[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for sent8:ACF69636.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3b3dB.bssp"
#ERROR : Can't open dsspfile "3b3dA.bssp"
#ERROR : Can't open dsspfile "1a80A.bssp"
#ERROR : Can't open dsspfile "2alrA.bssp"
#ERROR : Can't open dsspfile "2bgsA.bssp"
#ERROR : Can't open dsspfile "2acuA.bssp"
#ERROR : Can't open dsspfile "1az1A.bssp"
#ERROR : Can't open dsspfile "2dv0A.bssp"
#ERROR : Can't open dsspfile "3c3uA.bssp"
#ERROR : Can't open dsspfile "1afsA.bssp"
#ERROR : Can't open dsspfile "1c9wA.bssp"
#ERROR : Can't open dsspfile "2acsA.bssp"
#ERROR : Can't open dsspfile "3d3fA.bssp"
#ERROR : Can't open dsspfile "3cv6A.bssp"
#ERROR : Can't open dsspfile "1ah3A.bssp"
#ERROR : Can't open dsspfile "1adsA.bssp"
#ERROR : Can't open dsspfile "3eauA.bssp"
#ERROR : Can't open dsspfile "3burA.bssp"
#ERROR : Can't open dsspfile "2bgqA.bssp"
#ERROR : Can't open dsspfile "3caqB.bssp"
#ERROR : Can't open dsspfile "2agtA.bssp"
#ERROR : Can't open dsspfile "1ah0A.bssp"
#ERROR : Can't open dsspfile "3cv7A.bssp"
#ERROR : Can't open dsspfile "3eb4A.bssp"
#ERROR : Can't open dsspfile "2bp1B.bssp"
#ERROR : Can't open dsspfile "2c91A.bssp"
#ERROR : Can't open dsspfile "3eb3A.bssp"
#ERROR : Can't open dsspfile "2c91B.bssp"
#ERROR : Can't open dsspfile "2clpA.bssp"
#ERROR : Can't open dsspfile "3cd5C.bssp"
#ERROR : Can't open dsspfile "2bp1A.bssp"
#ERROR : Can't open dsspfile "1dq8D.bssp"
#ERROR : Can't open dsspfile "1dqaD.bssp"
#ERROR : Can't open dsspfile "1dq8B.bssp"
#ERROR : Can't open dsspfile "1dq9C.bssp"
#ERROR : Can't open dsspfile "2ao0A.bssp"
#ERROR : Can't open dsspfile "1dq9B.bssp"
#ERROR : Can't open dsspfile "1dqaB.bssp"
#ERROR : Can't open dsspfile "2clpI.bssp"
#ERROR : Can't open dsspfile "3cdbC.bssp"
#ERROR : Can't open dsspfile "3cdaA.bssp"
#ERROR : Can't open dsspfile "3bglD.bssp"
#ERROR : Can't open dsspfile "3cctC.bssp"
#ERROR : Can't open dsspfile "1dq8A.bssp"
#ERROR : Can't open dsspfile "1dq8C.bssp"
#ERROR : Can't open dsspfile "3cd5D.bssp"
#ERROR : Can't open dsspfile "2aicA.bssp"
#ERROR : Can't open dsspfile "3cdaD.bssp"
#ERROR : Can't open dsspfile "1dq9D.bssp"
#ERROR : Can't open dsspfile "1dy1A.bssp"
#ERROR : Can't open dsspfile "2d4cA.bssp"
#ERROR : Can't open dsspfile "3cd0D.bssp"
#ERROR : Can't open dsspfile "1dy0A.bssp"
#ERROR : Can't open dsspfile "2d4cB.bssp"
#ERROR : Can't open dsspfile "3ee8B.bssp"
#ERROR : Can't open dsspfile "3ee8A.bssp"
#ERROR : Can't open dsspfile "2d4cC.bssp"
#ERROR : Can't open dsspfile "1dqaC.bssp"
#ERROR : Can't open dsspfile "3bmaF.bssp"

## Summary of PDB Search
:289
    5e-65  45%  3b3dB  [x.x.x] PUTATIVE MORPHINE DEHYDROGENASE
    7e-61  45%  3b3dA  [x.x.x] PUTATIVE MORPHINE DEHYDROGENASE
    2e-59  42%  1a80A  [x.x.x] 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE A
    4e-56  36%  2alrA  [x.x.x] ALDEHYDE REDUCTASE
    2e-54  31%  2bgsA  [x.x.x] ALDOSE REDUCTASE
    2e-54  35%  2acuA  [x.x.x] ALDOSE REDUCTASE
    6e-54  34%  1az1A  [x.x.x] ALDOSE REDUCTASE
    2e-53  34%  2dv0A  [x.x.x] ALDOSE REDUCTASE
    8e-53  37%  3c3uA  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C1
    1e-52  33%  1afsA  [c.1.7] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    1e-52  35%  1c9wA  [c.1.7] CHO REDUCTASE
    2e-52  34%  2acsA  [x.x.x] ALDOSE REDUCTASE
    5e-52  46%  3d3fA  [x.x.x] YVGN PROTEIN
    7e-52  34%  3cv6A  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C21
    2e-50  33%  1ah3A  [c.1.7 (1ekoA)] ALDOSE REDUCTASE
    9e-50  38%  1adsA  [c.1.7 (1ef3A)] ALDOSE REDUCTASE
    2e-49  22%  3eauA  [x.x.x] VOLTAGE-GATED POTASSIUM CHANNEL SUBUNIT BETA-2
    2e-49  38%  3burA  [x.x.x] 3-OXO-5-BETA-STEROID 4-DEHYDROGENASE
    4e-49  31%  2bgqA  [x.x.x] ALDOSE REDUCTASE
    3e-48  41%  3caqB  [x.x.x] 3-OXO-5-BETA-STEROID 4-DEHYDROGENASE
    8e-48  38%  2agtA  [x.x.x] ALDOSE REDUCTASE
    1e-47  36%  1ah0A  [x.x.x] ALDOSE REDUCTASE
    3e-46  35%  3cv7A  [x.x.x] ALCOHOL DEHYDROGENASE
    5e-45  22%  3eb4A  [x.x.x] VOLTAGE-GATED POTASSIUM CHANNEL SUBUNIT BETA-2
    2e-44  23%  2bp1B  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
    3e-44  21%  2c91A  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
    4e-44  22%  3eb3A  [x.x.x] VOLTAGE-GATED POTASSIUM CHANNEL SUBUNIT BETA-2
    3e-42  24%  2c91B  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
    3e-42  19%  2clpA  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 3
    4e-42  11%  3cd5C  [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE
    8e-42  23%  2bp1A  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
    3e-41  11%  1dq8D  [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
    2e-40  11%  1dqaD  [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
    4e-40  11%  1dq8B  [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
    1e-39  11%  1dq9C  [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
    2e-39  35%  2ao0A  [x.x.x] ALDEHYDE DEHYDROGENASE
    2e-38  12%  1dq9B  [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
    3e-38  11%  1dqaB  [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
    2e-37  20%  2clpI  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 3
    3e-37  11%  3cdbC  [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE
    8e-37  11%  3cdaA  [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE
    1e-36  11%  3bglD  [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE
    7e-36  11%  3cctC  [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE
    2e-34  11%  1dq8A  [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
    3e-34  12%  1dq8C  [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
    9e-33  12%  3cd5D  [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE
    3e-30  12%  2aicA  [x.x.x] GUANINE NUCLEOTIDE EXCHANGE FACTOR BOPE
    9e-28  10%  3cdaD  [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE
    3e-27  11%  1dq9D  [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
    7e-26  11%  1dy1A  [d.169.1] COLLAGEN ALPHA1(XVIII) CHAIN
    9e-25  11%  2d4cA  [x.x.x] SH3-CONTAINING GRB2-LIKE PROTEIN 2
    2e-23  12%  3cd0D  [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE
    4e-23  10%  1dy0A  [d.169.1] COLLAGEN ALPHA1(XVIII) CHAIN
    7e-23  16%  2d4cB  [x.x.x] SH3-CONTAINING GRB2-LIKE PROTEIN 2
    7e-22  11%  3ee8B  [x.x.x] NON-STRUCTURAL PROTEIN 1
    7e-20  11%  3ee8A  [x.x.x] NON-STRUCTURAL PROTEIN 1
    2e-18  16%  2d4cC  [x.x.x] SH3-CONTAINING GRB2-LIKE PROTEIN 2
    3e-11  12%  1dqaC  [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
    2e-10  13%  3bmaF  [x.x.x] D-ALANYL-LIPOTEICHOIC ACID SYNTHETASE
:289

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEYSILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIATGLCTR
3b3dB           LQAKATLHNVEMPWFGLGVFQVEEGSELVNAVKTAIVHGYRSIDTAAIYGNEAGVGEGIREGIEEAGISR
3b3dA           LQAATLHNGVEMPWFGLGVFQVEEGSELVNAVKTAIVHGYRSIDTAAIYGNEAGVGEGIREGIEEAGISR
1a80A           VPSIVLNDGNSIPQLGYGVFKV-PPADTQRAVEEALEVGYRHIDTAAIYGNEEGVG----AAIAASGIAR
2alrA           ----LLHTGQKMPLIGLGTWKSEP-GQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDVGPGAVPR
2bgsA           ----VLKSGHAMPAVGLGTWRAGS-DTAHSVRTAITEAGYRHVDTAAEYGVEKEVGKGLKAAMEAGID-R
2acuA           ----LLNNGAKMPILGLGTWKSPP-GQVTEAVKVAIDVGYRHIDCAHVHQNENEVGVAIQEKLREQVVKR
1az1A           ----LLNNGAKMPILGLGTWKSPP-GQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR
2dv0A           ----LLNNGAKMPILGLGTWKSPP-GQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR
3c3uA           YQCVKLNDGHFMPVLGFGTYAPVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKR
1afsA           ISLRALNDGNFIPVLGFGTTVPVAKDEVIKATKIAIDNGFRHFDSAYLYEVEEEVGQAIRSKIEDGTVKR
1c9wA           --FVELSTKAKMPIVGLGTWQS-PPGQVKEAVKVAIDAGYRHIDCAYAYYNEHEVGEAIQEKIKEKAVRR
2acsA           ----LLNNGAKMPILGLGTWKSPP-GQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR
3d3fA           LKDTVKLHNVEMPWFGLGVFKVENGNEATESVKAAIKNGYRSIDTAAIYKNEEGVGIGIKESGVA----R
3cv6A           CHCVILNDGNFIPVLGFGTALPCPKSKAKELTKIAIDAGFHHFDSASVYNTEDHVGEAIRSKIADGTVRR
1ah3A           ----VLYTGAKMPILGLGTWKSPP-GKVTEAVKVAIDLGYRHIDCAHVYQNENEVGLGLQEKLQGQVVKR
1adsA           ----LLNNGAKMPILGLGTWKSPP-GQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR
3eauA           QFYRNLGKSLRVSCLGLGTWVTITDEMAEHLMTLAYDNGINLFDTAEVYAAGKA-EVVLGNIIKKKGWRR
3burA           ASHRIPLSDNSIPIIGLGTYSETPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAEGKVRR
2bgqA           EQDHFVLKSHAMPAVGLGTW-----DTAHSVRTAITEAGYRHVDTAAEYGVEKEVGKGLKAAMEAGID-R
3caqB           ASHRILSDGNSIPIIGLGTYSETPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAEGKVRR
2agtA           MASRILLNNAKMPILGLGTWKSPP-GQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR
1ah0A           --HLVLYTGAKMPILGLGTWKS-PPGKVTEAVKVAIDLGYRHIDCAHVYQNENEVGLGLQEKLQGQVVKR
3cv7A           AASCVLLHTQKMPLIGLGTWKS-EPGQVKAAIKYALTVGYRHIDCAAIYGNELEIGEALQETVGPGKAPR
3eb4A           QFYRNLGKSLRVSCLGLGTWVTITDEMAEHLMTLAYDNGINLFDTAEVYAAGKAEV-VLGNIIKKKGWRR
2bp1B           ------------VASVLGTMEMMDAPASAAAVRAFLERGHTELDTAFMYSDGQSET--ILGGLGLGLGCR
2c91A           -----------RPATVLGTMEMMDASASAASVRAFLERGHSELDTAFMYCDGQSEN--ILGGLGLGLGSD
3eb3A           QFYRNLGKSLRVSCLGLGTWVTITDEMAEHLMTLAYDNGINLFDTAEVYAAGK-AEVVLGNIIKKKGWRR
2c91B           -----------RPATVLGTMEMMDASASAASVRAFLERGHSELDTAFMYCDGQSEN--ILGGLGLGLGSD
2clpA           ------------PATVLGAMEMMDAPTSAAVTRAFLERGHTEIDTAFVYSEGQSETILGGLGLRLG-GSD
3cd5C           CRAIGLGGGASSRVLADGMTRVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQ--KLHTSIAG
2bp1A           ------------VASVLGTMEMMDAPASAAAVRAFLERGHTELDTAFMYSDGQSET--ILGGLGLGLGGD
1dq8D           CRAIGLGGGASSRVLADGMTRVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQ--KLHTSIAG
1dqaD           CRAIGLGGGASSRVLADGMTRVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQ--KLHTSIAG
1dq8B           CRAIGLGGGASSRVLADGMTRVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQ--KLHTSIAG
1dq9C           AIG--LGGGASSRVLADGMTRVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQ--KLHTSIAG
2ao0A           ----LLHTGQKMPLIGLGTW-KSEPGQVKAAIKYALTVGYRHIDCAAIYGNELEIGEALQETVGPGKVPR
1dq9B           CRAIGLGGGASSRVLADGMTRVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQ--KLHTSIAG
1dqaB           CRAIGLGGGASSRVLADGMTRGACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQ------KLHTSIAG
2clpI           ------------PATVLGAMEMMDAPTSAAVTRAFLERGHTEIDTAFVYSEGQSETILGGLGLRLG-GSD
3cdbC           CRAIGLGGGASSRVLADGMTRVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKL--HTSIAG
3cdaA           CRAIGLGGGASSRVLADGMTRVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQ--KLHTSIAG
3bglD           CRAIGLGGGASSRVLADGMTRVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQ--KLHTSIAG
3cctC           CRAIGLGGGASSRVLADGMTRVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQ--KLHTSIAG
1dq8A           CRAIGLGGGASSRVLADGMTRVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQ--KLHTSIAG
1dq8C           CRAIGLGGGASSRVLADGMTRVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQ--KLHTSIAG
3cd5D           CRAIGLGGGASSRVLADGMTRVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAG--
2aicA           ---------------------------------------------------------------------R
3cdaD           CRAIGLGGGASSRVLADGMTRVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQ--KLHTSIAG
1dq9D           CRAIGLGGGASSRVLADGMTVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSI--AG
1dy1A           ----------------------------------------------------------------------
2d4cA           ---EIMTKTIEYLQPNPASRAKLYPQAEALLAEAMLKFGRELGDDCNFGPAVGEAMRELSEVKDSLDIEV
3cd0D           CRAIGLGGGASSRVLADGMTRVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTS--IAG
1dy0A           ----------------------------------------------------------------------
2d4cB           -----------NPASRAKLSMIPGYPQAEALLAEAMLKFGRELGDDCNFGPLGEVGEAMRELSEV----K
3ee8B           ----------------------------------------------------------------------
3ee8A           ----------------------------------------------------------------------
2d4cC           -----KTIEYLQPNPASRAKLPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEV----K
1dqaC           -------------MTRGPVVRLPR--ACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSI--AG
3bmaF           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           EELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGDYFSAWRALEDAYEAGKLKAIGVS
3b3dB           EDLFITSKVWNADL-GYEETLAAFETSLSKLGLDYLDLYLIHPVEGKYKEAWRALETLYKEGRIKAIGVS
3b3dA           EDLFITSKVWNADL-GYEETLAAFETSLSKLGLDYLDLYLIHWPVEGKYEAWRALETLYKEGRIKAIGVS
1a80A           DDLFITTKLWNDRH-DGDEPAAAIAESLAKLALDQVDLYLVHWPTPNYVHAWEKMIELRAAGLTRSIGVS
2alrA           EELFVTSKLWNTKH-HPEDVEPALRKTLADLQLEYLDLYLMHWPYAHYKETWKALEALVAKGLVQALGLS
2bgsA           KDLFVTSKIWCTNL-APERVRPALENTLKDLQLDYIDLYHIHWPFRDMEGVWKEMENLVKDGLVKDIGVC
2acuA           EELFIVSKLWCTYH-EKGLVKGACQKTLFKPGKEFFPLDESGNSDTNILDTWAAMEELVDEGLVKAIGIS
1az1A           EELFIVSKLWCTYH-EKGLVKGACQKTLFKPGKEFFPLDESGNSDTNILDTWAAMEELVDEGLVKAIGIS
2dv0A           EELFIVSKLW-CTYHEKGLVKGACQKTLFKPGKEFFPLDESGPSDTNILDTWAAMEELVDEGLVKAIGIS
3c3uA           EDIFYTSKLWCNSH-RPELVRPALERSLKNLQLDYVDLYLIHFPVSDLCATWEAVEKCKDAGLAKSIGVS
1afsA           EDIFYTSKLWSTFH-RPELVRTCLEKTLKSTQLDYVDLYIIHFPMADICDTWEAMEKCKDAGLAKSIGVS
1c9wA           EDLFIVSKLW-PTCFERKLLKEAFPQGLQPGKELFPKDDQGNVSKITFLDAWEVMEELVDEGLVKALGVS
2acsA           EELFIVSKLW-CTYHEKGLVKGACQKTLFKPGKEFFPLDESGNVVPSDTNTWAAMEELVDEGLVKAIGIS
3d3fA           EELFITSKVWNEDQ-GYETTLAAFEKSLERLQLDYLDLYLIHWPGKKYKDTWRALEKLYKDGKIRAIGVS
3cv6A           EDIFYTSKVWCTSL-HPELVRASLERSLQKLQFDYVDLYLIHYPMADLCATWEAMEKCKDAGLTKSIGVS
1ah3A           EDLFIVSKLWCTDHEKLDLYLIHWPTGFKPGKDPFPLDGDGNVVPDESDFVWEAMEELVDEGLVKAIGVS
1adsA           EELFIVSKLWCTYH-EKGLVKGACQKTLSDLKLDYLDLYLIHWPTGNILDTWAAMEELVDEGLVKAIGIS
3eauA           SSLVITTKIFWGGKASRKHIIEGLKASLERLQLEYVDVVFANRPDPPMEETVRAMTHVINQGMAMYWGTS
3burA           EDIFYCGKLWATNH-VPEMVRPTLERTLRVLQLDYVDLYIIEYHKSNLCATWEAMEACKDAGLVKSLGVS
2bgqA           KDLFVTSKIWCTNL-APERVRPALENTLKDLQLDYIDLYHIHWPFRDMEGVWKEMENLVKDGLVKDIGVC
3caqB           EDIFYCGKLWATNH-VPEMVRPTLERTLRVLQLDYVDLYIIEVPMANLCATWEAMEACKDAGLVKSLGVS
2agtA           EELFIVSKLWCTYH-EKGLVKGACQKTLSDLKLDYLDLYLIHWPTGNILDTWAAMEELVDEGLVKAIGIS
1ah0A           EDLFIVSKLW-CTDHEKNLVKGACQTTLRDLKLDYLDLYLIHWPTGDFVETWEAMEELVDEGLVKAIGVS
3cv7A           EELFVTSKLWNTKH-HPEDVEPALRKTLADLQLEYLDLYLMHWPYAHYKDTWKALEALVAKGLVRALGLS
3eb4A           SSLVITTKIFWGGKASRKHIIEGLKASLERLQLEYVDVVFANRPDPPMEETVRAMTHVINQGMAMYWGTS
2bp1B           VKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAHGTPVEETLHACQRLHQEGKFVELGLS
2c91A           CTVKIATKANPWEGLKPDSIRSQLETSLKRLQCPRVDLFYLHAPDHSTPVELCACHQLHQEGKFVELGLS
3eb3A           SSLVITTKIFAGGKAETKHIIEGLKASLERLQLEYVDVVFANRPNTPMEETVRAMTHVINQGMAMYWGTS
2c91B           CTVKIATKANPWEGKSLDSIRSQLETSLKRLQCPRVDLFYLHAHSTPVEETLCACHQLHQEGKFVELGLS
2clpA           CRVKIDTKAIPLNSLKPDSLRFQLETSLKRLQCPRVDLFYLHDHSTPVEETLRACHQLHQEGKFVELGLS
3cd5C           RNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNCTDKKPAAINWIEGRGKSVVCEAV
2bp1A           CRVKIATKANPWDGKSLKSVRSQLETSLKRLQCPQVDLFYLHAPDHPVEETLHACQRLHQEGKFVELGLS
1dq8D           RNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNCTDKKPAAINWIEGRGKVVCEAVI
1dqaD           RNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSNYCTDKKPAAINWIEGRGKSVVCAVI
1dq8B           RNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNCTDKKPAAINWIEGRGKSVVCEAV
1dq9C           RNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKPAAINWIEGRGKSVVCEAV
2ao0A           EELFVTSKLWNTKH-HPEDVEPALRKTLADLQLEYLDLYLMHWPYAHYKDTWKALEALVAKGLVRALGLS
1dq9B           RNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNCTDKKPAAINWIEGRGKSVVCEAV
1dqaB           RNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSNYCTDKKPAAINWIEGRGKSVVCEAV
2clpI           CRVKIDTKAFGNSLKPDSLRFQ-LETSLKRLQCPRVDLFYLHMPDHSTPVTLRACHQLHQEGKFVELGLS
3cdbC           RNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYTDKKPAAINWIEGRGKVVCEAVI
3cdaA           RNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYTDKKPAAINWIEGRGKVVCEAVI
3bglD           RNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKPAAINWIEGRGKSVVEAVI
3cctC           RNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSNYCTDKKPAAINWIEGRGKSVVEAVI
1dq8A           RNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSNYCTDKKPAAINWIEGRGKVVCEAVI
1dq8C           RNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYTDKKPAAINWIEGRGKSVVCEAV
3cd5D           RNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYTDKKPAAINWIEGRGKSVVCEAV
2aicA           HFVDEAVKQVAHARTPAEFGRQVYEATLCAIFSEAKDRFCMDPATRGDAARATGLPGADKQGVFTPSGAG
3cdaD           RNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNCTDKKPAAINWIEGRGKSVVCEAV
1dq9D           RNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKPAAINWIEGRGKVVCEAVI
1dy1A           --------------------------------------PLAHTHQDQPVLHLVALNTPLS-GGMRGIRGA
2d4cA           KQNFIDPLQNLHDKDLREIQSA-LQHHLKKLEGRRLDFDYKKKRQGKIPDERQALEKFDESKEIAESSMF
3cd0D           RNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGYCTDKKPAAINWIEGRGKVVCEAVI
1dy0A           ----------------------------------------------QPVLHLVALNTPLS-GGMRGIRGA
2d4cB           DSLDIEVKQNFIDDKDLREIQSALQHHLKKLEGRRLDFDYKKKRQGKIPDERQALEKFDESKEIAESSMF
3ee8B           ---------------------------------------------------RDWFMLMPKQKVEGPLCIR
3ee8A           ---------------------------------------------------RDWFMLMPKQKVEGPLCIR
2d4cC           DSLDIEVKQNFIDPLQNREIQSALQHHLKKLEGRRLDFDYKKKRQGKIPELRQALEKFDESKEIAESSMF
1dqaC           RNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNCTDKKPAAINWIEGRGKSVVCEAV
3bmaF           ----------------------------------HHNLGAEKRSAVAIDSFKERSVRALSDPNVRFVGSS


                         +         .         .         .         .         *         .:210
query           NFYAHVLANFCETVRITPMVNQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRHKPYENVMLQRIADA
3b3dB           NFQIHHLEDLMTAAEIKPMINQVEFHPRLTQKELIRYCQNQGIQMEAWSPLMQGQL--LDHPVLADIAQT
3b3dA           NFQIHHLEDLMTAAEIKPMINQVEFHPRLTQKELIRYCQNQGIQMEAWSPLMQGQL--LDHPVLADIAQT
1a80A           NHLVPHLERIVAATGVVPAVNQIELHPAYQQREITDWAAAHDVKIESWGPLGQGKYDLFGAEPVTAAAAA
2alrA           NFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGVLLEEP----VVLALAEK
2bgsA           NYTVTKLNRLLRSAKIPPAVCQMEMHPGWKNDKIFEACKKHGIHITAYSPLGSSEKNLAHDPVVEKVANK
2acuA           NFNHLQVEMILNGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPLLEDPRIKAIAAK
1az1A           NFNHLQVEMILNKPGLKYKPAVNECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPLLEDPRIKAIAAK
2dv0A           NFNHLQVEMILNKPGLKYKPAVNECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRSLLEDPRIKAIAAK
3c3uA           NFNRRQLEMILNKPGLKYKPVCNECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWEDPVLCALAKK
1afsA           NFNCRQLERILNKLKYKPVCNQVECHLYLNQSKMLDYCKSKDIILVSYCTLGSSRPVLLDDPVLCAIAKK
1c9wA           NFNHFQIERILNKLKHKPVTNQVECHPYLTQEKLIEYCHSKGITVTAYSPLGSPNRSLLEDPKIKEIAAK
2acsA           NFNHLQVEMILNKPGLKYKPAVNECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRSLLEDPRIKAIAAK
3d3fA           NFQVHHLEELLKDAEIKPMVNQVEFHPRLTQKELRDYCKGQGIQLEAWSPLMQGQL--LDNEVLTQIAEK
3cv6A           NFNYRQLEMILNKPGLKYKPVCNECHPYLNQMKLLDFCKSKDIVLVAYGVLGTQRYPPWDEPVLGSMAKK
1ah3A           NFNHLQVEKILNKPGLKYKPAVNEVHPYLTQEKLIEYCKSKGIVVTAYSPLGSPDRSLLEDPRIKAIAAK
1adsA           NFNHLQVILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRSLLEDPRIKAIAAK
3eauA           RWSSMEIMEAYSVARIPPICEQAEYHMFQREKVEPELFHKIGVGAMTWSPLACGIVSGKYDSGLQAIAER
3burA           NFNRRQLELILNKPGLKHKPVSNQCHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWKDALLNSLGKR
2bgqA           NYTVTKLNRLLRSAKIPPAVCQMEMHPGWKNDKIFEACKKHGIHITAYSPLGKNL---AHDPVVEKVANK
3caqB           NFNRRQLELILNKLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWKDALLNSLGKR
2agtA           NFNHLQVEMILNKPGLKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRSLLEDPRIKAIAAK
1ah0A           NFNHLQVEKILNKPGLKYKPAVNEVHPYLTQEKLIEYCKSKGIVVTAYSPLGSPDRPWAEDPRIKAIAAK
3cv7A           NFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDPVLLEEPVVQALAEK
3eb4A           RWSSMEIMEAYSVARQFNLCEQAEYHMFQREKVLPELFHKIGVGAMTWSPLACGIVSGKKLKELQAIAER
2bp1B           NYASWEVAEICTLCKILPTVYQGMYNATTRQVETFPCLRHFGLRFYAYNPLAGGLNSWAETYRLQAAYGA
2c91A           NYASWEVAEICTLCKSNGWILPTVYQGMYVEAELLPCLRHFGLRFYAYNPLAGGLAIALVEKALQTTYGT
3eb3A           RWSSMEIMEAYSVARIPPICEQAEYHMFQREKVEVQLPHKIGVGAMTWSPLACGIRQQAKLKELQAIAER
2c91B           NYASWEVAEICTLCKILPTVYQGMYNATTRQVEALPCLRHFGLRFYAYNPLAGGLLKYKYEDKLQTTYGT
2clpA           NYAAWEVAEICTLCKILPTVYQGMYNAITRQVELFPCLRHFGLRFYAFNPLAGGLLKYEDKDGKQPVGRF
3cd5C           IPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYAANIVTAIYIACGQDAAQNVGSSIEIGTVGGG
2bp1A           NYASWEVAEICTLCKILPTVYQGMYNATTRQVETFPCLRHFGLRFYAYNPLAGGGNSWAETYRLQAAYGA
1dq8D           PAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVSIEIGTVGGG
1dqaD           PAKVVREVLKTTTEAMIEVNINKNLSAMAGSIGGYNAHAANIVTAIYIACGQDASGPTNEDLYIGTVGGG
1dq8B           IPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYAANIVTAIYIACGQDAAQNVGPSIEIGTVGGG
1dq9C           IPAKVVREVLKTTTEMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVSIEIGTVGGG
2ao0A           NFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRVLLEEPVVQALAEK
1dq9B           IPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGGYNAHAANIVTAIYIACGQDASGPTNESIEIGTVGGG
1dqaB           IPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSYNAHAANIVTAIYIACGQDAAQDLYISCTMGTVGGG
2clpI           NYAAWEVAEICTLCKILPTVYQGMYNAITRQVELFPCLRHFGLRFYAFNPLAGGLYKYEDKDGKQPVGRF
3cdbC           PAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAAVTAIYIACGQDAAQNVGSSIEIGTVGGG
3cdaA           PAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAAVTAIYIACGQDAAQNVGPSIEIGTVGGG
3bglD           PAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSIGTVGGG
3cctC           PAKVVREVLKTTTEAMIEVNINKNLVGSAMAGGGYNAHAANIVTAIYIACGQDAAQDLYISCTMPTVGGG
1dq8A           PAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSGYNAHAANIVTAIYIACGQDAAQNVGSSIEIGTVGGG
1dq8C           IPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYAANIVTAIYIACGQDAAEDLYISCTIGTVGGG
3cd5D           IPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYAANIVTAIYIACGQDAAQNVGSSNCIGTVGGG
2aicA           TNPLYTEIRLRADTLLAARPEYRELQPYARQQAIANALPAERSNTLVEFRQTVQTLTYRRAAQDASRDEK
3cdaD           IPAVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSIEIGTVGGG
1dq9D           PAKVVIEVNINKNLVGSAMAGSIGGYNAGQDAAQNVGSSNCITLMEASGPTNEDLYISCTSIEIGTVGGG
1dy1A           DFQCFQQARAVGLSGTFRAFLSSRLQDLYVRRADRGSVPIVNLKDEVLSPSWDSFDGRDVLRHWHGSDPS
2d4cA           NLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQ--------------------------
3cd0D           PAKVVREVL-KTTTEAMIEVNINKNLVGSAMAGSIGGAHAANVTAIYIACGQDASGPTNESIEIGTVGGG
1dy0A           DFQCFQQARAVGLSGTFRAFLSSRLQDLYSIVADRGSVPIVNLKDEVLSPSWDSLPAWPQKSVWHGSDPS
2d4cB           NLLEMDIEQVSQLSA--LVQAQLEYHKQAVQIQVTVRLEERIRQ--------------------------
3ee8B           IDQAIMDK------NIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVAIGVLIGG
3ee8A           IDQAIMDK------NIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVAIGVLIGG
2d4cC           NLLEMDIEQVSQLSA--LVQAQLEYHKQAVQILQTVRLEERIRQ--------------------------
1dqaC           IPAKVVREVLKTTTEAMIEVNINKNLVGSAMAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIETVGGG
3bmaF           EWLRFDGAHPAVPYLLGQGGAASLNQYFGMQQPQLENKQVVYVISPQWFSKNGYDPAAFQQDLVQKLASK


                         .         .         .         +         .         .         .:280
query           HQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINALDLGYVGEAVKHFNPEFVR
3b3dB           YNKSVAQIILRWDLQHGIITIPKSTKEHRIKENASVFDFELTQDDMNRIDALN-----------------
3b3dA           YNKSVAQIILRWDLQHGIITIPKSTKEHRIKENASVFDFELTQDDMNRIDALN-----------------
1a80A           HGKTPAQAVLRWHLQKGFVVFPKSVRRERLEENLDVFDFDLTDTEIAAIDAMDPGD--------------
2alrA           YGRSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFTFSPEEMKQLNALNKNW--------------
2bgsA           LNKTPGQVLIKWALQRGTSVIPKSSKDERIKENIQVFGWEIPEEDFKVLCSIK-----------------
2acuA           HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYN-----------------
1az1A           HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNW--------------
2dv0A           HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNW--------------
3c3uA           HKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN-----------------
1afsA           YKQTPALVALRYQLQRGVVPLIRSFNAKRIKELTQVFEFQLASEDMKALDGLNRNF--------------
1c9wA           HKKTSAQVLIRFHIQRNVVVIPKSVTPARIHENFQVFDFQLSDQEMATILGFNRNW--------------
2acsA           HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNW--------------
3d3fA           HNKSVAQVILRWDLQHGVVTIPKSIKEHRIIENADIFDFELSQEDMDKIDALNKDE--------------
3cv6A           YNRTPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVLDGLN-----------------
1ah3A           YNKTTAQVLIRFPMQRNLIVIPKSVTPERIAENFQVFDFELSPEDMNTLLSYN-----------------
1adsA           HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYN-----------------
3eauA           LGCTLPQLAIAWCLRNVSSVLLGASNAEQLMENIGAVLPKLSSSIVHEIDSILGNK--------------
3burA           YNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALN-----------------
2bgqA           LNKTPGQVLIKWALQRGTSVIPKSSKDERIKENIQVFGWEIPEEDFKVLCSIK-----------------
3caqB           YNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNV--------------
2agtA           HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYN-----------------
1ah0A           YNKTTAQVLIRFPMQRNLIVIPKSVTPERIAENFQVFDFELSPEDMNTLLSYN-----------------
3cv7A           YNRSPAQILLRWQVQRKVICIPKSVTPSRILQNIQVFDFTFSPEEMKQLDALN-----------------
3eb4A           LGCTLPQLAIAWCLRNEGSVLLGASNAEQLMENIGAIQVKLSSSIVHEIDSILGNK--------------
2bp1B           SAPSVTSAALRWMYHHGDAVILGMSSLEQLEQNLAATEGPLEPAVVDAFNQAW-----HLVAHECPNYFR
2c91A           NAPRMTSAALRWMYHHGDAVILGMSSLEQLEQNLAATEGPLEPAVVEAFDQAWNMV-----AHECPNYFR
3eb3A           LGCTLPQLAIAWCLRNVSSVLLGASNAEQLMENIGAVLPKLSSSIVHEIDSILGNK--------------
2c91B           NAPRMTSAALRWMYHHGDAVILGMSSLEQLEQNLAATEGPLEPAVVEAFDQAW-----NMVAHECPNYFR
2clpA           FGNTWAEMYRNRYWKEHHFEGIALVEKALQAAYG---ASAPSMTSATLRWMYHHSQL-------------
3cd5C           TNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHL----------------
2bp1A           SAPSVTSAALRWMYHHGDAVILGMSSLEQLEQNLAATEGPLEPAVVDAFNQAW-----HLVAHECPNYFR
1dq8D           TNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHL----------------
1dqaD           TNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHL----------------
1dq8B           TNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHL----------------
1dq9C           TNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHL----------------
2ao0A           YNRSPAQILLRWQVQRKVICIPKSVTPSRILQNIQVFDFTFSPEEMKQLDAL------------------
1dq9B           TNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAG---ELSLMAALAAGH--------------
1dqaB           TNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHL----------------
2clpI           FGNTWAEMYRNRYWKEHHFEGIALVE-KALQAAYGASAPSMTSATLR-----------------------
3cdbC           TNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAA-------------------
3cdaA           TNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHL----------------
3bglD           TNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAA-------------------
3cctC           TNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAA-------------------
1dq8A           TNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHL----------------
1dq8C           TNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMA---GELSLMAALAAGH--------------
3cd5D           TNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHL----------------
2aicA           GATNAADG--------------------------------------------------------------
3cdaD           TNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAA-------------------
1dq9D           TNLLPQQACLQMLGVQGACKDNPGENARQLARIVC--GTVMAGELSL-MAALAAGHLVKS----------
1dy1A           GRRLMESYCETWRTETTGSSLLSGRLLEQKAASCHNSYIVLCIENSF-----------------------
2d4cA           ----------------------------------------------------------------------
3cd0D           TNLLPQQACLQMLGVQGACKDNPGENARQLARIVC-----------------------------------
1dy0A           GRRLMESYCETWRTETTASSLLSGRLLEQKAASCHNSYIVLCIENSF-----------------------
2d4cB           ----------------------------------------------------------------------
3ee8B           LEWNDNTVRVSKTLQR------------------------------------------------------
3ee8A           LEWNDNTVRVSKTLQR------------------------------------------------------
2d4cC           ----------------------------------------------------------------------
1dqaC           TNLLPQQACLQMLGVQGACKDNPGENARQLARIVC-----------------------------------
3bmaF           EELSTADNEMIELLARFN------ERQASFFGQFSGY-VNYDKHVAKYLKILPDQFSYQAIED-------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxx
3b3dB           ---------
3b3dA           ---------
1a80A           ---------
2alrA           ---------
2bgsA           ---------
2acuA           ---------
1az1A           ---------
2dv0A           ---------
3c3uA           ---------
1afsA           ---------
1c9wA           ---------
2acsA           ---------
3d3fA           ---------
3cv6A           ---------
1ah3A           ---------
1adsA           ---------
3eauA           ---------
3burA           ---------
2bgqA           ---------
3caqB           ---------
2agtA           ---------
1ah0A           ---------
3cv7A           ---------
3eb4A           ---------
2bp1B           ---------
2c91A           ---------
3eb3A           ---------
2c91B           ---------
2clpA           ---------
3cd5C           ---------
2bp1A           ---------
1dq8D           ---------
1dqaD           ---------
1dq8B           ---------
1dq9C           ---------
2ao0A           ---------
1dq9B           ---------
1dqaB           ---------
2clpI           ---------
3cdbC           ---------
3cdaA           ---------
3bglD           ---------
3cctC           ---------
1dq8A           ---------
1dq8C           ---------
3cd5D           ---------
2aicA           ---------
3cdaD           ---------
1dq9D           ---------
1dy1A           ---------
2d4cA           ---------
3cd0D           ---------
1dy0A           ---------
2d4cB           ---------
3ee8B           ---------
3ee8A           ---------
2d4cC           ---------
1dqaC           ---------
3bmaF           ---------