[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for sent8:ACF70211.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2ejmA.bssp"
#ERROR : Can't open dsspfile "2edgA.bssp"
#ERROR : Can't open dsspfile "1bdoA.bssp"
#ERROR : Can't open dsspfile "3bdoA.bssp"
#ERROR : Can't open dsspfile "1brwA.bssp"
#ERROR : Can't open dsspfile "3bg5B.bssp"
#ERROR : Can't open dsspfile "3b7mA.bssp"
#ERROR : Can't open dsspfile "3bg3A.bssp"
#ERROR : Can't open dsspfile "3bg5A.bssp"

## Summary of PDB Search
:396
    6e-06   9%  2ejmA  [x.x.x] METHYLCROTONOYL-COA CARBOXYLASE SUBUNIT ALPHA
    2e-05  15%  2edgA  [x.x.x] GLYCINE CLEAVAGE SYSTEM H PROTEIN
    3e-05  14%  1bdoA  [b.84.1 (2bdoA)] ACETYL-COA CARBOXYLASE
    1e-04  15%  3bdoA  [b.84.1] PROTEIN (ACETYL-COA CARBOXYLASE)
    1e-04  19%  1brwA  [a.46.2 - c.27.1 - d.41.3] PROTEIN (PYRIMIDINE NUCLEOSIDE
    1e-04  21%  3bg5B  [x.x.x] PYRUVATE CARBOXYLASE
    2e-04  10%  3b7mA  [x.x.x] CELLULASE
    3e-04  13%  3bg3A  [x.x.x] PYRUVATE CARBOXYLASE, MITOCHONDRIAL
    8e-04  24%  3bg5A  [x.x.x] PYRUVATE CARBOXYLASE
:396

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIWAWFGRLDEVSTGNGKVIPSSREQVLQSLD
2ejmA           ----------------------------------------------------------------------
2edgA           -------------------------------------------FTEKHEWITTEEGIGTVGISNFAQEAL
1bdoA           --------------------------------------------GQKVNVGDTLCIVEAMKMMNQIEADK
3bdoA           -----------------------------------------------QKVNVGDCIVEAMKMMNQIEADK
1brwA           ----------------------------------------------------TAAMWLGAGRAKKEDVID
3bg5B           --------------------------------------------------------TEAMKMETTIQAPF
3b7mA           ---------------------------------------LMIWLNNGDVMPIGSATVELAGATWEVWYAD
3bg3A           --------------------------------------------------------LSAMKMETVVTSPM
3bg5A           -------------------------------------------------------------METTIQAPF


                         .         .         *         .         .         .         .:140
query           GGILAQLTVREGDRVQANQIVARLDPTRLASNVGExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ejmA           ----------------------------------------------------------------------
2edgA           GDVVYCSLPEVGTKLKKQEEFGALESVKAASEL-------------------------------------
1bdoA           SGTVKAILVESGQPVEFDEPLVVIE---------------------------------------------
3bdoA           SGTVKAILVESGQPVEFDEPLVVIE---------------------------------------------
1brwA           LAVGIVLHKKIGDRVQKGEALATIHSNRPDVLDVK-----------------------------------
3bg5B           DGVIKQVTVNNGDTIATGDLLIEIE---------------------------------------------
3b7mA           NGAMNVISYVRTTPTTSVTELDLKAFI-------------------------------------------
3bg3A           EGTVRKVHVTKDMTLEGDDLILEIE---------------------------------------------
3bg5A           DGVIKQVTVNNGDTIATGDLLIEIE---------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ejmA           ----------------------------------------------------------------------
2edgA           ----------------------------------------------------------------------
1bdoA           ----------------------------------------------------------------------
3bdoA           ----------------------------------------------------------------------
1brwA           ----------------------------------------------------------------------
3bg5B           ----------------------------------------------------------------------
3b7mA           ----------------------------------------------------------------------
3bg3A           ----------------------------------------------------------------------
3bg5A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRLTVRSPVRGIVKNIQVTTIGGVIPPNGEMMEIVPVDD
2ejmA           --------------------------------QGGPLAPMTGTIEKVFVK-AGDKVKAGDSLMVMIA-MK
2edgA           ----------------------------------------------------------------------
1bdoA           ----------------------------------------------------------------------
3bdoA           ----------------------------------------------------------------------
1brwA           ----------------------------------------------------------------------
3bg5B           ----------------------------------------------------------------------
3b7mA           ----------------------------------------------------------------------
3bg3A           ----------------------------------------------------------------------
3bg5A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RLLIETRLSPRDIAFIHPGQRALVKITAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ejmA           MEHTIKSPKDGTVKKVFYREGAQANRHT------------------------------------------
2edgA           ----------------------------------------------------------------------
1bdoA           ----------------------------------------------------------------------
3bdoA           ----------------------------------------------------------------------
1brwA           ----------------------------------------------------------------------
3bg5B           ----------------------------------------------------------------------
3b7mA           ----------------------------------------------------------------------
3bg3A           ----------------------------------------------------------------------
3bg5A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ejmA           ----------------------------------------------
2edgA           ----------------------------------------------
1bdoA           ----------------------------------------------
3bdoA           ----------------------------------------------
1brwA           ----------------------------------------------
3bg5B           ----------------------------------------------
3b7mA           ----------------------------------------------
3bg3A           ----------------------------------------------
3bg5A           ----------------------------------------------