[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for sent8:ACF69590.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1e39A.bssp"
#ERROR : Can't open dsspfile "2b7rA.bssp"
#ERROR : Can't open dsspfile "2b7sA.bssp"
#ERROR : Can't open dsspfile "1d4cA.bssp"

## Summary of PDB Search
:419
    2e-06  12%  1e39A  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C3
    5e-06  21%  2b7rA  [x.x.x] FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT
    6e-05  16%  2b7sA  [x.x.x] FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT
    3e-04  16%  1d4cA  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C FUMARATE
:419

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1e39A           ----------------------------------------------------------------------
2b7rA           ----------------------------------------------------------------------
2b7sA           ----------------------------------------------------------------------
1d4cA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1e39A           ----------------------------------------------------------------------
2b7rA           ----------------------------------------------------------------------
2b7sA           ----------------------------------------------------------------------
1d4cA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1e39A           ----------------------------------------------------------------------
2b7rA           ----------------------------------------------------------------------
2b7sA           ----------------------------------------------------------------------
1d4cA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1e39A           ----------------------------------------------------------------------
2b7rA           ----------------------------------------------------------------------
2b7sA           ----------------------------------------------------------------------
1d4cA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLGLDVQQTATRAEWYQQHFF
1e39A           --------------------------------------------------KDTDFERPNLPRALNEGNYY
2b7rA           ----------------------------------------------------------------------
2b7sA           -----------------------------------------------------DFERPNLPRALNEGNYY
1d4cA           ---------------------------------------------------------------ALEIAPA


                         .         .         .         .         *         .         .:420
query           DPQPWQQFGVVTDDAFRPSLAGNTVENLYAIGSVLAGFDPIAEGCGGGVCAVSALQAAHHIAERAGExx
1e39A           AIEVTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAIIITFGRLAGEEAAKYS----
2b7rA           --------GVMIDKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAIIITFGRLAGEEAAKYS----
2b7sA           AIEVTPMGGVMIDKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAIIITFGRLAGEEAAKYS----
1d4cA           VHHTMGGLVIDTKAEVKSEKTGKPITGLYAAGEVTGGVHGANRLGGNAIIVTYGRIAGASAAKFAKD--