------------
3bb1G           SDEKVLPNGIAWIPHLVQT---------------------------------------------------
2d3wD           DYVHVLYQGRIVKSGDFTLVKQLEEQGYG-----------------------------------------
2ccjA           HRFKSVNADQPLENVVEDTYQ-------------------------------------------------
1e2hB           NTVRYLQCGGSWREDWGQLSGPQSNAGPRPHIGDTLFTLFRAPELLAPNGDLYNVFAWALDVLAKRL---
3c15C           ----------------------------------------------------------------------
2aunA           RHGLPAIHGPVATGLGLQER--------------------------------------------------
1e2iA           EDWGQLSGTGPR----------------------------------------------------------
3cueF           ----------------------------------------------------------------------
1akeA           TKYAKVDGTKPVAEVRADLEKI------------------------------------------------
3ec1A           TDIVFSGLGWVTCNDPGAQ---------------------------------------------------
2awnA           ----------------------------------------------------------------------
2aumA           LLSAFHRHGLPAHGPVATGLGLQE----------------------------------------------
2d3wC           DYVHVLYQGRIVKSGDFTLVKQLEEQGYG-----------------------------------------
2boeX           QHVQQEVLETMAYAGKALKAGSSQ----------------------------------------------
1e9sI           KARFVLSDKLPEHVT-------------------------------------------------------
3dauA           QKLYLTHIDAEVEGDTHFP---------------------------------------------------
2aunB           LSAFHRHGLPAIHGPVATGLGLEQQ---------------------------------------------
2bofX           QMASWLQQADISYRWTADEVAYAKAVLSAI----------------------------------------
3bb1H           PVVLIENSGRCNKNDSDEKVLPNGI---------------------------------------------
3cmvB           AEFQILYGEGINFYGELVDLGVKEKLIEK-----------------------------------------
2dpyB           ----------------------------------------------------------------------
3dvlD           RYGVEEFDNVVILRNVLEGERRRRTLE-------------------------------------------
2d4uB           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2bhvD           APIVVIREGSRVFISPNTD---------------------------------------------------
3a00B           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2drcA           QKLYLTHIDAEVEGDTHFP---------------------------------------------------
3dffA           DHEATRDAALFATHEKNVPVRLWEDLPYA-----------------------------------------
4atjA           MDRLYNFSNTGLPDPTLNT---------------------------------------------------
2bbtA           DKILILHEGSSYYGTFSENLRPDFSSDSFDQFSAERRNSILTET--------------------------
1e9sE           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
2bkeA           -QLKKSRGNRRI----------------------------------------------------------
1cfrA           RRLQLAHEGSLMKALYTHLQTRT-----------------------------------------------
1ckvA           ----------------------------------------------------------------------
1eamA           KKMYYLNKIVRNKVVVNFD---------------------------------------------------
5dfrA           QKLYLTHIDAEVGDTHFPDYEPDDWESVFS----------------------------------------
3bk7A           DVIHVVYGEPGVYGIFSKP---------------------------------------------------
3d1mB           SEESLHYEGRAVDITTSDR---------------------------------------------------
4dfrA           QKLYLTHIDAEVHFPDYEPDDWES----------------------------------------------
3d1mA           EESL-HYEGRAVDITTSDR---------------------------------------------------
3dyoA           QMAITVDVEVASDTPHPARIGLNCQLAQVAERVNWLGLGPQENYPDRL----------------------
3cr7B           KGYL------------------------------------------------------------------
2a1fD           LAKAGMNRVVGDHMGMLAT---------------------------------------------------
2ancF           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
1draA           QKLYLTHIDAEVGDTHFPDYEPDD----------------------------------------------
1dyhA           QKLYLTHIDAEVHFPDYEPDDWES----------------------------------------------
3ecpA           FRTVGLLHQEWWMRPDDPA---------------------------------------------------
2aumB           RHGLPAIHGPVA----------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
1e2nA           AMLAAIRRV-------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
1e4vA           TKYAKVDGTKPVAEVRADLEKI------------------------------------------------
1e2iB           DRLAKRERLDLAMLAAIRRVYGL-----------------------------------------------
1d2zD           ----------------------------------------------------------------------
3b55A           DRYVLTGKGNPSQHL-------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
1e1qB           QIFLE-----------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
2a1fC           LAKAGMNRVVGDHMGMLATVMNGLAM--------------------------------------------
3cqcA           ADMVSSERHKLY----------------------------------------------------------
2awoD           NMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQ------------------------
2b8tD           RHHHKVPNRPYLNSNSEEFIK-------------------------------------------------
1e2mB           VRYLQCGG--------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
1dp0A           QMAITVDVEVASD---------------------------------------------------------
3bb1D           NLI-------------------------------------------------------------------
2anbA           KTIIRAERLRMSRQKQRHD---------------------------------------------------
3bjqB           KRIDFGYEGDPYSIVPSAL---------------------------------------------------
1afrA           PDGTVLAFADMMRKKISMPAHLMYD---------------------------------------------
2d7vB           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
1drbA           QKLYLTHIDAEVGDTHFPDYEPDDWESVFS----------------------------------------
2dftC           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1e9sA           PDGDFSIRSWLEDPNGGN----------------------------------------------------
1accA           DRYDMLNISSLR----------------------------------------------------------
2ancD           KTIIRAERLRMSRQKQRHD---------------------------------------------------
1bccF           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2e85B           EDIGEVFLGIQPDI--------------------------------------------------------
1dvrA           KKRLAAYHAQT-----------------------------------------------------------
2a1fE           LAKAGMNRVVGDHMGMLAT---------------------------------------------------
3do6A           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
3dm5B           ALSAVAATGAPIKFIGTGEKIDD-----------------------------------------------
2a5vB           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
2cdnA           LRALG-----------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
2d2fA           DKVHVMMDGRVVATGGPELALELEAKGYE-----------------------------------------
3c7kC           LHFRLFDVGGQRSERKKWI---------------------------------------------------
3c85A           ----------------------------------------------------------------------
3bm2B           REAFGCREQDKI----------------------------------------------------------
2b0lC           ESAGVIESRSLGMKGTYIKVLNNKFL--------------------------------------------
1chdA           ERLNKLCQISVK----------------------------------------------------------
1e2nB           NTVRYLQCGGSWREDWGQLSGPQSN---------------------------------------------
1e9rB           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
1e2jA           GGSWREDWGQLSGPRP------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
3b9qA           VVSVVEELGIPVKFIGVGEAVEDLQP--------------------------------------------
1d8jA           ----------------------------------------------------------------------
2an9A           KTIIRAERLRMSRQKQRHDALISKLL--------------------------------------------
1e2lA           VYGLLANTVRYLQ---CGGSWREDWGQLSGPRPHIGDTLFTLFRAPEL----------------------
1e2mA           DRLAKRQRP-------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
2aexA           ERKEGGGG--------------------------------------------------------------
2bboA           DKILILHEGSSYFYGTFSELQNLQPDFSS-----------------------------------------
2ancB           KTIIRAERLRMSRKQRHDA---------------------------------------------------
2a78A           ----------------------------------------------------------------------
2c9oA           DVANGEINKVVN----------------------------------------------------------
2e85A           DIGEVIFLGIQPDIVGFYY---------------------------------------------------
1e9sK           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
1ckeA           ALVLDSTTLSI-----------------------------------------------------------
1dwmA           DRVWVIVNDHGV----------------------------------------------------------
3ci2A           DRVRLFVDKLDN----------------------------------------------------------
1agpA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1e2kB           DRHIDRLA--------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
3bs4A           LSVYRRADYVL-----------------------------------------------------------
2cfsA           LRFARLGFGGL-----------------------------------------------------------
1brwA           ----------------------------------------------------------------------
3csuA           LDMLDEKGIAWSLHSSIEE---------------------------------------------------
2c5mD           MRQALEPQVC------------------------------------------------------------
3cddA           DSEIGRYRPLIIVNEEVTAEGAAKRGQ-------------------------------------------
2axnA           ----------------------------------------------------------------------
2ekbA           RALGEDGL--------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
2c95B           CTHLD-----------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
1e2lB           AKRLDLAMLAAIR---------------------------------------------------------
1dapA           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
3cddB           SKFTIKGGIKADVTDSEIGRYRPLIIVNEEVTTA------------------------------------
3bb4A           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3cr8B           GERLALGEGYMLAILTLS----------------------------------------------------
2bwjD           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3b5jA           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
3c7kC           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
3ci2A           ----------------------------------------------------------------------
1agpA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2cfsA           ----------------------------------------------------------------------
1brwA           ----------------------------------------------------------------------
3csuA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
3cddA           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
2ekbA           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
3bb4A           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3cr8B           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3b5jA           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
3c7kC           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
3ci2A           ----------------------------------------------------------------------
1agpA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2cfsA           ----------------------------------------------------------------------
1brwA           ----------------------------------------------------------------------
3csuA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
3cddA           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
2ekbA           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
3bb4A           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3cr8B           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3b5jA           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
3c7kC           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
3ci2A           ----------------------------------------------------------------------
1agpA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2cfsA           ----------------------------------------------------------------------
1brwA           ----------------------------------------------------------------------
3csuA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
3cddA           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
2ekbA           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
3bb4A           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3cr8B           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3b5jA           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
3c7kC           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
3ci2A           ----------------------------------------------------------------------
1agpA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2cfsA           ----------------------------------------------------------------------
1brwA           ----------------------------------------------------------------------
3csuA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
3cddA           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
2ekbA           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
3bb4A           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3cr8B           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3b5jA           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3dmdC           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
3cmvG           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
3cmvC           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
1dw9A           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
1d2zD           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
3c7kC           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
2c9oA           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
3ci2A           ----------------------------------------------------------------------
1agpA           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
2ax4B           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
2cfsA           ----------------------------------------------------------------------
1brwA           ----------------------------------------------------------------------
3csuA           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
3cddA           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
2ekbA           ----------------------------------------------------------------------
2ax4A           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
2c95B           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
3bb4A           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3cr8B           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxx
3b5jA           ------------------
2dwoA           ------------------
3dmdC           ------------------
2dwpA           ------------------
3c95A           ------------------
2d3wB           ------------------
3cmvH           ------------------
3cmvG           ------------------
2ccgA           ------------------
2akaB           ------------------
1bifA           ------------------
2ccjB           ------------------
2bifA           ------------------
2bbsA           ------------------
2ccgB           ------------------
2czvA           ------------------
3dmdB           ------------------
2c03B           ------------------
2c61B           ------------------
1e69A           ------------------
3cmvC           ------------------
4dcgA           ------------------
3cmvA           ------------------
2dr3A           ------------------
3b60A           ------------------
3eiuB           ------------------
1e9cA           ------------------
3czpB           ------------------
2a2zD           ------------------
1e9fA           ------------------
2b8wA           ------------------
2c03A           ------------------
1e98A           ------------------
2b8tA           ------------------
1d1cA           ------------------
2a30D           ------------------
3eiuA           ------------------
2cjwB           ------------------
2dr3E           ------------------
1e2dA           ------------------
2bc9A           ------------------
2cckA           ------------------
1e9sF           ------------------
3dm5A           ------------------
1e9sG           ------------------
2a2zA           ------------------
1cr4A           ------------------
2awnD           ------------------
2d62A           ------------------
3d3kA           ------------------
1e9rA           ------------------
3bb1B           ------------------
3b2qA           ------------------
1e9dA           ------------------
3b85A           ------------------
3bpbA           ------------------
2c9oC           ------------------
2cgtH           ------------------
2c04A           ------------------
2b92B           ------------------
2a5gA           ------------------
2c61A           ------------------
1aroP           ------------------
2c9yA           ------------------
2d4hB           ------------------
3b2qB           ------------------
1ai4B           ------------------
3a1wA           ------------------
3cr7C           ------------------
2bdtA           ------------------
2axzC           ------------------
1e9sD           ------------------
1bg0A           ------------------
2a30B           ------------------
1e2fA           ------------------
3dt4A           ------------------
2ctsA           ------------------
3bb1E           ------------------
3dt2A           ------------------
421pA           ------------------
3d7wA           ------------------
2bbsB           ------------------
1e4yA           ------------------
1dg3A           ------------------
2d4hA           ------------------
1e9sJ           ------------------
1dkiA           ------------------
2awnB           ------------------
2axpA           ------------------
2b8tB           ------------------
3dhwC           ------------------
2dr3B           ------------------
3cr7A           ------------------
2b8tC           ------------------
2a5jA           ------------------
2bbtB           ------------------
2a30A           ------------------
3adkA           ------------------
3cddD           ------------------
1e3aB           ------------------
3cmtD           ------------------
3bo6B           ------------------
3cddF           ------------------
1e0jA           ------------------
3dm9B           ------------------
3da4A           ------------------
2c4rL           ------------------
1cr2A           ------------------
2ahwD           ------------------
2b8wB           ------------------
1e0jB           ------------------
3czpA           ------------------
3cmxA           ------------------
3dtbB           ------------------
2a2zB           ------------------
3bb1C           ------------------
1e9rE           ------------------
1av6A           ------------------
3bb1F           ------------------
2akaA           ------------------
2bjbA           ------------------
3cioD           ------------------
2d4uA           ------------------
2awnC           ------------------
1e2kA           ------------------
2dr3F           ------------------
2c0bL           ------------------
1d6jB           ------------------
3cr7D           ------------------
3clvA           ------------------
1e59A           ------------------
3dfpC           ------------------
1e6cA           ------------------
1e3mB           ------------------
1e9sB           ------------------
3dfnC           ------------------
1e3mA           ------------------
2eg5G           ------------------
2ahvA           ------------------
3dfoD           ------------------
3bgwA           ------------------
3dfqD           ------------------
2cckB           ------------------
2ausC           ------------------
1e9rD           ------------------
3cddC           ------------------
2bkiA           ------------------
3cmvE           ------------------
3dftD           ------------------
3dfpD           ------------------
3dt7A           ------------------
1cr1A           ------------------
3dfqA           ------------------
1dhjA           ------------------
1aldA           ------------------
2dr3C           ------------------
2dflA           ------------------
3ch4B           ------------------
3dfnA           ------------------
1cs4C           ------------------
1adoA           ------------------
3dfnD           ------------------
2bwjA           ------------------
6aldA           ------------------
3dftC           ------------------
2bx2L           ------------------
1cjtC           ------------------
2a1fF           ------------------
1e9sM           ------------------
3bh0A           ------------------
3dt4C           ------------------
3bb1A           ------------------
1ek0A           ------------------
1d6jA           ------------------
2bhjA           ------------------
3d3qA           ------------------
1bmfC           ------------------
3c8uA           ------------------
2c7cH           ------------------
3dfqC           ------------------
2d0kA           ------------------
1dekA           ------------------
3di4A           ------------------
1e9rF           ------------------
2czvB           ------------------
1cr0A           ------------------
3d3qB           ------------------
2awoC           ------------------
3dfoC           ------------------
3d31A           ------------------
3a00A           ------------------
3cmwC           ------------------
1e9sH           ------------------
2bkhA           ------------------
3bgwD           ------------------
3bjdB           ------------------
2cvfA           ------------------
3cnlA           ------------------
2bv7A           ------------------
3be4A           ------------------
3bczC           ------------------
3czjA           ------------------
2dr3D           ------------------
2awoA           ------------------
2bhvA           ------------------
1dw9A           ------------------
3dlbB           ------------------
1culC           ------------------
1b0uA           ------------------
3cm0A           ------------------
3dymA           ------------------
1cjaA           ------------------
1ak2A           ------------------
1dekB           ------------------
3bv4A           ------------------
1dhiA           ------------------
1eilA           ------------------
1e2gA           ------------------
3crmA           ------------------
1c9kC           ------------------
3c14C           ------------------
2ck3C           ------------------
1e9sL           ------------------
1bglA           ------------------
2d3wA           ------------------
2d2eA           ------------------
3brwA           ------------------
3bb1G           ------------------
2d3wD           ------------------
2ccjA           ------------------
1e2hB           ------------------
3c15C           ------------------
2aunA           ------------------
1e2iA           ------------------
3cueF           ------------------
1akeA           ------------------
3ec1A           ------------------
2awnA           ------------------
2aumA           ------------------
2d3wC           ------------------
2boeX           ------------------
1e9sI           ------------------
3dauA           ------------------
2aunB           ------------------
2bofX           ------------------
3bb1H           ------------------
3cmvB           ------------------
2dpyB           ------------------
3dvlD           ------------------
2d4uB           ------------------
1e9rG           ------------------
2bhvD           ------------------
3a00B           ------------------
2dpyA           ------------------
2drcA           ------------------
3dffA           ------------------
4atjA           ------------------
2bbtA           ------------------
1e9sE           ------------------
3dfdA           ------------------
2bkeA           ------------------
1cfrA           ------------------
1ckvA           ------------------
1eamA           ------------------
5dfrA           ------------------
3bk7A           ------------------
3d1mB           ------------------
4dfrA           ------------------
3d1mA           ------------------
3dyoA           ------------------
3cr7B           ------------------
2a1fD           ------------------
2ancF           ------------------
2dftA           ------------------
1draA           ------------------
1dyhA           ------------------
3ecpA           ------------------
2aumB           ------------------
3cbnA           ------------------
1e2nA           ------------------
3ed8A           ------------------
1e4vA           ------------------
1e2iB           ------------------
1d2zD           ------------------
3b55A           ------------------
3bwdD           ------------------
1e1qB           ------------------
3cnnA           ------------------
3c7kA           ------------------
2a1fC           ------------------
3cqcA           ------------------
2awoD           ------------------
2b8tD           ------------------
1e2mB           ------------------
3cmuA           ------------------
3cphA           ------------------
2d7vA           ------------------
1dp0A           ------------------
3bb1D           ------------------
2anbA           ------------------
3bjqB           ------------------
1afrA           ------------------
2d7vB           ------------------
1cjuC           ------------------
1cjvC           ------------------
1drbA           ------------------
2dftC           ------------------
3e8aC           ------------------
1e9sA           ------------------
1accA           ------------------
2ancD           ------------------
1bccF           ------------------
3b85B           ------------------
2e85B           ------------------
1dvrA           ------------------
2a1fE           ------------------
3do6A           ------------------
1azsC           ------------------
3dm5B           ------------------
2a5vB           ------------------
2c9gA           ------------------
2cdnA           ------------------
2a5vA           ------------------
2d2fA           ------------------
3c7kC           ------------------
3c85A           ------------------
3bm2B           ------------------
2b0lC           ------------------
1chdA           ------------------
1e2nB           ------------------
1e9rB           ------------------
3cd9A           ------------------
1e2jA           ------------------
1d6aA           ------------------
3b9qA           ------------------
1d8jA           ------------------
2an9A           ------------------
1e2lA           ------------------
1e2mA           ------------------
3cbqA           ------------------
2aexA           ------------------
2bboA           ------------------
2ancB           ------------------
2a78A           ------------------
2c9oA           ------------------
2e85A           ------------------
1e9sK           ------------------
2cbzA           ------------------
1ckeA           ------------------
1dwmA           ------------------
3ci2A           ------------------
1agpA           ------------------
3dkvA           ------------------
1e2hA           ------------------
1e2kB           ------------------
2bwjB           ------------------
2ax4B           ------------------
2bhvC           ------------------
3bs4A           ------------------
2cfsA           ------------------
1brwA           ------------------
3csuA           ------------------
2c5mD           ------------------
3cddA           ------------------
2axnA           ------------------
2ekbA           ------------------
2ax4A           ------------------
3dmdA           ------------------
2c95B           ------------------
3e70C           ------------------
1e2lB           ------------------
1dapA           ------------------
1e2jB           ------------------
3cddB           ------------------
3bb4A           ------------------
2c9oB           ------------------
3cr8B           ------------------
2bwjD           ------------------