[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for sent8:ACF69712.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cu7A.bssp"
#ERROR : Can't open dsspfile "3ecqB.bssp"
#ERROR : Can't open dsspfile "2dcjA.bssp"
#ERROR : Can't open dsspfile "2a9dB.bssp"
#ERROR : Can't open dsspfile "3ecqA.bssp"
#ERROR : Can't open dsspfile "2a9cA.bssp"
#ERROR : Can't open dsspfile "2a9dA.bssp"
#ERROR : Can't open dsspfile "3eb7C.bssp"
#ERROR : Can't open dsspfile "3cu7B.bssp"
#ERROR : Can't open dsspfile "1cygA.bssp"
#ERROR : Can't open dsspfile "2b39A.bssp"
#ERROR : Can't open dsspfile "2ca4A.bssp"
#ERROR : Can't open dsspfile "3dyoA.bssp"
#ERROR : Can't open dsspfile "1dabA.bssp"
#ERROR : Can't open dsspfile "2dckA.bssp"
#ERROR : Can't open dsspfile "2a4eA.bssp"
#ERROR : Can't open dsspfile "2e24A.bssp"
#ERROR : Can't open dsspfile "2a9aB.bssp"
#ERROR : Can't open dsspfile "4cgtA.bssp"
#ERROR : Can't open dsspfile "2c9xA.bssp"
#ERROR : Can't open dsspfile "1a47A.bssp"
#ERROR : Can't open dsspfile "3bmvA.bssp"
#ERROR : Can't open dsspfile "2e22A.bssp"
#ERROR : Can't open dsspfile "2ca3A.bssp"
#ERROR : Can't open dsspfile "1cguA.bssp"
#ERROR : Can't open dsspfile "3cu7A.bssp"
#ERROR : Can't open dsspfile "3ecqB.bssp"
#ERROR : Can't open dsspfile "3ecqB.bssp"
#ERROR : Can't open dsspfile "2a9dB.bssp"
#ERROR : Can't open dsspfile "2a9dB.bssp"
#ERROR : Can't open dsspfile "2a9dB.bssp"
#ERROR : Can't open dsspfile "2a9dB.bssp"
#ERROR : Can't open dsspfile "2a9dB.bssp"
#ERROR : Can't open dsspfile "3ecqA.bssp"
#ERROR : Can't open dsspfile "2a9cA.bssp"
#ERROR : Can't open dsspfile "2a9cA.bssp"
#ERROR : Can't open dsspfile "2a9cA.bssp"
#ERROR : Can't open dsspfile "2a9cA.bssp"
#ERROR : Can't open dsspfile "2a9cA.bssp"
#ERROR : Can't open dsspfile "2a9cA.bssp"
#ERROR : Can't open dsspfile "2a9dA.bssp"
#ERROR : Can't open dsspfile "2a9dA.bssp"
#ERROR : Can't open dsspfile "2a9dA.bssp"
#ERROR : Can't open dsspfile "2a9dA.bssp"
#ERROR : Can't open dsspfile "2a9dA.bssp"
#ERROR : Can't open dsspfile "3eb7C.bssp"
#ERROR : Can't open dsspfile "3cu7B.bssp"
#ERROR : Can't open dsspfile "1cygA.bssp"
#ERROR : Can't open dsspfile "2b39A.bssp"
#ERROR : Can't open dsspfile "3dyoA.bssp"
#ERROR : Can't open dsspfile "2dckA.bssp"
#ERROR : Can't open dsspfile "2a4eA.bssp"
#ERROR : Can't open dsspfile "2a9aB.bssp"
#ERROR : Can't open dsspfile "2a9aB.bssp"
#ERROR : Can't open dsspfile "4cgtA.bssp"
#ERROR : Can't open dsspfile "2c9xA.bssp"
#ERROR : Can't open dsspfile "2c9xA.bssp"
#ERROR : Can't open dsspfile "2c9xA.bssp"
#ERROR : Can't open dsspfile "2c9xA.bssp"
#ERROR : Can't open dsspfile "1a47A.bssp"

## Summary of PDB Search
:3824
    1e-10  10%  3cu7A  [x.x.x] COMPLEMENT C5
    1e-10   8%  3ecqB  [x.x.x] ENDO-ALPHA-N-ACETYLGALACTOSAMINIDASE
    9e-09   9%  2dcjA  [x.x.x] XYLANASE J
    9e-09  20%  2a9dB  [x.x.x] SULFITE OXIDASE
    1e-08   9%  3ecqA  [x.x.x] ENDO-ALPHA-N-ACETYLGALACTOSAMINIDASE
    2e-08  11%  2a9cA  [x.x.x] SULFITE OXIDASE
    3e-08  17%  2a9dA  [x.x.x] SULFITE OXIDASE
    2e-07   9%  3eb7C  [x.x.x] INSECTICIDAL DELTA-ENDOTOXIN CRY8EA1
    6e-07   9%  3cu7B  [x.x.x] COMPLEMENT C5
    1e-06  11%  1cygA  [x.x.x] CYCLODEXTRIN GLUCANOTRANSFERASE
    2e-06  10%  2b39A  [x.x.x] C3
    3e-06  11%  2ca4A  [x.x.x] SULFITE\:CYTOCHROME C OXIDOREDUCTASE SUBUNIT A
    4e-06  12%  3dyoA  [x.x.x] BETA-GALACTOSIDASE
    8e-06  10%  1dabA  [b.80.1] P.69 PERTACTIN
    1e-05  11%  2dckA  [x.x.x] XYLANASE J
    1e-05  10%  2a4eA  [x.x.x] CADHERIN-11
    3e-05  10%  2e24A  [x.x.x] XANTHAN LYASE
    3e-05  14%  2a9aB  [x.x.x] SULFITE OXIDASE
    5e-05  11%  4cgtA  [x.x.x] CYCLODEXTRIN GLYCOSYLTRANSFERASE
    5e-05  14%  2c9xA  [x.x.x] SULFITE\:CYTOCHROME C OXIDOREDUCTASE SUBUNIT A
    6e-05   7%  1a47A  [x.x.x] CYCLODEXTRIN GLYCOSYLTRANSFERASE
    1e-04  10%  3bmvA  [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
    2e-04   6%  2e22A  [x.x.x] XANTHAN LYASE
    2e-04  14%  2ca3A  [x.x.x] SULFITE\:CYTOCHROME C OXIDOREDUCTASE SUBUNIT A
    3e-04  12%  1cguA  [x.x.x] CYCLODEXTRIN GLYCOSYL-TRANSFERASE
    2e-05   6%  3cu7A  [x.x.x] COMPLEMENT C5(query 884->1133)
    3e-05   8%  3ecqB  [x.x.x] ENDO-ALPHA-N-ACETYLGALACTOSAMINIDASE(query 558->915)
    3e-04  10%  3ecqB  [x.x.x] ENDO-ALPHA-N-ACETYLGALACTOSAMINIDASE(query 1316->1667)
    3e-07  14%  2a9dB  [x.x.x] SULFITE OXIDASE(query 2100->2265)
    9e-07  14%  2a9dB  [x.x.x] SULFITE OXIDASE(query 1067->1230)
    3e-06  15%  2a9dB  [x.x.x] SULFITE OXIDASE(query 1563->1661)
    4e-05  12%  2a9dB  [x.x.x] SULFITE OXIDASE(query 1878->2058)
    2e-04  21%  2a9dB  [x.x.x] SULFITE OXIDASE(query 912->1019)
    4e-06   9%  3ecqA  [x.x.x] ENDO-ALPHA-N-ACETYLGALACTOSAMINIDASE(query 2021->2270)
    1e-07  18%  2a9cA  [x.x.x] SULFITE OXIDASE(query 2466->2580)
    7e-07  16%  2a9cA  [x.x.x] SULFITE OXIDASE(query 2161->2265)
    5e-05  13%  2a9cA  [x.x.x] SULFITE OXIDASE(query 1878->2058)
    1e-04  16%  2a9cA  [x.x.x] SULFITE OXIDASE(query 990->1142)
    4e-04  18%  2a9cA  [x.x.x] SULFITE OXIDASE(query 856->928)
    5e-04  16%  2a9cA  [x.x.x] SULFITE OXIDASE(query 205->265)
    5e-06  19%  2a9dA  [x.x.x] SULFITE OXIDASE(query 2481->2580)
    1e-05  12%  2a9dA  [x.x.x] SULFITE OXIDASE(query 1563->1661)
    3e-05  17%  2a9dA  [x.x.x] SULFITE OXIDASE(query 1955->2058)
    3e-05  15%  2a9dA  [x.x.x] SULFITE OXIDASE(query 2101->2161)
    8e-05  21%  2a9dA  [x.x.x] SULFITE OXIDASE(query 1059->1145)
    4e-06   6%  3eb7C  [x.x.x] INSECTICIDAL DELTA-ENDOTOXIN CRY8EA1(query 2042->2279)
    6e-05   8%  3cu7B  [x.x.x] COMPLEMENT C5(query 987->1134)
    2e-06  13%  1cygA  [x.x.x] CYCLODEXTRIN GLUCANOTRANSFERASE(query 2110->2277)
    2e-06  10%  2b39A  [x.x.x] C3(query 1808->2493)
    2e-04  23%  3dyoA  [x.x.x] BETA-GALACTOSIDASE(query 312->360)
    1e-04  15%  2dckA  [x.x.x] XYLANASE J(query 2072->2136)
    8e-04  16%  2a4eA  [x.x.x] CADHERIN-11(query 1003->1132)
    6e-05  14%  2a9aB  [x.x.x] SULFITE OXIDASE(query 2364->2475)
    3e-04  17%  2a9aB  [x.x.x] SULFITE OXIDASE(query 2161->2265)
    5e-04  12%  4cgtA  [x.x.x] CYCLODEXTRIN GLYCOSYLTRANSFERASE(query 2314->2550)
    2e-04  15%  2c9xA  [x.x.x] SULFITE\:CYTOCHROME C OXIDOREDUCTASE SUBUNIT A(query 1989->2055)
    3e-04  14%  2c9xA  [x.x.x] SULFITE\:CYTOCHROME C OXIDOREDUCTASE SUBUNIT A(query 1511->1553)
    5e-04  18%  2c9xA  [x.x.x] SULFITE\:CYTOCHROME C OXIDOREDUCTASE SUBUNIT A(query 2314->2370)
    8e-04  20%  2c9xA  [x.x.x] SULFITE\:CYTOCHROME C OXIDOREDUCTASE SUBUNIT A(query 2427->2472)
    6e-04   9%  1a47A  [x.x.x] CYCLODEXTRIN GLYCOSYLTRANSFERASE(query 2102->2273)
:3824

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTVSGEA
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------RVDVSL
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           EAGSTITIKDPSGNVVGEGKADSDGKFSIDLTAPQLSGEQLTVTATDDAGNTGPSxxxxxxxxxxxxxxx
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           DGGRTWKVARLMGDKAPPGRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQPD---------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGSAGTVIHIYANGQEIGSTTVDSSGSWRFAITSALADGE
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           -------------------------------DGVNSAFHLWCNGRWVGYGQ-DSRLPSEFDLSAFLRAGE
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           NHFTAIATNVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           NRLAVMVLRW------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTEF
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           -------------------------------------------------------------------YAV
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           TASDSQYPAQPTILTVTDDAGAVTGLLKNGDATDDNRPTLSGTAEPGSTISINDNGFPVPTFPPIVADAD
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           YVGVDNRSNAKASITVNTGEKEVTTYTNKSLALNYVKAYAHNTRRNNATVDDTSYFQNYAFFTTGSDVSN
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           GKWSFTPSLALADGDHVFTATATNDRGTSGQSVSFTIDIDTQPPVLEGLAVSDVGDRLTGTTEAGSTVVI
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           VTLTLSREAGDEATYFDEIRTFENNSSYGDKHDTGKGTFKQDFENVAQGIFPFVVGGVEGVEDNRTHLSE
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           KDSQGNTLGSGTAGDDGTFSIGISPAKINGETLSISVTDKAANSGPVETLNAPDKTAPAAPDGLIVATDG
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           KHDPYTQRGWNGKKVDDVIEGNWSLKTNGLVSRRNLVYQTIPQNFRFEAGKTYRVTFEYEAGSDNTYAFV
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           LSVSGQAEAGATVTIRDSSNTVLGSAVANGNGQFIVPLNTAQTNGQALIATATDVAKNESAAATVIAPDS
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           VGKGEFQSGRRGTQASNLEHELPNTWTDSKKAKKATFLVTGAETGDTWVGIYSTGNASNTRGDSGGNANF
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           TAPEMPKNVVISEDGTSISGTAEPGSAITIATPDGKPLGSGKADGEGHFTLPLVPAQTNGEQVTVTATDS
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           -------------------------------------------EQTYVISAPKIFRVGASENIVIQVYGY
3ecqB           RGYNDFDNLQIEEITLTGKLTENALKNYLPTVA------------------TNYTKESDALKEAVFNLSQ
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ---------------VRVDVSLDGGRTWKVARLMGDKAPPGRAWAWALWELTVPVEAGTELEIVCKAVDS
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           ANNVSPPTTAQAPDITAPDKPIITQVLDDVESFTGPLVNGQTTNDNRPTLSGTAEAGARVEVFDNGVSLG
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           TEAFDATISIKSYPDKKFSYSHVHLSSENKFQNSAILTIQPKQLPGGQNPVSYVYLEVV-SKHFSKSKRM
3ecqB           ADDDI-----------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           -QNDYKGFSPCVDWDTVDYRTAPAIQELPVQSAVTQPRPGAAVPPGELTVKGYAWSGGGREVLDGGRTWK
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           SYNVQPDSVAPIWNLRGV----------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           LATLQPNGGWTFTPSQNLGEGAHRLTVIATDAKGNASPAASFDLVVDTQSPQQPVITFITDDAPGILGSV
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ------------TPNILRLESEETVVLEAHGGQGTIQVSVTVHDFPA-KKQVLSNENTQLNSNNGYLSTV
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           --------------------------------------------------ATIPINRFDVRSFITNVENG
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           PITYDNGFLFIHTDKPVYTPDQVKVRVYSLNDDLKPAKRETVLTFIDPEGSEVDMVEEIDHIGIISFPDF
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           VARLMAWALWELTVPVEAG-TELEIVCKAVDSSYNVQPD-------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ---------WLRRVAVSPDESPSHWQQNDYKGFSPCVDWDTVDYRTAPAIQELPVQSAVTQPRPGAAVPP
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ------QTYVISAPKIFRVGASENIVIQVYGYTEAFDATISI-KSYPDKKFSYSSGHVHLSSENKFQNSA
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------YTLMAQAVDRDTNRPLEPPSEFIVKVQDINDNPPEFLHEIYHANVPER
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           AHLGLTNDSTPTINGTGEPGSTVHLYQNGARIADIIVGNSGVWSYAYTTASPLADDTYTFTVTASDSNGN
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           TIKIPASKELKSDKGHK---FVTVVATFGNVQVEKVVLISLQSGYLFIQTDKTPGSTVLYRVFTVDHKLL
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ASVKAGEVPLRGIAFDGGYGITQVSVSKSWTNATLDPGLGKYSFRGWKAVLPLTKGDHVLMCRATNARGE
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           KIPSNPRYGMWTIKAKYKEDFSTTGTAYFEVKEYVLPHFSVSIEPEYNFIGYKNFKNFEITIKARYFYNK
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------GTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDESPSHWQQNDYKGFSPCV
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ---GELTVKGYAWSGGGREVVRVDVSLDGGRTWKVARGRAWAWALWELTVPVEAGTELEIVCKAVDSSYN
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           --------KGYAWSGGGREVVRVVSLDGGARLMGDKAPPGRAWAWAELTVPVEAGTELEIVCKAVDSSYN
3eb7C           ----------------------------------------------------------------------
3cu7B           ILTIQPKQLPGGQNPV----SYVYLVVSKHFSKSKRMPITYDNGFLFIHTDKPPDQSVKVRVYSLNDDLK
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           SNVGTSIQVTASDADDPTYGNSAKLVYSILEGQPYVEAQTGIIRTALPNMDREAKEEYHVVIQAKDMGGH
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           TTPFSTDFTITIDTQAPAAPGVIGVADGDGNTIDTNQITQESQPRLSGSGTAGDTIILYDNGNAIGQALV
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           --PVGQTVFITIETPDGIPVKRDSKSSQNQFGILTLSWNIPELV-----NMGVWKIKAYYEDSPQQVFEV
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           TQPMQATWNPAGYMRNVVEATRVIAA--------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           VVTEADVYITFGI---------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           DWDTVDYRTAPAIQELPVQSAVTQPRPG--AAVPPGELTVKGYAWSGGGREVVRVDVSLDGGRTWKVARA
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           VQP--DSVAPIWNLRGVLSTAW------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           VQPDSVAPIWNLRGVLSTAWHRVRV---------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           --PAKRETVLTFID--------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           MGGLSGTTKVTI----------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           GTDGRWQFTPPAALGDGDHLLTARANDPAGNESPESISFTLRIDTQAPDAPQIVSAAITGGEGEVLLANG
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           KEYVLPSFEVQLEPEPDGLKVNIIARFLYGEQVDGTAFVIFGVQDGDRRISLTHSLTRVPINDG-NGEAI
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           WAWALWELTVPVEA-GTELEIVCKAVDSSYNVQPDSVAPI------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:1330
query           SITNQRMPTLSGTGEPGTIITLYNNGVELATVQVNPQGSWTYPLTRNLSEGLNILTATATDAAGNSSPTS
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           LKRQVLLNGVQPSRADALVGKSIYVSATVILQSGSDMVEAERTGIPIVTSPYQIHFTKTPKFFKPAMPFD
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           -------------------------------------------------------NTKYAVYVGVDNRSN
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:1400
query           GVFSVTLDTQPPAQPDAPLISDNVAPVIGNIGNNGATNDTTPTFSGTGEIGSTIILYNNGSEIGRTTVGD
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           LMVYVTNPDGSPARHIPVVTQGSNLTQDDGVAKLSINTQNKR---DPLTITVRTKKDNIPEGRQATRTMQ
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           AKASITVNTGEKEVTTYTNKSLALNYVKAYAHNTRRNNATVDDTSYFQNYAFFTTGSDVSNVTLTLSREA
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:1470
query           NGSWSFTPAALXXXXXXXXXXXXDIAGNISPPSASVTFTLDTTAPANPVITFAEDNVGEVQDTIVSGATT
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ALPYNT----------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           GDEATYFDEIRTFENNSSYGDKHDTGKGTFKQDFENVAQGIFPFVVGGVNRTHLSEKHDPYTQRGWNGKK
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:1540
query           DDNTPVIHGTGDIGSVITLYNXXXXXXXXXXXXXXXWTLPVTSALPDGVYTLTAIAADAAGNSSDVSNSF
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           -----------------------------------------------NDYKGFSPCVDWDTVDYRTAPAI
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           VDDVIEGNWSLKTNGLVSRRNLVYQTIPQNFRFEAGKTYRVTFEYEAGSDNTYAFVV---GKGEFQSGRR
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------AVLPLTKGDHVLMCRATNARGETQPMQATW
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:1610
query           TFTVDTVPLQPPVVNEILDDVAPVTGPLTDGAFTNDRTLTINGSGENGSTVTIYDNGVAIGTALVTDGTW
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           QELPVQSAVTQPRPGAAVPPGELVKGYAWSGGGREVVRVDVSLDGGRTWKVARLMGDKAPPGRAWAWALW
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           -LPVQSAVTQPRPGAAVPPGELTVKGYAWSGGGREVVRVDVSLDGGRTWKVARLMGDKAPPGRAWAWALW
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           GTQASNLEHELPNTWTDSKKAKKATFLVTGAETGDTWVGIYSTGNASNTRGDSGGNANFRGYNDFDNLQI
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------PRPGAAVPPGELTVKGYAWSGGGREVVRVDVLDGGRTWKVARLAWALW
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------ELTVKGYAWSGGGREVVRVDVSLDGGRTWKVARMGDKAPPGRAWAALW
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           NPAGYMRNVVEAT---------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:1680
query           TFNTPELSEVSHALTFSATDDAGNTTAQTQPITITVDITAPPAPTIQTVDDDGTRVAxxxxxxxxxxxxx
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ELTVPVEAGTELEIVCKAVDSSYNV--QPDSVAPIWNLRGVLSTAWHRV---------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ELTVPVEAGTELEIVCKAVDSSYNV--QPDSVAPIWNLRGVLSTAWHRV---------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           EEITLTGKLTENALKNYLPTVATNYTKESDALKEAVFNLSQADDDI-SVEEARAEIA-------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ELTVPVEAGTELEIVCKAVDSSYNVQPDSVAPIWNLRGVLSAWHRVRSVQD-------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ELTVPVEAGTELEIVCKAVDSSYNVQPDSVAPIWNLRLSTAWHRVRVSVQD-------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1750
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1820
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxESTHYFTVQATNA
3cu7A           ---------------------------------------------------------GASENIVIQVYGY
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ---------------------------------------------------------ESEETVVLEAHGG
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1890
query           NGPGGLSAPVGITVDLSVPAQPVITSATDDVPGMTGTLDNGALTNDSRPTLNGTGEAGATIRILDNGVEI
3cu7A           TEAFDATISIKSYPDKKFSSGHVHLSSENKFQN-SAILTIQPKQLPGGQNPVSYVYLEVVS---KHFSKS
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ---------------------------------------------------------GFPVRVVVPGV-V
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ---------------------------------------------------------GFPVRVVVPGVVG
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           QGT----IQVSVTV-HDFPAKKQVLSNENTQLNSNNGYLSTVTIKIPASKELKSDKGHKFVTVVATFGNV
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1960
query           GSATVDQSGNWRFTPNAPLENIAHIFTAVATDPAGNSGQPSDGFTLNIDAQAPDVPVITSVIDDNNQPTV
3cu7A           KRMPITYDNGFLFIHTDKPPDQSVKVRVYSLNDDLKPAKRETVLT-------FIDPEGSEVDMVEEIDHI
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ------EQTYVISAPKIFRVGASENIVIQVYGYTEA------------------FDATISIKSYPDKKFS
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           -QQLRSLNGEWRFAWFPAPEAVPESWLECDLPEADTVVVPSNWQMHGYDAIYTNVTYPITVNPPFVPTEN
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           GARSVKWLRRVAVSPDESPSHWQQNDYKGFSPCVDWDTVDYRTAPAIQELPVQSAVTQPRPGAAVPPGEL
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ARSVKWLRRVA--VSPDESPSHWQQNDYKGFSPCVDWDTVDYRTAPAIQELPVQSAVTQPRPGAAVPPGE
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------PGELTV
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           QVEKISLQSGYLFIQTDKTPGSTVLYRVFTVDHKLLP--VGQTVFITIETPDGIPVKRDSKSSQNQFGIL
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:2030
query           PVLPGQSTDDRQPILNGTGEPGATITIFDNGTPLGTAQVGENGSWTFPVPRNLSEGSHNLTVSATDPAGN
3cu7A           GIISFPDFKIPSNPRYGMWTIKAKYKEDFSTTGTAYFEVKEYVLPHFNFIGYKNFKNFEITIKARYFYNK
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           NKFQNSAILTIQPKQLPGGQNPVSYVYLEVVSKHFSKSKYDNGFLHTDKPVYTPDQSVKVRVYSLNDDLK
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           -----------------------------------------------------------IGLTARPPQLE
3dyoA           PTVDESWLQEGQTRII-FDGVNSAFHLWCNGRWVGYGQDSRL-PSEFDLSAFLRAGENRLAVMVLRWSDG
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           --------------------------------------------------------------VIQEDTFS
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           TVKGYAWSGGGREVVDVSLDGGRTWKVARMGDKAPPGRAWAWALWELTVP-VEAGTELEIVCKAVDSSYN
2a9dB           ----------------------------------------------------------------------
3ecqA           ------------------------------------------------------------RTFENNSSYG
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           LTVKGYAWS-------GGGREVVRVDVSLDGDKAPPGRAWAWALWELTVP-VEAGTELEIVCKAVDSSYN
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           KGYAWSGGGRRVDVSLDGGRTWKVARLMGDKAPPGRAWAWALWELTVPVEAG---TELEIVCKAVDSSYN
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           PELVNMGVWKIKAYYEDSPQQVFSAEFEVKEYVLPSFEV--QLEPEEKFYYIDDPDGLKVNIIARFLYGE
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------KSWTNATLDPGLGKYSFRGWKAVLPLTKGHVLMCRATNARGE
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:2100
query           TSAVSAPWTIVVDITPPAIPVLTSVVDDQPGITGNLVSGQLTNDATPTLNGRGEAGATINVYLDGNPASI
3cu7A           VVTEADVYITFGIREDDQKEMMQTAMQNTMLINGIAQVTFDSETAVKELSYY------SLEDLNNKYLYI
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----PAKRETVLTFIDPEGSEVDMVEEIDHIGIISFPDFKIPSNPRY-----GMWTIKAKYKEDFSTTGT
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           TPF---SVFDEGLITPNDAFVRYALAGIPLEIDPDEIKGKVGTPLSLSLQDLKNDFPASEVVAVNQCSGN
3dyoA           SYLEDQDMWRMSGIFRDVSLLHKPTTQISDFHVATRFNDD-FSRAVLEAEVQMCGELRDYLRVTVSLWQG
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           --------------------------------------------------------------YEAYRPLL
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------NNFTLAAGATAVWQYTTAETTPTIGHVGPVMGKPGN
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           SFYGDVSTDTIRLAKAIVDDPSIAPAAAPNLYKQYAAMDRAVLQRPGFALGLALYSTRISSYESINSENG
2ca3A           ----------------------------------------------------------------------
1cguA           ------------------------------------------NNFTLAAGATAVWQYTTAETTPTIGHVG
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ---------------------------------------------------------------------V
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           VQPDSVAPIWNLRGVLSTAWHRVRVVQD------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           DKHDTGKGTFKQDFENVAQGIFPFVVGGVEGVEDNRTHLSEKHDPYTQRGWNGKKVDDVIEGNWSLKTNG
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           VQPDSV--APIWNLRGVAWHRVRVSVQD------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           VQPDSVAPIWNLRGVLSTAWHRVRVVQD------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           -----------QQIGFTGFDVYKTLSTAGVLFAYTSKYYGVSKVVFDAIYPDNKYKTTFTYNPGSEGIGA
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           QVDGTAFVIFGVQDGISLTHSLTRVPINDGNGEAILKRQVLLGVQPSRADA--------LVGKSIYVSAT
3dyoA           ----------------------------------------------------------------------
2dckA           -----------------------------------------KANSSFSLRGASNNSNMARVDLRIGGQNR
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           TQPMQATWNPAGYMRNVVEATRVIA---------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:2170
query           GTTTVNSDGTWSFTPQTPLANGSHTFTLSATDPAGNSSAVSSGFVLTIDATPPAAPVIASVADNTAPVTG
3cu7A           AVTVIESTGGFSEEAEIPGVLSPYKLNLVATPLFLKPGIPYPIKVQVKDSLDQL-VGGVPVTLNAQTIDV
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           AYFEVKEYVLPHFPEYNFINFKNFEITIKARYFYNKVVTEADVYITFGIREDL--KDDQKEMMQTAMQNT
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           SFVEPRVGGGQLANGAMGNARWRGVPLKAVLEKAGVQAGAKQVTFGGLDGPVIPETPDFVKALSIDHATD
3dyoA           ETQVASGTAPFGGEIIDERGGYADRVTLRLNVENPKSAEIPNLYRAVVELHTADGTLIEAEACDVGFREV
1dabA           ----------------------------------------------------------ATIRRGDALAGG
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           YKGAMMDMVRGREISRSYAQDHAVGHGIVASIPAPHAAAFKQIAKRVIQEDTFSSFYGDVSTDTIRLAKA
2a9aB           ----------------------------------------------------------------------
4cgtA           VVTIDGRGFGSTKGTVYFGTTAVTGAAITSWEDTQIKVTIPSVAAGNYAVKVAASGVNSNAYNNFTILTG
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           RGWYTGAGATYLYNQDLAQYSEDYWPTVDAYRIPGTTVASGTPIASGTGTSSWTGGVSLAGQYGASGMDL
2ca3A           ----------------------------------------------------------------------
1cguA           PVMGKPGNVVTIDGRGFGSTKGTVYFGTTAVTGAAITSWEDTQIKVTIPSVAAGNYAVKVAASGVNSNAY
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           AVSPDESPSHWQQNDYKGFSPCVDWDTVDYRTAPAIQELPVQSAVTQPRPGAA-------VPPGELTVKG
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           LVSRRNLVYQTIPQNFRFEAGKTYRVTFEYEAGSDNTYAFVVGKGEFQSGRRGTQASNLEHELPNTWTDS
2a9cA           ----------------------------------------------------------------------
2a9cA           ------------------------------------------------------------VPPGELTVKG
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           PPGRAWAWALWELTVPVE-AGTELEIVCKAVDSSYNVQPDSVAPIWNLRGVLSTAWHRVRV---------
2a9dA           ----------------------------------------------------------------------
3eb7C           QEKDSEVELPPETLDQPNYEAYSHRLNYVTFIRNPDVPVFSWTHRSADRTNTVYSDKITQIPVVKASDGP
3cu7B           ----------------------------------------------------------------------
1cygA           ---------TVKFGTTAANVVSWSNNQIVVAVPNVSPGKYNITVQSSSGQTSAAYDNFEVLTNDQVSVRF
2b39A           VILQSGSDMVEAERTGIPIVTSPYQIHFTKTPKFFKPAMPFDLYVTNPDGSPARVVTQGSNVQSLTQDDG
3dyoA           ----------------------------------------------------------------------
2dckA           GTFYFGDQYPAYTINNINHGIGNQLVELIVTADDGT----------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ------------------------------------------------------------VPPGELTVKG
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           -ITIDGRGFGTTSGQVLFGSTAGTIVSWDDTEVKVKVPSVTPGKYNISLKTSSGATSNTYNNINILTGNQ


                         .         .         *         .         .         .         .:2240
query           IVPNGGSTNETRPTLSGTGEAGTTISIYNGSALVGTAQVQANGSWSFTPSTSLGAGVWNLTATATDAAGN
3cu7A           NQETSDLDPSKSVTRVDDGVASFVLNLPSGVTVLEFNVKTDAPDLPEENQAREGYRAIAYSSLSQSYLYI
3ecqB           ------------------------------------------------------------YVGVDNRSNA
2dcjA           ----------------------------------GNMSINYGATYNPNGNSYLTVYGWTVDPLVEFYIVD
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           MLINGIAQVTFDSETAVKELSYYSLEDLNNKYLYIAVTVIESTGEAEIPGIKYVLSPYKLNLVATPLFLK
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           GEVMLAYSMNGADL---------PWLNGYPLRLVVPGYYGTYWVKHLNEITVIDKEFDGFWMKTAYRIPD
3dyoA           RIENG-----------------------------------------------------------------
1dabA           AVPGGAVPGGAVPGGFGPGGFGPVLDGWYGVDVSGSSVELAQSIVEAPELGAAIRVGRGARVTVPGGSLS
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           IVDDPSIAPAAAPNLYKQYAAMDRAVLQRPGFALGLALYSTRISSYESINSENGRGWYTGAGATYLYNQD
2a9aB           ----------------------------------------------------------------------
4cgtA           DQVTVRFVVNNASTTLGQNLYLTGNVAELG-----NWSTGSTAIGPAFNQVIHQYPTWYYDVSVPAGKQL
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           SYGAYNLSARKSWFMFDDEIVALGSGISSTAGIPIETVVDNRKLNGAGDNAWTANGAALSTGLGVAQTLT
2ca3A           ----------------------------------------------------------------------
1cguA           NNFTILTGDQVTVRFVVNNASTTLGQNLYLTGNVAELGNWSTGSTAIGPAVIHQYPTWYYDVSVPAGKQL
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           YAWSGGGREVVRVDVSLDGGRTWKVARLMGDKA-PPGRAWAWALWELTVPVEAG-TELEIVCKAVDSSYN
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           KKAKKATFLVTGAETGDTWVGIYSTGNASNTRGDSGGNANFRGYNDFDNLQIEEITL----TGKLTENAL
2a9cA           ----------------------------------------------------------------------
2a9cA           YAWSGGGREVVRVDVSLDGGRTWKVARLMGDKA-PPGRAWAWALWELTVPVEA-GTELEIVCKAVDSSYN
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           KPSANEVGHYLGGDPISFNSSGSTGVIRLNINSPLSQKYRVRIRYCSSVDFDLDVVRGGTTVNNGRFNKS
3cu7B           ----------------------------------------------------------------------
1cygA           VVNNATTNLGQNIYIVGNVYELGNWDTSKAIGPMFNQVVYSYPTWYIDVSVPEGKTI-EFKFIKKDSQGN
2b39A           VANKRDPLTITVRTKKDNIPEGRQATRTMQALPYNTQGNSNNYLHLSVPRVELKPGTLNVNFHLRTDPGE
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           YAWSGGGREVVRVDVSLDGGRTWKVARLMGDKA-PPGRAWAWALWELTVPVEA-GTELEIVCKAVDSSYN
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ICVRFVVNNASTVYGENVYLTGNVAELGNWDTSKAIGPMFNQVVYQYPTWYY--------DVSVPAGTTI


                         +         .         .         .         .         *         .:2310
query           TSAASEIRSFTIDTTAPAAPVIDTVYDGTGPITGNLSSGQITDEARPVISGTRETNTTIRLYDNGTLLAE
3cu7A           DWTDNHKALLVGEHLNIIVTPKSPYIDKITHYNLILSKGKIIHFGTREKFSDASYQSINIPVTQYYIVTG
3ecqB           KASITVNTGEKEVTTYTNKSLALNYVKAYAHNTRRNNATVDDTSY-FQNYAFFTTGSDVSNVTLTLSREA
2dcjA           SWGTWRPPGGTPKGTINVDGGTYQIYETTRYNQPSIKGTATFQQYWSVRTSKRTSGTHFRAWESLGMNMG
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           PGIPYPIKVQVKDSLDQLVGGVPVTLNAQTIDVNQETSDLDPSKSVTRVDDGVASFVLNLPSGVTVLEFN
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           NACACTEPGKAPTATIPINRFDVRSFITNVENGASVKAGEVPLRGIAFDGGYGITQVSVSADAGKSWTNA
3dyoA           ----------------------------------------------------------------------
1dabA           APHGNVIETGGARRFAPQAAP-LSITLQAGAHAQGKALLYRVLPEPVKLTLTGGADAQGDIVATELPSIP
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           LAQYSEDYWPTVDAYRIPGTTVASGTPIASGTGTSSWTGGVSLAGQYGASGMDLSYGAYNLSARKSWFMF
2a9aB           ----------------------------------------------------------------------
4cgtA           EFKFFKKNGSTITWESGSNHTFTTPASGTATVTVN-----------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           GVNWVHLAGNTADGSDIGYYFPGGATLQTKREARTGTWKQINNRPATPSTAVTRNYETMWIDHGTNPSGA
2ca3A           ----------------------------------------------------------------------
1cguA           EFKFFKKNGSTITWESGSNHTFTTPASGTATVTVN-----------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           VQPDS--VAPIWNLRGVLSTAWHRV---------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           KNYLPTVAKEAVFNLSQADDDISVEEARAE----------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           VQ--PDSVAPIWNLRGVLSTAWHRV---------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           APNVGWQSLKYENFKFASFSTPFTFNQAQDTLKISVRNF-------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           VT-----------WESGSNHVYTTPTNTTGKIIVDWQ---------------------------------
2b39A           QAKIRYYTYMIMNKGKLLKVGRQYREPGQDLVVLPLTITSDFIPSFRLVAYYTLQREVVADSVWVDVKDS
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           VQPDS--VAPIWNLRGVLSTAWHRV---------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           QFKFIKKNGNTITWEGGSNHTYTVPSSSTGTVI-------------------------------------


                         .         .         .         +         .         .         .:2380
query           IPADNSSSWRYTPDASLATGNHVITVIAVDAAGNASPVSDSVNFVVDTTPPLTPVITSVSDDQAPGLGTI
3cu7A           EQTAELVSDSVWLNIEEKCGNQLQVHLSPDA--DAYSPGQTVSLNMATGMDSWVALAAVDSAVYGVQRGA
3ecqB           GDEATYFDEIRTFENNSSYGDKHDTGKGTFKQDFENVAQGIFPFVVGGVEGVEDNRTHLSEKHDPYTQRG
2dcjA           NMYEVALTVEGYQSSGSANVYTIGGQSGGEQATRVEAESMTKGGPYTSNITSPFNGVALYANGDNVSFNH
2a9dB           --------------------------------------------------------------------QP
3ecqA           -----------------HNTRRNNATVDDTSYFQNYAFFTTGSDVSNVTLTLSREAGDEATYFDEIRTFE
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------IQELPVQSAVTQPRPGAAVPPGEL
3eb7C           ----------------------------------------------------------------------
3cu7B           VKTDAPDLPEYRAIAYSSLSQSYLYIDWTDNHKALLVGEHLNIIVTPKSPYIDKITHYNYLILSKGKIIH
1cygA           --------VKFGTTAANVVSWSNNQIVVAVPNVSPGKYNITVQSSSGQTSAAYDNFEVLTNDQVSVRFVV
2b39A           ----------------------------------------------------------------------
2ca4A           PGLGKYSFRGWKAVLPLTKGDHVLMCRATNARGETQPMQATWNPAGYMRNVVEATRVIAA----------
3dyoA           ----------------------------------------------------------------------
1dabA           GTSIGPLDVALASQARWTGATRAVDSLSIDNATWVMTDNSNVGALRLASDGSVDFQQPAEAGRFKVLNVF
2dckA           --------------------------------------------------------------------NH
2a4eA           ------------------------------------------------SGWVWNQFFVIEEYTGPD--PV
2e24A           DDEIVALGSGISSTAGIPIETVVDN--------RKLNGAGDNAWTANGAALSTGLGVAQTLTGVNWVHLA
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           -----TIVSWDDTEVKVKVPSVTPGKYNISLKTSSGATSNTYNNINILTGNQICVRF-----------VV
2e22A           SYGYVLLPNKTSAQVGAYAADPAIEIVVNTSGVQSVKEKTLGLVGANFWTDTTQTADLITSNKKASVMTR
2ca3A           -----------------AMGNARWRGVPLKAVLEKAGVQAGAKQVTFGGLDTPDFVKALSIDHATDGEVM
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           CMGTLVVKNGGKEEKHHRPGQITLKIEADQGARVGLVAVDKGVFVLNKKNKLTQRKKADIGCTPGSGRNY
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           -----------------------------------------------------PRPGAAVPPGELTVKGY
2a9aB           ----------------------------------------------------------------------
4cgtA           ---LSTSASITGLSTSLPTGSYTDVLGGVLNGNNITSTNGSIN---NFTLAAGATAVWQYTTAETTPTIG
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ---GKYSFRGWKAVLPLTKGDHVLMCRATNARGETQPMQATWNPAGYMRNVVEATRVIAA----------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:2450
query           ANGQNTNDPTPTFSGTAEAGATITLYENGTVIGTTTAQPDGAWSVSTSTLASGTHVITAVATDAAGNSSP
3cu7A           KPLERVFQFLEKSDLGCGAGGGLNNANVFHLAGLTFLTNA------------------------------
3ecqB           WNGKKVDDVIEGNWSLK---TNGLVSRRNLVYQTIPQNFRFEAGKTYRVTFEYEAGSDNTYAFVVGKGEF
2dcjA           SFTKANSSFSLRGASNNSNMARVDLRIGGQNRGTFYFGDQYPAVINNINHGIGNQLVELIVTADDGTWDA
2a9dB           RPGAAVPPGELTVKGYAWSGGGREVVRMGDKAPPGRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQP
3ecqA           NNSSYGDKHDTGKGTFKQDFENVAQGIFPFVVGGVEGVEDNRTHLSEKHDPYTQRGWNGKKVDDVIEGNW
2a9cA           ----------------------------------------------------------------------
2a9dA           TAWSGGGREVVRVDVSLDGGRTWKVARMGDKAPPGRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQP
3eb7C           -----------------------------------------------------QPIGGSIQTQTYGTTSG
3cu7B           DASYQSINIPVTQNMVPSSRLLVYYIVTGSVWLNIEEKCGNQQTVSLNMATGMDSWVALAAVDSAVY--G
1cygA           NNATTNLGQNIYIVGNVYELGNWDTSKAIGPMFNQVVYSYPTWYIDVSVPEGKTIEFKFIKKDSQGNVTW
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ADLGLSDKLVVMQDASGQHRLWVRNSGSEPASANTLLLVQTPLGSAATFTLANKDGKVDIGTYRYRLAAN
2dckA           SFTKANSSFSLRGASNNSNMARVDLRIGGQNRGTFYFGDQYPATINNINHGIGNQLVELIVTADDGTWDA
2a4eA           LVGRLHSDID---SGDGNIKYILSGEGAGTIFVIDDKSGNIHATKTLDREERAQYTLMAQAVDRDTNRPL
2e24A           GNTADGSDIGYYFPGGATLQTKREARTGTWKQINNAPATPSTAVTRNYETMWIDHGTNPSGA-----SYG
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           --------TITIDGRGFGTTSGQVLFGSTAGTIVSWDDTEVKVKVPSVTPGKYNISLKTSSGATSNTYNN
3bmvA           NNASTVYGENVYLTGNVAELGNWDTSKAIGPMFNQVVYQYPTWYYDVSVPAGTTIQFKFIKKNGNTITWE
2e22A           EIADERLEASVSDPTQANNGTIAIELARSAEGYSADPGITVTQLAPTIKFTVNVNGAKGKSFHASFQL--
2ca3A           LAYSMNGADLPWLNGYPLRLVVPGYYGTYWVKHLNEITVIDKEFDGFWMKTAYRIPDNACACTEPGKAPT
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           AGVFTDAGLTLKTSQGLETQQRADPQCPQSVQLMEKRMDKAGQYSS-------DLRKCCEDGMRDNPMKF
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           AWSGGGREVVRVDVSLDGGRTWKVARLMGDKAPPGRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQP
2a9aB           ----------------------------------------------------------------------
4cgtA           HVGPVMGKPGNVVTIDGRGFGSTKGTVYFGTTAVTGAAITSWEDTQIKVTIPSVAAGNYAVKVAASGVNS
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------VLPLTKGDHVLMCRATNARGETQP
1a47A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:2520
query           NSTAFTLTVDTTAPQTPILTSVVDDVAGGVTGNLANGQITNDNRPTLNGTAEAGSVVSIYDGDTLLGVTS
3cu7A           ----------------------------------------------------------------------
3ecqB           QSGRRGTQASNLEHELPNTWTDSKKAKKATFLVTGAETGDTWVGIYSTGNASNTRGDSGGNANFRGYNDF
2dcjA           YLDYLEI---------------------------------------------------------------
2a9dB           DSVAPIWNLRGVLSTAWHRVRVVQD---------------------------------------------
3ecqA           SLKTNGLVSRRNLVYQTIPQNFRFEAGKTYRVTFEYEAGSDNTYAFVVGKGEFQSGRRGTQASNLEHELP
2a9cA           ----------------------------------------------------------------------
2a9dA           DSVAPIWNLRGVLSTAWHRVRVVQD---------------------------------------------
3eb7C           SSVIATQQIGFTGFDVYKTLSTAGVLFAYTSKYYGVSKVVFDAIYPDNKYKTTFTYNPGSEGIGAQEKDS
3cu7B           VQRGAKKPLE------------------------------------------------------------
1cygA           ESGS---NHVYTTPTNTTGKIIV-----------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           GNGQWSLVGAKAPP--------------------------------------------------------
2dckA           Y---------------------------------------------------------------------
2a4eA           EPPSEFIVKVQDINDNPPEFLHEIYHANVPERSNVGTSVIQVTASDADDPTYGNSAKLVYSILEGQPYFS
2e24A           YVLLPNKTSAQVGAYAADPAIEIVVNTSGVQSVKEKTLGLVGANFWTDTTQTADLITSNKKASVMTREIA
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           INILTGNQICVRFVVNNASTVYGENVYLTGNVAEL----GNWDTSKAIGPMFNQVVYQYPTWYYDVSVPA
3bmvA           GGSNHTYTVPSSSTGTVIVN--------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ATIPINRFDVRSFITNVENGASVKAGEVPLRGIAFDG-----------GYGITQVSVSADAGKSWTNATL
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ---------------QPRPGAAVPPGELTVKGYAWSGGGREVVRVDVSLDGGRTWKVARLMGDKAPPGRA
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ------------------------------VTQPRPGAAVPPGELTVKGYAWSGGDVSLDGGRTWKVARL
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           PCQRRAQFILQGDACVKAFLDCCEYIT--QLRQQHSRDGALDD---------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           DSVAPIWNLRGVLSTAWHRVRVVQD---------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           NAYNNFTILTGDQVTVRFVVNNASTTLGQNLYLTGNVAELGNWSTGSTAIGPAFNQVIHQYPTWYYDVSV
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           MQATWNPAGYMRNVVEATRVIA------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:2590
query           ANASGAWSFTPTTGLNDGTRTLTVTATDPAGNVSPATSGFTIVVDTLAPTVPLITSIVDDVPNNTGAIGN
3cu7A           ----------------------------------------------------------------------
3ecqB           DNLQIEEITLTGKLTENALKNYLPTVATNYTKESDALKEAVFNLSQADDDI-------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           NTWTDSKKAKKATFLVTGAETGDTWVGIYSTGNASNTRGDSGGNANFRGYNNLQIEEITLTGKLTENALK
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           EVELPPETLDQPNYE-----AYSHRLNYVTFIRNPDVPVFSWTHRSADRTNTVYSDKITQIPVVKASDGP
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           VEAQTGIIRTALPNMDKEEYHVVIQAKDMGGHMGGLSGTTKVTI--------------------------
2e24A           DERLEASVSDPTQANNGTIAIELARSAEGYSADPGITVTQLAPTIKFTVNVNGAKGKSFHASFQLG----
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           GTTIQFKFIKKNGNTITWEGGSNHTYTVPSSSTGTVIVNWQ-----------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           DPGLGKYSFRGWKAVLKGDHVLMCRATNARGETQPMQATWNPYMRNVVEATRVIAA--------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           -WAWALWELTVPV-EAGTELEIVCKAVDSSYNVQPDSVAPIWLRGVLSTAWHRVRVSVQD----------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           MGDKAPWELTVPVEAG-TELEIVCKAVDSSYNVQPDSVAPIWNLRGVLSTAWHRVRVVQD----------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           PAGKQLKNGSTITWESGSNHTFTTPASGTA----------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:2660
query           GQSTNDTQPTLNGTAEANSAVSIFDNGALVATVNANASGNWSWTPTAALGQGSHAYXXXXXXXXXXXXXX
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           NYLPTVAKEAVFNLSQADDDISVEEARAEIAKI-------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           KPSANEVGHYLGGDPISFNSSGSTGVIRLNINSPLSQKYRVRIRYCSSVDFDLDV---------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:2730
query           XPSITIIVDTIAPGAPGNLVINATGNRVTGTAEAGSTVTITSETGVVLGTATADGTGSFTATLTxxxxxx
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           VRGGTTVNNGRFNKSAPNVGWQSLKYENFKFASFSTPFTFNQAQDTLKISVRNFSSIVGGSVVY------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:2800
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:2870
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:2940
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:3010
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:3080
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:3150
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:3220
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:3290
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:3360
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:3430
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:3500
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:3570
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:3640
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:3710
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:3780
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2dcjA           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
2ca4A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
1dabA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2e24A           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
2e22A           ----------------------------------------------------------------------
2ca3A           ----------------------------------------------------------------------
1cguA           ----------------------------------------------------------------------
3cu7A           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
3ecqB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
2a9dB           ----------------------------------------------------------------------
3ecqA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9cA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
2a9dA           ----------------------------------------------------------------------
3eb7C           ----------------------------------------------------------------------
3cu7B           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
2b39A           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2dckA           ----------------------------------------------------------------------
2a4eA           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
2a9aB           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
2c9xA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:3850
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cu7A           --------------------------------------------
3ecqB           --------------------------------------------
2dcjA           --------------------------------------------
2a9dB           --------------------------------------------
3ecqA           --------------------------------------------
2a9cA           --------------------------------------------
2a9dA           --------------------------------------------
3eb7C           --------------------------------------------
3cu7B           --------------------------------------------
1cygA           --------------------------------------------
2b39A           --------------------------------------------
2ca4A           --------------------------------------------
3dyoA           --------------------------------------------
1dabA           --------------------------------------------
2dckA           --------------------------------------------
2a4eA           --------------------------------------------
2e24A           --------------------------------------------
2a9aB           --------------------------------------------
4cgtA           --------------------------------------------
2c9xA           --------------------------------------------
1a47A           --------------------------------------------
3bmvA           --------------------------------------------
2e22A           --------------------------------------------
2ca3A           --------------------------------------------
1cguA           --------------------------------------------
3cu7A           --------------------------------------------
3ecqB           --------------------------------------------
3ecqB           --------------------------------------------
2a9dB           --------------------------------------------
2a9dB           --------------------------------------------
2a9dB           --------------------------------------------
2a9dB           --------------------------------------------
2a9dB           --------------------------------------------
3ecqA           --------------------------------------------
2a9cA           --------------------------------------------
2a9cA           --------------------------------------------
2a9cA           --------------------------------------------
2a9cA           --------------------------------------------
2a9cA           --------------------------------------------
2a9cA           --------------------------------------------
2a9dA           --------------------------------------------
2a9dA           --------------------------------------------
2a9dA           --------------------------------------------
2a9dA           --------------------------------------------
2a9dA           --------------------------------------------
3eb7C           --------------------------------------------
3cu7B           --------------------------------------------
1cygA           --------------------------------------------
2b39A           --------------------------------------------
3dyoA           --------------------------------------------
2dckA           --------------------------------------------
2a4eA           --------------------------------------------
2a9aB           --------------------------------------------
2a9aB           --------------------------------------------
4cgtA           --------------------------------------------
2c9xA           --------------------------------------------
2c9xA           --------------------------------------------
2c9xA           --------------------------------------------
2c9xA           --------------------------------------------
1a47A           --------------------------------------------