[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for sent8:ACF70405.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2bq1E.bssp"
#ERROR : Can't open dsspfile "3bu7A.bssp"
#ERROR : Can't open dsspfile "2a1sD.bssp"
#ERROR : Can't open dsspfile "2cu2A.bssp"
#ERROR : Can't open dsspfile "3ca8A.bssp"
#ERROR : Can't open dsspfile "3ca8B.bssp"
#ERROR : Can't open dsspfile "2atfA.bssp"
#ERROR : Can't open dsspfile "2d5hA.bssp"
#ERROR : Can't open dsspfile "3bbdA.bssp"
#ERROR : Can't open dsspfile "2ea7C.bssp"
#ERROR : Can't open dsspfile "3bu7B.bssp"
#ERROR : Can't open dsspfile "2b5hA.bssp"
#ERROR : Can't open dsspfile "3cgxA.bssp"
#ERROR : Can't open dsspfile "2c0zA.bssp"
#ERROR : Can't open dsspfile "1cauA.bssp"
#ERROR : Can't open dsspfile "3duvB.bssp"
#ERROR : Can't open dsspfile "2d5fB.bssp"
#ERROR : Can't open dsspfile "2eaaA.bssp"
#ERROR : Can't open dsspfile "2d40A.bssp"
#ERROR : Can't open dsspfile "3c3vA.bssp"
#ERROR : Can't open dsspfile "2e9qA.bssp"
#ERROR : Can't open dsspfile "2e3dB.bssp"
#ERROR : Can't open dsspfile "2d40B.bssp"
#ERROR : Can't open dsspfile "2ea7A.bssp"
#ERROR : Can't open dsspfile "3cjxE.bssp"
#ERROR : Can't open dsspfile "3d5nA.bssp"
#ERROR : Can't open dsspfile "2e3dA.bssp"
#ERROR : Can't open dsspfile "2ea7B.bssp"
#ERROR : Can't open dsspfile "2e8bA.bssp"
#ERROR : Can't open dsspfile "2eaaC.bssp"
#ERROR : Can't open dsspfile "2cv6A.bssp"
#ERROR : Can't open dsspfile "3cewA.bssp"
#ERROR : Can't open dsspfile "3cjxC.bssp"
#ERROR : Can't open dsspfile "2d5hD.bssp"
#ERROR : Can't open dsspfile "2cauA.bssp"
#ERROR : Can't open dsspfile "3ehkA.bssp"
#ERROR : Can't open dsspfile "2cavA.bssp"
#ERROR : Can't open dsspfile "1e5rA.bssp"
#ERROR : Can't open dsspfile "2eaaB.bssp"
#ERROR : Can't open dsspfile "2d5fA.bssp"
#ERROR : Can't open dsspfile "3cjxB.bssp"
#ERROR : Can't open dsspfile "1dzrA.bssp"
#ERROR : Can't open dsspfile "3cjxD.bssp"
#ERROR : Can't open dsspfile "1dgwA.bssp"
#ERROR : Can't open dsspfile "3d8vA.bssp"
#ERROR : Can't open dsspfile "2aacA.bssp"
#ERROR : Can't open dsspfile "2d5hB.bssp"
#ERROR : Can't open dsspfile "2d40C.bssp"
#ERROR : Can't open dsspfile "3bcwB.bssp"
#ERROR : Can't open dsspfile "3bcwA.bssp"
#ERROR : Can't open dsspfile "3ejkA.bssp"
#ERROR : Can't open dsspfile "3cjxF.bssp"
#ERROR : Can't open dsspfile "1cauB.bssp"
#ERROR : Can't open dsspfile "1e5sB.bssp"
#ERROR : Can't open dsspfile "3d98A.bssp"
#ERROR : Can't open dsspfile "3cjxA.bssp"
#ERROR : Can't open dsspfile "1e5rB.bssp"
#ERROR : Can't open dsspfile "2d5hF.bssp"
#ERROR : Can't open dsspfile "2d5hC.bssp"
#ERROR : Can't open dsspfile "2d5hE.bssp"
#ERROR : Can't open dsspfile "3d5nH.bssp"
#ERROR : Can't open dsspfile "3dj4A.bssp"
#ERROR : Can't open dsspfile "3d5nB.bssp"
#ERROR : Can't open dsspfile "3d5nE.bssp"
#ERROR : Can't open dsspfile "3brkX.bssp"
#ERROR : Can't open dsspfile "3d82A.bssp"
#ERROR : Can't open dsspfile "2d40D.bssp"
#ERROR : Can't open dsspfile "2arcA.bssp"
#ERROR : Can't open dsspfile "1e5kA.bssp"
#ERROR : Can't open dsspfile "3ebrA.bssp"
#ERROR : Can't open dsspfile "3d5nF.bssp"
#ERROR : Can't open dsspfile "3balA.bssp"
#ERROR : Can't open dsspfile "2ab4A.bssp"
#ERROR : Can't open dsspfile "2ehoB.bssp"
#ERROR : Can't open dsspfile "2arcB.bssp"
#ERROR : Can't open dsspfile "1acfA.bssp"
#ERROR : Can't open dsspfile "3d82B.bssp"
#ERROR : Can't open dsspfile "2e3dD.bssp"
#ERROR : Can't open dsspfile "2b8mA.bssp"
#ERROR : Can't open dsspfile "2araA.bssp"
#ERROR : Can't open dsspfile "2bnoA.bssp"
#ERROR : Can't open dsspfile "2dpwA.bssp"
#ERROR : Can't open dsspfile "3d5nI.bssp"
#ERROR : Can't open dsspfile "2bnnB.bssp"
#ERROR : Can't open dsspfile "1dgwX.bssp"
#ERROR : Can't open dsspfile "3d0jA.bssp"
#ERROR : Can't open dsspfile "2bnmA.bssp"
#ERROR : Can't open dsspfile "2e3dC.bssp"

## Summary of PDB Search
:478
    6e-61  11%  2bq1E  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE 2 ALPHA
    5e-45  10%  3bu7A  [x.x.x] GENTISATE 1,2-DIOXYGENASE
    8e-45  13%  2a1sD  [x.x.x] POLY(A)-SPECIFIC RIBONUCLEASE PARN
    1e-40  32%  2cu2A  [x.x.x] PUTATIVE MANNOSE-1-PHOSPHATE GUANYLYL
    2e-30  10%  3ca8A  [x.x.x] PROTEIN YDCF
    2e-28  11%  3ca8B  [x.x.x] PROTEIN YDCF
    6e-26  19%  2atfA  [x.x.x] CYSTEINE DIOXYGENASE TYPE I
    9e-26   8%  2d5hA  [x.x.x] GLYCININ A3B4 SUBUNIT
    4e-25  15%  3bbdA  [x.x.x] RIBOSOME BIOGENESIS PROTEIN NEP1-LIKE
    1e-24  20%  2ea7C  [x.x.x] 7S GLOBULIN-1
    2e-24  11%  3bu7B  [x.x.x] GENTISATE 1,2-DIOXYGENASE
    4e-24  15%  2b5hA  [x.x.x] CYSTEINE DIOXYGENASE TYPE I
    1e-23  11%  3cgxA  [x.x.x] PUTATIVE NUCLEOTIDE-DIPHOSPHO-SUGAR TRANSFERASE
    7e-23  12%  2c0zA  [x.x.x] NOVW
    1e-22  18%  1cauA  [b.82.1] CANAVALIN
    2e-22  10%  3duvB  [x.x.x] 3-DEOXY-MANNO-OCTULOSONATE CYTIDYLYLTRANSFERASE
    2e-22   7%  2d5fB  [x.x.x] GLYCININ A3B4 SUBUNIT
    2e-22  18%  2eaaA  [x.x.x] 7S GLOBULIN-3
    3e-22   8%  2d40A  [x.x.x] PUTATIVE GENTISATE 1,2-DIOXYGENASE
    5e-22  12%  3c3vA  [x.x.x] ARACHIN ARAH3 ISOFORM
    6e-22   8%  2e9qA  [x.x.x] 11S GLOBULIN SUBUNIT BETA
    7e-22  16%  2e3dB  [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    3e-21   9%  2d40B  [x.x.x] PUTATIVE GENTISATE 1,2-DIOXYGENASE
    4e-21  20%  2ea7A  [x.x.x] 7S GLOBULIN-1
    5e-21  18%  3cjxE  [x.x.x] PROTEIN OF UNKNOWN FUNCTION WITH A CUPIN-LIKE
    8e-21  10%  3d5nA  [x.x.x] Q97W15_SULSO
    1e-20  16%  2e3dA  [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    1e-20   9%  2ea7B  [x.x.x] 7S GLOBULIN-1
    2e-20  11%  2e8bA  [x.x.x] PROBABLE MOLYBDOPTERIN-GUANINE DINUCLEOTIDE
    2e-20  19%  2eaaC  [x.x.x] 7S GLOBULIN-3
    2e-20  19%  2cv6A  [x.x.x] SEED STORAGE PROTEIN
    2e-20  16%  3cewA  [x.x.x] UNCHARACTERIZED CUPIN PROTEIN
    3e-20  18%  3cjxC  [x.x.x] PROTEIN OF UNKNOWN FUNCTION WITH A CUPIN-LIKE
    3e-20   8%  2d5hD  [x.x.x] GLYCININ A3B4 SUBUNIT
    4e-20  20%  2cauA  [b.82.1 - b.82.1] PROTEIN (CANAVALIN)
    1e-19  14%  3ehkA  [x.x.x] PRUNIN
    1e-19  17%  2cavA  [b.82.1 - b.82.1] PROTEIN (CANAVALIN)
    2e-19  11%  1e5rA  [b.82.2] PROLINE OXIDASE
    3e-19  19%  2eaaB  [x.x.x] 7S GLOBULIN-3
    3e-19  14%  2d5fA  [x.x.x] GLYCININ A3B4 SUBUNIT
    4e-19  16%  3cjxB  [x.x.x] PROTEIN OF UNKNOWN FUNCTION WITH A CUPIN-LIKE
    4e-19  15%  1dzrA  [b.82.1] DTDP-4-DEHYDRORHAMNOSE 3,5-EPIMERASE
    7e-19  18%  3cjxD  [x.x.x] PROTEIN OF UNKNOWN FUNCTION WITH A CUPIN-LIKE
    1e-18  19%  1dgwA  [b.82.1] CANAVALIN
    2e-18  13%  3d8vA  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    2e-18   7%  2aacA  [b.82.4] ARAC
    2e-18   8%  2d5hB  [x.x.x] GLYCININ A3B4 SUBUNIT
    3e-18   9%  2d40C  [x.x.x] PUTATIVE GENTISATE 1,2-DIOXYGENASE
    3e-18  12%  3bcwB  [x.x.x] UNCHARACTERIZED PROTEIN
    4e-18  12%  3bcwA  [x.x.x] UNCHARACTERIZED PROTEIN
    7e-18  10%  3ejkA  [x.x.x] DTDP SUGAR ISOMERASE
    8e-18  16%  3cjxF  [x.x.x] PROTEIN OF UNKNOWN FUNCTION WITH A CUPIN-LIKE
    9e-18  16%  1cauB  [b.82.1] CANAVALIN
    9e-18  11%  1e5sB  [b.82.2] PROLINE OXIDASE
    1e-17  19%  3d98A  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    1e-17  17%  3cjxA  [x.x.x] PROTEIN OF UNKNOWN FUNCTION WITH A CUPIN-LIKE
    2e-17  12%  1e5rB  [b.82.2] PROLINE OXIDASE
    3e-17  15%  2d5hF  [x.x.x] GLYCININ A3B4 SUBUNIT
    5e-17   8%  2d5hC  [x.x.x] GLYCININ A3B4 SUBUNIT
    5e-17   8%  2d5hE  [x.x.x] GLYCININ A3B4 SUBUNIT
    6e-17   9%  3d5nH  [x.x.x] Q97W15_SULSO
    8e-17  19%  3dj4A  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    8e-17   9%  3d5nB  [x.x.x] Q97W15_SULSO
    8e-17   7%  3d5nE  [x.x.x] Q97W15_SULSO
    1e-16  15%  3brkX  [x.x.x] GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE
    2e-16  20%  3d82A  [x.x.x] CUPIN 2, CONSERVED BARREL DOMAIN PROTEIN
    3e-16  11%  2d40D  [x.x.x] PUTATIVE GENTISATE 1,2-DIOXYGENASE
    4e-16   7%  2arcA  [b.82.4] ARABINOSE OPERON REGULATORY PROTEIN
    8e-16  13%  1e5kA  [c.68.1] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
    8e-16  15%  3ebrA  [x.x.x] UNCHARACTERIZED RMLC-LIKE CUPIN
    1e-15   9%  3d5nF  [x.x.x] Q97W15_SULSO
    3e-15   7%  3balA  [x.x.x] ACETYLACETONE-CLEAVING ENZYME
    7e-15  18%  2ab4A  [x.x.x] TRNA PSEUDOURIDINE SYNTHASE B
    7e-15  11%  2ehoB  [x.x.x] DNA REPLICATION COMPLEX GINS PROTEIN PSF1
    4e-14   8%  2arcB  [b.82.4] ARABINOSE OPERON REGULATORY PROTEIN
    7e-14  13%  1acfA  [x.x.x] PROFILIN I
    8e-14  18%  3d82B  [x.x.x] CUPIN 2, CONSERVED BARREL DOMAIN PROTEIN
    9e-14  15%  2e3dD  [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    1e-13  16%  2b8mA  [x.x.x] HYPOTHETICAL PROTEIN MJ0764
    4e-12   7%  2araA  [x.x.x] ARAC
    4e-12  10%  2bnoA  [x.x.x] EPOXIDASE
    8e-12  16%  2dpwA  [x.x.x] HYPOTHETICAL PROTEIN TTHA0179
    1e-11  10%  3d5nI  [x.x.x] Q97W15_SULSO
    3e-11  13%  2bnnB  [x.x.x] EPOXIDASE
    6e-11  17%  1dgwX  [b.82.1] CANAVALIN
    2e-10  12%  3d0jA  [x.x.x] UNCHARACTERIZED PROTEIN CA_C3497
    4e-09  11%  2bnmA  [x.x.x] EPOXIDASE
    3e-06  23%  2e3dC  [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
:478

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRQTKLYPVVMAGGSGSRLWPLSRVLYPKQFLCLKGDLTMLQTTICRLNGVECESPVVICNEQHRFIVAE
2bq1E           ----------------------------------------------------------------------
3bu7A           ----------------------------------------------------------------------
2a1sD           ----------------------------------------------------------------------
2cu2A           ----KTYALVMAGGRGERLWPLSREDRPKPFLPLFEGKTLLEATLERLAPLVPPERTLLAVRRDQEAVAR
3ca8A           ----QADCVILAGNAVMPTIDAACKIARDQQIISGGIGHSTTFLYSAIAQHPHYNTIRTTRAEATILADI
3ca8B           EVPYQADCVILAGNAVMPTIDAACKIARDQQIISGGIGHSTTFLYSAIAQHPHYNTIRTGRAEATILADI
2atfA           ----------------------------------------------------------------------
2d5hA           ----------------------------------------------------------------------
3bbdA           ----------------------------------------------------------------------
2ea7C           ----------------------------------------------------------------------
3bu7B           ----------------------------------------------------------------------
2b5hA           ----------------------------------------------------------------------
3cgxA           --CILFFVKYPEPGVKTRLGEV-----VGNDKAA-LYRHFVQDLQGLARLHADLHICYVPGDADLPEKFK
2c0zA           ----------------------------------------------------------------------
1cauA           ----------------------------------------------------------------------
3duvB           -----FTVIIPARFASSRLPG-------KPLADI-KGKPIQHVFEKALQ-SGASRVIIATDNENVADVAK
2d5fB           ----------------------------------------------------------------------
2eaaA           ----------------------------------------------------------------------
2d40A           ----------------------------------------------------------------------
3c3vA           ----------------------------------------------------------------------
2e9qA           ----------------------------------------------------------------------
2e3dB           --------VIPVAGLGTRMLPATKA-IPKEMLPL-VDKPLIQYVVNECIAAGITEIVLVTHSSKNSIEND
2d40B           ----------------------------------------------------------------------
2ea7A           ----------------------------------------------------------------------
3cjxE           ----------------------------------------------------------------------
3d5nA           -----IGVIILAAGEGKRFGG------DKLLAKI-DNTPIIRTIRIYG----DLEKIIIVGKYVNELPLL
2e3dA           --------VIPVAGLGTRMLPATKAI-PKEMLPL-VDKPLIQYVVNECIAAGITEIVLVTHSSKNSIENH
2ea7B           ----------------------------------------------------------------------
2e8bA           ----VNTCYVLAGGKSKRFGE------DKLLYEI-KGKKVIERVYETAKSVFKE-VYIVAKDREKFSFLN
2eaaC           ----------------------------------------------------------------------
2cv6A           ----------------------------------------------------------------------
3cewA           ----------------------------------------------------------------------
3cjxC           ----------------------------------------------------------------------
2d5hD           ----------------------------------------------------------------------
2cauA           ----------------------------------------------------------------------
3ehkA           ----------------------------------------------------------------------
2cavA           ----------------------------------------------------------------------
1e5rA           ----------------------------------------------------------------------
2eaaB           ----------------------------------------------------------------------
2d5fA           ----------------------------------------------------------------------
3cjxB           ----------------------------------------------------------------------
1dzrA           ----------------------------------------------------------------------
3cjxD           ----------------------------------------------------------------------
1dgwA           ----------------------------------------------------------------------
3d8vA           ----DTAVLVLAAGPGTRMRS----DTPKVLHTL-AGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPL
2aacA           ----------------------------------------------------------------------
2d5hB           ----------------------------------------------------------------------
2d40C           ----------------------------------------------------------------------
3bcwB           ----------------------------------------------------------------------
3bcwA           ----------------------------------------------------------------------
3ejkA           ----------------------------------------------------------------------
3cjxF           ----------------------------------------------------------------------
1cauB           ----------------------------------------------------------------------
1e5sB           ----------------------------------------------------------------------
3d98A           FPG-DTAVLVLAAGPGTRMRS----DTPKVLHTL-AGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPL
3cjxA           ----------------------------------------------------------------------
1e5rB           ----------------------------------------------------------------------
2d5hF           ----------------------------------------------------------------------
2d5hC           ----------------------------------------------------------------------
2d5hE           ----------------------------------------------------------------------
3d5nH           -----IGVIILAAGEGDKLLKI-------------DNTPIIRTIRIYG----DLEKIIIVGKYVNELPLL
3dj4A           -----TAVLVLAAGPGTRMRS----DTPKVLHTL-AGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPL
3d5nB           -----IGVIILAAG-------------DKLLAKIDNT-PIIRTIRIYG----DLEKIIIVGKYVNELPLL
3d5nE           -----IGVIILAAGEDKLLAKI-------------DNTPIIRTIRIYG----DLEKIIIVGKYVNELPLL
3brkX           ---ARDAAYVLAGGRGSRLKELTDRRAK-PAVYFGGKARIIDFALSNALNSGIRRIGVATQIRHLQRGWD
3d82A           ----------------------------------------------------------------------
2d40D           ----------------------------------------------------------------------
2arcA           ----------------------------------------------------------------------
1e5kA           ---TTITGVVLAGGKARRMGG-----VDKGLLEL-NGKPLWQHVADALMTQLSHVVVNANRHQEIYQAS-
3ebrA           ----------------------------------------------------------------------
3d5nF           -----IGVIILAAG-------------DKLLAKI-DNTPIIRTIRIYG----DLEKIIIVGKYVNELPLL
3balA           ----------------------------------------------------------------------
2ab4A           ----------------------------------------------------------------------
2ehoB           ----------------------------------------------------------------------
2arcB           ----------------------------------------------------------------------
1acfA           ----------------------------------------------------------------------
3d82B           ----------------------------------------------------------------------
2e3dD           --------VIPVAGLGTRMLPATKA-IPKEMLPL-VDKPLIQYVVNECIAAGITEIVLVTHSSKNSIEND
2b8mA           ----------------------------------------------------------------------
2araA           ----------------------------------------------------------------------
2bnoA           ----------------------------------------------------------------------
2dpwA           ----RPSAIVLAGGKEAWAERFGV--GSKALVPY-RGRPVEWVLEALYAAG-LSPVYVGENPGLVPAPAL
3d5nI           ------------------------ILAAKLLAKI-DNTPIIRTIRIYG----DLEKIIIVGKYVNELPLL
2bnnB           ----------------------------------------------------------------------
1dgwX           ----------------------------------------------------------------------
3d0jA           ----------------------------------------------------------------------
2bnmA           ----------------------------------------------------------------------
2e3dC           --------VIPVAGLGTRMLPATKAI-PKEMLPL-VDKPLIQYVVNECIAAGITEIVLVTHSSKNSI---


                         .         .         *         .         .         .         .:140
query           QLRQLNKLTENIILEPAGRNTXXXXXXXXXXXTRQHTDCDPLMLVLAADHAIANEEAFRDAVRGAMPYAD
2bq1E           -----------------------------------YHALNAMLNLYDKAGHIQFDKDQQAIDA-FFATHV
3bu7A           ----------------------------------------------------------------------
2a1sD           -----------------------------------------------------IRSNFKSNLHKVYQAIE
2cu2A           PYADGI----RLLLEPLGRDTAGAVLLGVAEALKEGAER---LLVLPADHYVGDDEAYREALATMLEAAE
3ca8A           AHQFWHIPHEKIWIEDQSTNCGENARFSIALLNQAVERVHTAIVVQDPTMQRRTMATFRRMTGDNPDAPR
3ca8B           AHQFWHIPHEKIWIEDQSTNCGENARFSIALLNQAVERVHTAIVVQDPTMQRRTMATFRRMTGDNPDAPR
2atfA           ----------------------------------------------------------------------
2d5hA           ----------------------------------------------------------------------
3bbdA           --------TYNIILAKSALELIPEEIKNKIR----KSRVYKYDILDSNYHYKA--EKLKDKERGR-PDII
2ea7C           ----------------------------------------------------------------------
3bu7B           ----------------------------------------------------------------------
2b5hA           ----------------------------------------------------------------------
3cgxA           AWLGPQHFAAQ---QGLDLGE--------RKHAQKAFDDGYDRVVLGSDIPDYPCELVQKALN---DLQH
2c0zA           ----------------------------------------------------------------------
1cauA           ----------------------------------------------------------------------
3duvB           SFG-------AEVCTSVNHNSGTERLAEVVEKLAIPDNEI--IVNIQGDEPLIPPVIVRQVADNLAKFNV
2d5fB           ----------------------------------------------------------------------
2eaaA           ----------------------------------------------------------------------
2d40A           ----------------------------------------------------------------------
3c3vA           ----------------------------------------------------------------------
2e9qA           ----------------------------------------------------------------------
2e3dB           EVQSICPPHVTIMQVRQGKGLGHAVLCA-----HPVVGDEPVAVILPDVILDEYESDLQDNLAEMIRRFD
2d40B           ----------------------------------------------------------------------
2ea7A           ----------------------------------------------------------------------
3cjxE           ----------------------------------------------------------------------
3d5nA           DQIVIYNPFWNEGISTSLKLG------------LRFFKDYD-AVLVALGDPFVTKEDVNKIINTFKPNCK
2e3dA           FDTEVQSICPPHVTIMQVRQGLAKGLGHAVLCAHPVVGDEPVAVILPDVILDEYESDLSQDNLAEMIRFD
2ea7B           ----------------------------------------------------------------------
2e8bA           APVVLDEFEESASIIGLYTA--------------LKHAKEENVFVLSGDLPLMKKETVLYVLE---NFKE
2eaaC           ----------------------------------------------------------------------
2cv6A           ----------------------------------------------------------------------
3cewA           ----------------------------------------------------------------------
3cjxC           ----------------------------------------------------------------------
2d5hD           ----------------------------------------------------------------------
2cauA           ----------------------------------------------------------------------
3ehkA           ----------------------------------------------------------------------
2cavA           ----------------------------------------------------------------------
1e5rA           ----------------------------------------------------------------------
2eaaB           ----------------------------------------------------------------------
2d5fA           ----------------------------------------------------------------------
3cjxB           ----------------------------------------------------------------------
1dzrA           ----------------------------------------------------------------------
3cjxD           ----------------------------------------------------------------------
1dgwA           ----------------------------------------------------------------------
3d8vA           VGELADTLTIDVALQDRPLGTGHAVLCGLSAL---PDDYAGNVVVTSGDTPLLDADTLADLI---ATHRA
2aacA           ----------------------------------------------------------------------
2d5hB           ----------------------------------------------------------------------
2d40C           ----------------------------------------------------------------------
3bcwB           ----------------------------------------------------------------------
3bcwA           ----------------------------------------------------------------------
3ejkA           ----------------------------------------------------------------------
3cjxF           ----------------------------------------------------------------------
1cauB           ----------------------------------------------------------------------
1e5sB           ----------------------------------------------------------------------
3d98A           VGELADTLGRTVALQDRPLGTGHAVLCGLSAL---PDDYAGNVVVTSGDTPLLDADTLADLIATHR-AVS
3cjxA           ----------------------------------------------------------------------
1e5rB           ----------------------------------------------------------------------
2d5hF           ----------------------------------------------------------------------
2d5hC           ----------------------------------------------------------------------
2d5hE           ----------------------------------------------------------------------
3d5nH           DQIV-------IYNPFWNEGISTSLKLGLRFF------KDYDAVLVALGDPFVTKEDVNKIINTFKPNCK
3dj4A           VGEDTLGRTIDVALQDRPLGT---GHAVLCGLSALPDDYAGNVVVTSGDTPLLDADTLADLI---ATHRA
3d5nB           DQIV-------IYNPFWNEGISTSLKLG-----LRFFKDYDAVLVALGDPFV--TKEDVNKIINTFKPNC
3d5nE           DQI-------VIYNPFWNEGISTSLKLG-----LRFFKDYDAVLVALGDPFV--TKEDVNKIINTFK-PN
3brkX           FFRPERNESFDILPASWYEGTADAVYQNI----DIIEPYAPEYVILAGDHIYKDYEYLQQHV------DS
3d82A           ----------------------------------------------------------------------
2d40D           ----------------------------------------------------------------------
2arcA           ----------------------------------------------------------------------
1e5kA           ------GLKVIEDSLADYPGPLAGMLSV-----MQQEAGEW-FLFCPCDTPYIPPDLAARLNH-----QR
3ebrA           ----------------------------------------------------------------------
3d5nF           DQIVIYNPFWNEGISTSLKLG------------LRFFKDYDAVLVAL-GDPFVTKEDVNKIINTFKPNCK
3balA           ----------------------------------------------------------------------
2ab4A           ----------------------------------------------------------------------
2ehoB           ----------------------------------------------------------------------
2arcB           ----------------------------------------------------------------------
1acfA           ----------------------------------------------------------------------
3d82B           ----------------------------------------------------------------------
2e3dD           EVQSICPPHVTIMQVRQGKGLGHAVLCA-----HPVVGDEPVAVILPDVILDEYESDLQDNLAEMIRRFD
2b8mA           ----------------------------------------------------------------------
2araA           ----------------------------------------------------------------------
2bnoA           ----------------------------------------------------------------------
2dpwA           TLPDRGGLLENLALEH---------------------VEGR-VLVATGDIPHLTEEAVRFVLD---KAPE
3d5nI           DQIVIYNPFWNEGISTSLKLG------------LRFFKDYDAVLVALGDP-FVTKEDVNKIINTFKPNCK
2bnnB           ----------------------------------------------------------------------
1dgwX           ----------------------------------------------------------------------
3d0jA           ----------------------------------------------------------------------
2bnmA           ----------------------------------------------------------------------
2e3dC           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AGKLVTFGIVPDLPETGYGYIRRGDVVPGATDAVAFEVAQFVEKPGLETAQAYVASGDYYWNSGMFLFRA
2bq1E           RPHSVTFASQHERLGTLVREGYYDDAVLARYDFEHAHASGFRFQTFLGAWKFYTFDGKRYLEHDRVTMVA
3bu7A           -------------------YYDDLAKIETG--ALWTVANDIEPWEPTPKSA------PVHWKWSDEVLRA
2a1sD           EADFFA----IDGEFSGISDGPGFDTPEERYQKLKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYV--
2cu2A           EGFVVALGLRPTRPETEYGYIRLGPREGA-----WYRGEGFVEKPSYAEALEYIRKG-YVWNGGVFAFAP
3ca8A           WLSYPGF--VPQLGNNADSVIFINQ--LQGLWPVERYLSLLTGELLRDDSDGYGPRG-RDFIVHVDFPAE
3ca8B           WLSYPGF--VPQLGNNADSVIFINQL------QGLWPVERYLSLLTGELPRLRDDSDGYGPRGRDFIVHV
2atfA           ----------------------------------------------------------------------
2d5hA           ----------------------------------------------------------------------
3bbdA           HISLLNILDSPINHEKKLNIYIHTY---------DDKVLKINPETRLPRNY-FRFLGVEKVLKGER----
2ea7C           ----------------------------------------------------------------------
3bu7B           ----------------------------------------------------------------------
2b5hA           ----------------------------------------------------------------------
3cgxA           YDAAIGPAFDGGYYLIGFRKDSFCPDVFDGIRWGEADVYQ--PTVEKRRARLEVLQLPDWNDVDTVLNVL
2c0zA           ----------------------------------------------------------------------
1cauA           ----------------------------------------------------------------------
3duvB           NASLAVKIHDAEELFNPNAVKVLTDKDGYVLYFSRSVIPYDRDQFNLQDVQKVQLSDAYLRHIGIYAYR-
2d5fB           ----------------------------------------------------------------------
2eaaA           ----------------------------------------------------------------------
2d40A           ----------------------------------------------------------------------
3c3vA           ----------------------------------------------------------------------
2e9qA           ----------------------------------------------------------------------
2e3dB           ETGHSQIMVEPVADVTAYGVVDCKGV--ELAPGESVPMVGVVEKPKADVAPSNAIVGRYVLSADIWPLLA
2d40B           ----------------------------------------------------------------------
2ea7A           ----------------------------------------------------------------------
3cjxE           ----------------------------------------------------------------------
3d5nA           A--VIPTHKGERGNPVLISKSLFNEIEKLRGD---VGARVILNKIKIEELCFIECSEGVLID--------
2e3dA           ETGHSQIMVEPVADVTAYGVVDCKGVELAPGES--VPMVGVVEKPKADVAPSN------LAIVGRYVLSA
2ea7B           ----------------------------------------------------------------------
2e8bA           PVSVAKTEKL----HTLVGVYSKKEKIEERIKKGDYRIWALLKDVGYNEVEIPEELRYTLLN--------
2eaaC           ----------------------------------------------------------------------
2cv6A           ----------------------------------------------------------------------
3cewA           ----------------------------------------------------------------------
3cjxC           ----------------------------------------------------------------------
2d5hD           ----------------------------------------------------------------------
2cauA           ----------------------------------------------------------------------
3ehkA           ----------------------------------------------------------------------
2cavA           ----------------------------------------------------------------------
1e5rA           ----------------------------------------------------------------------
2eaaB           ----------------------------------------------------------------------
2d5fA           ----------------------------------------------------------------------
3cjxB           ----------------------------------------------------------------------
1dzrA           ----------------------------------------------------------------------
3cjxD           ----------------------------------------------------------------------
1dgwA           ----------------------------------------------------------------------
3d8vA           VSAAVTVLTTTLDDPFGYGRILRTQ---------DHEVMAIVEQTDATPSQREI----REVNAGVYAFDI
2aacA           ----------------------------------------------------------------------
2d5hB           ----------------------------------------------------------------------
2d40C           ----------------------------------------------------------------------
3bcwB           ----------------------------------------------------------------------
3bcwA           ----------------------------------------------------------------------
3ejkA           ----------------------------------------------------------------------
3cjxF           ----------------------------------------------------------------------
1cauB           ----------------------------------------------------------------------
1e5sB           ----------------------------------------------------------------------
3d98A           AAVTVLTTTLDD--PFGYGRILRTQ---------DHEVMAIVEQTDATPSQREI----REVNAGVYAFDI
3cjxA           ----------------------------------------------------------------------
1e5rB           ----------------------------------------------------------------------
2d5hF           ----------------------------------------------------------------------
2d5hC           ----------------------------------------------------------------------
2d5hE           ----------------------------------------------------------------------
3d5nH           A--VIPTHKGERGNPVLISKSLFNEIEKL-----RGDVGARVILNKIKIEELCF----IECSEGVLID--
3dj4A           VSAAVTVLTTTLDDPFGYGRILRTQ---------DHEVMAIVEQTDATPSQREI----REVNAGVYAFDI
3d5nB           KAVIPTHKGERGNP-VLISKSLFNEIEKLRGD---VGARVILNKIKIEELCFIECSEGVLID--------
3d5nE           CKAVIPTHKGERGNPVLISKSLFNEI---EKLRGDVGARVILNKIKIEELCFIECSEGVLID--------
3brkX           GADVTIGCLEVPREATGFGVHVNEK----------DEIIDFIEKP--ADPPGIPGNEGFALASGIYVFHT
3d82A           ----------------------------------------------------------------------
2d40D           ----------------------------------------------------------------------
2arcA           ----------------------------------------------------------------------
1e5kA           KDAPVVWVHDGERDHPTIALVNRAIE---------PLLLEYLQAGERRVMVDFSDHKDAFVNVN------
3ebrA           ----------------------------------------------------------------------
3d5nF           A--VIPTHKGERGNPVLISKSLFNEIEKLRGD---VGARVILNKIKIEELCFIECSEGVLID--------
3balA           ----------------------------------------------------------------------
2ab4A           ----------------------------------------------------------------------
2ehoB           --------IRELHRAPEGQLPAFNE---------DGLRQVLEEKALYEQNQSDVNEAKSGGRSDLIPTIK
2arcB           ----------------------------------------------------------------------
1acfA           ----------------------------------------------------------------------
3d82B           ----------------------------------------------------------------------
2e3dD           ETGHSQIMVEPVADVTAYGVVDCKG----------VELAPGESVPMVGVVEP-----SNLAIVGRYV---
2b8mA           ----------------------------------------------------------------------
2araA           ----------------------------------------------------------------------
2bnoA           ----------------------------------------------------------------------
2dpwA           AALVYPIVPKEAVEARFPRTKRTYAR--LREGTFTGGNLLLLDKS-------------------------
3d5nI           A--VIPTHKGERGNPVLISKSLFNEIEKLRGD---VGARVILNKIKIEELCFIECSEGVLID--------
2bnnB           ----------------------------------------------------------------------
1dgwX           ----------------------------------------------------------------------
3d0jA           ----------------------------------------------------------------------
2bnmA           ----------------------------------------------------------------------
2e3dC           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GRYLEELKKFRPDILAACEQAMRGVDPDLDFIRVDEEAFLACPEESIDYAVMERTADAVVMPMDAGWSDV
2bq1E           LTLAQGDETLATQLTEMLSGRFQPATPTFLNCGKQQRGFLLRIEDNME-SIGRAVNSALQLSKRGGGVAF
3bu7A           IDLVRPEDAGRRVVYLRNPQRKDVSAACGWLFS----GIQTMKASALRFIMEGSGAKVELGANDFVLTPN
2a1sD           --FPKPFNRSSPDVKFVCQSS------SIDFLASQGFDFNKVFRNGIPYLNQEEELRPVTIPEDQKKDQV
2cu2A           ATMAELFRRHLPSHHEALE--------RLLAGASLEEVYAGLPKISIDYGVMEKAERVRVVLGRFPWDDV
3ca8A           WQTLKHDAVLIE----------------------------------------------------------
3ca8B           DFPAEVIHAWQT----------------------------------------------------------
2atfA           ----------------------------------------------------------------------
2d5hA           -----------------------------------------GDEPVVAISLLDTSNFNNQLDQNPRVFYL
3bbdA           -NHLIKEEKTLEDLLNEINAK---------KIAITKTGKLTHPKLLKEYDTFIIGGFPYGKLKINKEKVF
2ea7C           ----------------------------------------------------------------------
3bu7B           ---------------------------------------------ALRFIMEGSGAKVELGANDFVLTPN
2b5hA           ----------------------------------------------------------------------
3cgxA           YRTNKNSSFRRSSTYALLRENIRQYDID------------------------------------------
2c0zA           ----------------------------------------------------------------------
1cauA           ----------------------------------------------------------------------
3duvB           -----------AGFIKQYVQWAPTQLENLEKL-------------EQLRVLYNGERIHVELAKEVPAVGV
2d5fB           -----------------------------------------SNFNNQLDQNPRVFYLAGNPDIEHPETMQ
2eaaA           ----------------------------------------------------------------------
2d40A           ----------------------------------------------------------TPNEGDFILTPQ
3c3vA           ----------------------------------------------------------------------
2e9qA           ----------------------------------------------------------------------
2e3dB           KTQLTDAIDM-----------------------------------------LIEKETVEAYHMKGKSHDC
2d40B           ------------------------------------------------------DGERTPNEGDFILTPQ
2ea7A           ----------------------------------------------------------------------
3cjxE           ----------------------------------------------------------------------
3d5nA           ----------------------------------------------------------------------
2e3dA           D-IWPLLAKTPPEI-----------------------------QLTDAIDMLIEKETVEAYHMKGKSHDC
2ea7B           ----------------------------------------------------------------------
2e8bA           ----------------------------------------------------------------------
2eaaC           ----------------------------------------------------------------------
2cv6A           ----------------------------------------------------------------------
3cewA           ----------------------------------------------------------------------
3cjxC           ----------------------------------------------------------------------
2d5hD           ----------------------------------------------------------------------
2cauA           ----------------------------------------------------------------------
3ehkA           ----------------------------------------------------------------------
2cavA           ----------------------------------------------------------------------
1e5rA           ----------------------------------------------------------------------
2eaaB           ----------------------------------------------------------------------
2d5fA           ----------------------------------------------------------------------
3cjxB           ----------------------------------------------------------------------
1dzrA           ----------------------------------------------------------------------
3cjxD           ----------------------------------------------------------------------
1dgwA           ----------------------------------------------------------------------
3d8vA           AALRSALSRLSSYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTV
2aacA           ----------------------------------------------------------------------
2d5hB           ----------------------------------------------------------------------
2d40C           ----------------------------------------------------------TPNEGDFILTPQ
3bcwB           ----------------------------------------------------------------------
3bcwA           ----------------------------------------------------------------------
3ejkA           ----------------------------------------------------------------------
3cjxF           ----------------------------------------------------------------------
1cauB           ----------------------------------------------------------------------
1e5sB           ----------------------------------------------------------------------
3d98A           ----------------------------------------------------------------------
3cjxA           ----------------------------------------------------------------------
1e5rB           ----------------------------------------------------------------------
2d5hF           ----------------------------------------------------------------------
2d5hC           ----------------------------------------------------------------------
2d5hE           ----------------------------------------------------------------------
3d5nH           ----------------------------------------------------------------------
3dj4A           ----------------------------------------------------------------------
3d5nB           ----------------------------------------------------------------------
3d5nE           ----------------------------------------------------------------------
3brkX           KFLEAVRRDAADIIPYIVEHGKAVAHRFADSCVRSDFEHEPYWRDVGTIDAYWQANIDLTDVVPDLDIYD
3d82A           ----------------------------------------------------------------------
2d40D           ----------------------------------------------------------------------
2arcA           ----------------------------------------------------------------------
1e5kA           ----------------------------------------------------------------------
3ebrA           ----------------------------------------------------------------------
3d5nF           ----------------------------------------------------------------------
3balA           ----------------------------------------------------------------------
2ab4A           ----------------------------------------------------------------------
2ehoB           FRHCS----------------LLRNRRCTVAYLYDRLLRIRALRWEYGSILPNRFHAAEEEWFNNYKRSL
2arcB           ----------------------------------------------------------------------
1acfA           -------------------------------------------QTYVDTNLVGAVTQAAILGLDGNWATS
3d82B           ----------------------------------------------------------------------
2e3dD           ---------LSADIWPLLAKTGAGDEIQLTDA----------------IDMLIEKETVEAYHMKGKSHDC
2b8mA           ----------------------------------------------------------------------
2araA           ----------------------------------------------------------------------
2bnoA           ----------------------------------------------------------------------
2dpwA           ----------------------------------------------------------------------
3d5nI           ----------------------------------------------------------------------
2bnnB           ----------------------------------------------------------------------
1dgwX           ----------------------------------------------------------------------
3d0jA           ----------------------------------------------------------------------
2bnmA           ----------------------------------------------------------------------
2e3dC           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GSWSSLWEISAHTPEGNVHHGDVISHKTENSYVYAESXXXXXXXXXXXXXXQTKDAVLIADRHAVQDVKK
2bq1E           L-LSNLREAGAPIKRENQSSGVIPVMKMLEDAFSYANQGAGAVYLHAHHPDRFLDTKRIKTLSLGVVIPD
3bu7A           GTWHEHGILESGTECIWQDGLDIPLTNCLEANFYEPNDYQTTDIPLNDSPLTYGGPALLPQLDKWDKPYS
2a1sD           VEKIEDLLQSEENKNLDLEPC---TGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKR
2cu2A           GNWRALERVFSQDPHENVVLGEGRHVALDTFGCYADRGVVATLGVSGLVVAKVGDEVLVVPKDWAREVRE
3ca8A           ----------------------------------------------------------------------
3ca8B           ----------------------------------------------------------------------
2atfA           ---------------------------------------------------RILHELFAGDEVNVEEVQA
2d5hA           AGNPDIEHPETMQEEGGSVLSGFSKHFLAQSFNTNEDTAEKLRSPDDERKQIVTVEGGLSVISNICTMKL
3bbdA           GDIKEISIYN------------------------------------------------------------
2ea7C           --------------------------------------------------------VSVSSGKNNPFYFN
3bu7B           GTWHEHGILESGTECIWQDGLDIPLTNEANFYEVHPNDYQTTDIPLNDSPLTYGGPALLPQLDKWDKPYS
2b5hA           ---------------------------------------------------RILHELFAGDEVNVEEVQA
3cgxA           ----------------------------------------------------------------------
2c0zA           ---------------------------------------------------PRGSHMRL-RPLGIEGVWE
1cauA           -----------------------------------------------------------------QNNPY
3duvB           DTAEDLEKVRA-----------------------------------------------------------
2d5fB           EGGSVLSGFSKHFLAQSFNTNEDTAEKLRSPDDERKQIVTVEGGL------SVISPKWGVEENICTMKLH
2eaaA           -----------------------------------------------------------SRGENNPFYFS
2d40A           WRWHDHGNPGDWLDGLDLPLVNILGCGFAEDYPQQPVTRKEGDYLPRYAANLPLRHQTGNSSPIFNYRYD
3c3vA           ----------------------------------------------------------ISFRQQPEENAC
2e9qA           --------------------------------------------------------------TICTLRLK
2e3dB           GNKLGYMQAFVEY---------------------------------------------------------
2d40B           WRWHDHGNPGDEPVIWLDGLDLPLVNILGCGFAEDPPVTRKEGDYLPRYAANLPLRHQTGNSSPIFNYRY
2ea7A           --------------------------------------------------------VSVSSGKNNPFYFN
3cjxE           ----------------------------------------------------------------------
3d5nA           ----------------------------------------------------------------------
2e3dA           GNKLGYMQAFV-----------------------------------------------------------
2ea7B           ----------------------------------------------------------------RKSSQD
2e8bA           ----------------------------------------------------------------------
2eaaC           -------------------------------------------------------------DSRGENNPF
2cv6A           ----------------------------------------------------------------GKNNPF
3cewA           ----------------------------------------------------------------------
3cjxC           ----------------------------------------------------------------------
2d5hD           ----------------------------------------------------------------------
2cauA           ----------------------------------------------------------------------
3ehkA           ----------------------------------------------------------------------
2cavA           ----------------------------------------------------------------------
1e5rA           ----------------------------------------------------APDLAYLAAVPTVEEFSN
2eaaB           -----------------------------------------------------------SDSRGEPFYFS
2d5fA           ----------------------------------------------------------------------
3cjxB           ----------------------------------------------------------------------
1dzrA           ---------------------------------------------------------MIVIKTAIPDVLI
3cjxD           ----------------------------------------------------------------------
1dgwA           ----------------------------------------------------------------------
3d8vA           VDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAA
2aacA           ----------------------------------------------------------------------
2d5hB           ----------------------------------------------------------------------
2d40C           WRWHDHGNPGDEPVIWLDGLDLPLVNILGCGFAEDYPEQPVTRKEGDYLPRYLPLRHQTGNSSPIFNYRY
3bcwB           ------------------------------------------------------------DKSRLVRIDT
3bcwA           ------------------------------------------------------------DKSRLVRIDT
3ejkA           -----------------------------------------------------------AILLPVEGAQL
3cjxF           ----------------------------------------------------------------------
1cauB           ----------------------------------------------------------------------
1e5sB           ----------------------------------------------------------------------
3d98A           ----------------------------------------------------------------------
3cjxA           ----------------------------------------------------------------------
1e5rB           ----------------------------------------------------PDLAYLAAVPTVEEFSNG
2d5hF           ----------------------------------------------------------------------
2d5hC           ----------------------------------------------------------------------
2d5hE           ----------------------------------------------------------------------
3d5nH           ----------------------------------------------------------------------
3dj4A           ----------------------------------------------------------------------
3d5nB           ----------------------------------------------------------------------
3d5nE           ----------------------------------------------------------------------
3brkX           KSWPIWTYAEITPPAKFVHDDEDRRGSAVSSVV-------------------------------------
3d82A           ----------------------------------------------------------------------
2d40D           ----------------------------------------------------------------------
2arcA           ----------------------------------------------------------------------
1e5kA           ----------------------------------------------------------------------
3ebrA           ----------------------------------------------------------------------
3d5nF           ----------------------------------------------------------------------
3balA           ----------------------------------------------------------------------
2ab4A           -----------------------------------------------------KHGILVAYKPKGPTSHD
2ehoB           ATYRSLGGDE------------------------------------------------------------
2arcB           ----------------------------------------------------------------------
1acfA           AGFAVTPAAGAFNNADAIRAGGFDLAGVHYVTLRADDSIYGKKGSSGVITVKTSKAILVGVYNAANVVEK
3d82B           ----------------------------------------------------------------------
2e3dD           GNKLGYMQ--------------------------------------------------------------
2b8mA           ----------------------------------------------------------------------
2araA           ----------------------------------------------------------------------
2bnoA           ----------------------------------------------------------------------
2dpwA           ----------------------------------------------------------------------
3d5nI           ----------------------------------------------------------------------
2bnnB           ----------------------------------------------------------------------
1dgwX           ----------------------------------------------------------------------
3d0jA           ----------------------------------------------------------------------
2bnmA           ----------------------------------------------------------------------
2e3dC           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VVEKIKADGRHEHHMHREVYRPWGKYDSIDAGERYQVKRITVKPGEGLSVQMHHHRAEHWVVVAGTARVT
2bq1E           ITFRSPYDIQRRYGKPFGDIAISERYDELIADPHVRKTYINARDFFQTLAEIQFESGYPYIMFEDTVNRA
3bu7A           PLLKYSWEPTYEALLNYAILRYTNPQTGGHPMLTMGASMQMLRPGEHTKAH-RHTGNVIYNVAKGQGYSI
2a1sD           ----------------------------------------------------------------------
2cu2A           VVKRLEA---------------------------------------------------------------
3ca8A           ----------------------------------------------------------------------
3ca8B           ----------------------------------------------------------------------
2atfA           VLEAYESNPAEWALYAK-FDQYRYTRNLVDQGNGKFNLILCWGEGHGSSIHDHTDSHCFLKLLQGNLKET
2d5hA           HENIARPSRADFYNPKAGRISTLNSLTLPALRQFGLSAQYVVLYRNGIYSPHWNLNASVIYVTRGKGRVR
3bbdA           ----------------------------------------------------------------------
2ea7C           SDRWFRTLYRNEWGHIRVLQRFDQRSKQMQNLENYRVVEFKSKPNT--LLLPHHADADFLLVLNGTAVLT
3bu7B           PLLKYSAKASDGSPYDGLILRYTNPQTGGHPMLTMGASMQMLRPGEHTKAH-RHTGNVIYNVAKGQGYSI
2b5hA           VLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKET
3cgxA           ----------------------------------------------------------------------
2c0zA           ITPEQRADPRLDWYHVDRFAEAIGRPL-----RLAQANLSVSVRGVVRGIHFVPGQAKYVTCVRGAVFDV
1cauA           LFRSNKFLTLFKQHGSLRLLQRFNEDTEKLENRDYRVLEYCSKPNTLL--LPHHSDSDLLVVLEGQAILV
3duvB           ----------------------------------------------------------------------
2d5fB           ENIARPSRADFYNPKAGRISTLNSLTLPALRQFGLSAQYVVLYRNGIYSPHWNLNANSVIYVTRGKGRVR
2eaaA           SDRRFHTLFTNQYGHLRILHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPH-HADADFLLVVLNGRAILT
2d40A           RSREVLHDLTRLGDADEWDGYKRYVNPVTGGYPPSGAFLQLLPKGFASRVA-RTTDSTIYHVVEGSGQVI
3c3vA           QFQRLNAQRPDNRESEGGYIETWNPNNQEFECAGVALSRLVLRRN-ALRRPFYSNAPQEIFIQQGRGYFG
2e9qA           QNIGRSERADVFNPRGGRISTANYHTLPILRQVRLSAERGVLYSNAMVAPHYTVNSHSVMYATRGNARVQ
2e3dB           ----------------------------------------------------------------------
2d40B           DRSREVLHDLTRLGDADEWDGYKRYVNPVTGGYPPSGAFLQLLPKGFASRVARTTDSTIYHVVEGSGQVI
2ea7A           SDRWFRTLYRNEWGHIRVLQRFDQRSKQMQNLENYRVVEFKSKPNTLLLPH-HADADFLLVVLNGTAVLT
3cjxE           --EKLLTVDTTAHPFLKALGGHEGTDIFPLFDPYNGLVRASFAPGLTL--PLHFHTGTVHYTISGCWYYT
3d5nA           ----------------------------------------------------------------------
2e3dA           ----------------------------------------------------------------------
2ea7B           EPFNLRNSKPIYSNKFGRWYEMTPEKNPQLKDLDVFISSVDMKEGALLLPHYSSKAIVIMVINEGEAKIE
2e8bA           ----------------------------------------------------------------------
2eaaC           YFSSDRRFFTNQYGHLRILHRFDQRSKQIQNLENYRVVEFKSKPNTLL--LPHHADADFLLVLNGRAILT
2cv6A           YFNSDRWFFRNQFGHLRVLQRFDQRSKQMQNLENYRVVEFNSKPNTLLLPH-HADADFLLVVLNGRAVLT
3cewA           ------------NYQKSVAQDARVELHDSLALTGAEVSINHLPAGAGVPFVHSHKQNEIYGILSGKGFIT
3cjxC           --EKLLTVDTTAHPFLKALGGHEGTDIFPLFDPYNGLVRASFAPGLTL--PLHFHTGTVHYTISGCWYYT
2d5hD           -----RPSRADFYNPKAGRISTLNSLTPALRQFGLSAQYVVLYRNGIYSPHWNLNANSVIYVTRGKGRVR
2cauA           --NKFLTLFKNQHGSLRLLQRFNEDTEKLENLRDYRVLEYCSKPNTLL---LPHHSDSDLLVLEGQAILV
3ehkA           -LNQLQAREPDNRQAEAGQIETWNFNQGDFQCAGVAASRITIQRNGL--HLPSYSNAPQLIIVQGRGVLG
2cavA           IVKMPKDDKPFNLRSRDPIYSNYGKLYEITRDLDILLNCLQMNEGALFVPHYNSRATVILVANEGRAEVE
1e5rA           GFWKHVPLWNQPTAHVEHVPYLKEIVTTVFDGTHLQMARSRNLKNAIVIPHRDFRYFRTFMVLEDSPLAF
2eaaB           SDRRFHTLFTNQYGHLRILHRFDQRSKQIQNLENYRVVEFKSKPNT--LLLPHHADADFLLVLNGRAILT
2d5fA           -LNNLNALEPDHVESEGGLIETWNSQHPELQCAGVTVSKRTLNRNGL--HLPSYSPYPQMIVVQGKGAIG
3cjxB           --EKLLTVDTTAHPFLKALGGHEGTDIFPLFDPYNGLVRASFAPGLT--LPLHFHTGTVHYTISGCWYYT
1dzrA           LEPKVFGDERFESYNQQTFEELIG-----RKVTFVQDNHSKSKKNVLRGLHFQRGQGKLVRCAVGEVFDV
3cjxD           --EKLLTVDTTAHPFLKALGGHEGTDIFPLFDPYNGLVRASFAPGLTL--PLHFHTGTVHYTISGCWYYT
1dgwA           ---------------SLRLLQRFNEDTEKLENRDYRVLEYCSKPNTLL--LPHHSDSDLLVVLEGQAILV
3d8vA           VGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTDADIGEY-SNIGASSVFVNYDTSKRRTTVR
2aacA           --------------------LPGYSFNAHLVAGLTPIEANGYLDFF--IDRPLGMKGYILNLTRGQGVVK
2d5hB           ----RPSRADFYNPKAGRISTLNSLTLPALRQFGLSAQYVVLYRNGIYSPHWNLNANSVIYVTRGKGRVR
2d40C           DRSREVLHDLTRLGDADEWDGYKRYVNPVTGGYPPSGAFLQLLPKGFASRVARTTDSTIYHVVEGSGQVI
3bcwB           GPINPVAGKPSRPIAGDASFRTVTAFE--GGQGKVESGVWESTSGS---FQSNTTGYIEYCIIEGEARLV
3bcwA           GPINPVAGKPSRPIAGDASFRTVTAFE--GGQGKVESGVWESTSGS---FQSNTTGYIEYCIIEGEARLV
3ejkA           SELRQIPA-------EGGPVLHLRLDSPQF-SQFGEIYFSEVLPRRVKAWK-RHSLTQLFAVPVGCIHVV
3cjxF           --KLLTVDTTAHPFLKALGGHEGTDIFPLF-DPYNGLVRASFAPGLTL--PLHFHTGTVHYTISGCWYYT
1cauB           ---------------DPIYSNNYGKLYEITPDLDILLNCLQMNEGALFVPHYNSRATVILVANEGRAEVQ
1e5sB           ---------NAPTAHVEHVPYLKEIVTTVFDGTHLQMARSRNLKNAIVIPHRDFVYFRTFMVLEPLAFHS
3d98A           ----------------------------------------------------------------------
3cjxA           --EKLLTVDTTAHPFLKALGGHEGTDIFPLFDPYNGLVRASFAPGLT--LPLHFHTGTVHYTISGCWYYT
1e5rB           FWKHVPLW-NAPTAHVEHVPYLKEIVTTVFDGTHLQMARSRNLKNAIVIPHRDFVERYMVLEDSPLAFHS
2d5hF           -LNNLNALEPDHRESEGGLIETWNSQHPELQCAGVTVSKRTLNRN-GLHLPSYSPYPQMIIVVQGKGAIG
2d5hC           -------RADFYNPKAGRISTLNSLTLPALRQFGLSAQYVVLYRNGIYSPHWNLNANSVIYVTRGKGRVR
2d5hE           -----PSRADFYNPKAGRISTLNSLTLPALRQFGLSAQYVVLYRNGIYSPHWNLNANSVIYVTRGKGRVR
3d5nH           ----------------------------------------------------------------------
3dj4A           ----------------------------------------------------------------------
3d5nB           ----------------------------------------------------------------------
3d5nE           ----------------------------------------------------------------------
3brkX           ----------------------------------------------------------------------
3d82A           --------GQTKVINFNDKFSLFNQHWSPRVIAENDYQFKLVKVEGEFV--WHEHADTDEVIVEGTLQIA
2d40D           ----------RLGDADEWDGYKRYVNPVTGGYPPSGAFLQLLPKGFA-SRVARTTDSTIYHVVEGSGQVI
2arcA           --------------------LPGYSFNAHLVAGLTPIEANGYLDFF--IDRPLGMKGYILNLTRGQGVVK
1e5kA           ----------------------------------------------------------------------
3ebrA           ---------DGNDTPWPFAPYSNDVVKYFKIDPVRGETITLLKAPAGEP--RHHHTGTVIVTVQGSWRYK
3d5nF           ----------------------------------------------------------------------
3balA           -----CNKKHTAEEYVKISDNNYVPFPEAFSDGGITWQLLHSSPETSSWTAIIHAGPGEYFLTKGKMEVR
2ab4A           VVDEVR------KKLKTRKVGHGGTLDPFACG----VLIIGVNQGTRILEFYKDLKKVFWVKMRLGLITE
2ehoB           ----------------------------------------------------------------------
2arcB           ------------------LLPGYSFNAHLVAG-LTPIEANGYLDFF--IDRPLGMKGYILNLTRGQGVVK
1acfA           LADYLIGQG-------------------------------------------------------------
3d82B           ---------QTKVINFNDKFSLFNQHWSPRVIAENDYQFKLVKVEGEFV--WHEHDTDEVFIVEGTLQIA
2e3dD           ----------------------------------------------------------------------
2b8mA           --------GIEKVYEFKRDAK-TKVVEKLVNTEHVQINHIVLPRGE---QPKHYSNSVHLIIIKGETLTL
2araA           ------------------------------------IEANGYLDFF--IDRPLGMKGYILNLTRGQGVVK
2bnoA           ----------PILKNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMK
2dpwA           ----------------------------------------------------------------------
3d5nI           ----------------------------------------------------------------------
2bnnB           DGVIIQMPDERPILKGVYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMK
1dgwX           --------------------NNYGKLYEITPDLDILLNCLQMNEGALFVPHYNSRATVILVANEGRAEVE
3d0jA           --------------------KPDIENNREGILCVYKNEKWLNDIEGIAHLEIHHSTDEQFILSAGKAILI
2bnmA           ---------ILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKSGHAGNEFLFVLEGEIHMK
2e3dC           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           INGEVKLLGENESIYIPLGATHCLENPGKIPLDLIEVRSGSYLEEDDVVRFEDRYGRI
2bq1E           NPIAGRINMSN-----LCSEILQVNSASRYDDNLDYTHIGHDLGSLNIAHVMDSPD--
3bu7A           VGGKRFDWSEHDIFCVPAWTWHEHCNTQERDDACLFSFNDFPVMEKLGFWAEQALED-
2a1sD           ----------------------------------------------------------
2cu2A           ----------------------------------------------------------
3ca8A           ----------------------------------------------------------
3ca8B           ----------------------------------------------------------
2atfA           LKKSERTLRENQCAYINDSGLHRVENVSHTPAVSLHLYSPPF---DTCHAFDQRTGHK
2d5hA           VVNQDGELRRGQLLVVPQNFVVAEQGGEQGLEYVKTHHNAVSSYIKDVFRAIPSEVL-
3bbdA           ----------------------------------------------------------
2ea7C           LSRDSYILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLAIPVNNPHRFQDFFLSSTE-
3bu7B           VGGKRFDWSEHDIFCVPAWTWHEHCNTQERDDACLFSFNDFPVMEKLGFWAEQALED-
2b5hA           LFDERTLRENQCAYINDSIGLHRVENVSHTPAVSLHLYSPPF---DTCHAFDQRTGHK
3cgxA           ----------------------------------------------------------
2c0zA           VEGTRLDDVSRRAVYLSEGIGHGFCAISDEATLCYLSSGTYDPATEHGVHPLD-----
1cauA           LGRDTYKLDQGDAIKIQAGTPFYLINPDNNQN-LRILKFAITFRRPGTVEDFFLSST-
3duvB           ----------------------------------------------------------
2d5fB           VAVFDGELRRGQLLVVPQNFVVAEQGGEQGLEYVKTHHNAVSSYIKDVFRAIPSEVL-
2eaaA           LSRDSYILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLAIPVNNPHRFQDFFLSSTE-
2d40A           IGNETFSFSAKDIFVVPTWHGVSFQTTQDSVLFSFSD--RPVQEALGLFREAR-----
3c3vA           LHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAV-----------------------
2e9qA           VVDFDGEVREGQVLMIPQNFVVIKRASDRGFEWIAFK-TNDNAITNLLAGRVSQMRML
2e3dB           ----------------------------------------------------------
2d40B           IGNETFSFSAKDIFVVPTWHGVSFQTTQDSVLFSFSD--RPVQEALGLFR-EAR----
2ea7A           LSRDSYILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLAIPVNNPHRFQDFFLSS---
3cjxE           E-YPGQKQTAGCYLYEPGGSIHQFNTPRDNEGQTEFTQDGTYLGLSDAGVIKNWVDR-
3d5nA           ----------------------------------------------------------
2e3dA           ----------------------------------------------------------
2ea7B           LQRYRAELSEDDVFVIPAAYPVAINATSNLNFFAFGINAENNRRNFLAGGKDNVMSEI
2e8bA           ----------------------------------------------------------
2eaaC           LSRDSYILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLAIPVNNPHRFQDFFLSSTE-
2cv6A           LGRDSNILEQGHAQKIPAGTTFFLVNPDDEENLRIIKLAVPVNNPHRFQDFFLSSTE-
3cewA           IDGEKIELQAGDWLRIAPDGKRQISAASDSPIGFLCIQVLEGYTTDGVVQ--------
3cjxC           -EYPGQKQTAGCYLYEPGGSIHQFNTPRDSGCNVNFTQDGTYLGLSDAGVIKNWVDR-
2d5hD           VAVFDGELRRGQLLVVPQNFVVAEQGGEQGLEYVKTHHNAVSSYIKDVFRAIPSEVL-
2cauA           LGRDTYKLDQGDAIKIQAGTPFYLINPDNNQNLRILKFAITFRRPGTVEDFFLSSTK-
3ehkA           AHQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYL--
2cavA           LRRYAATLSEGDIIVIPSSFPVALKAASDLNMVGIGVNAENNERNFLAGHKENVIRQI
1e5rA           HEDTVIHMRPGEIWFLDAATVHSAVNFSEISRQSLCVDFAFDGP--------------
2eaaB           LSRDSYILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLAIPVNNPHRFQDFFLSSTE-
2d5fA           FHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQNPRVFYLA-
3cjxB           E-YPGQKQTAGCYLYEPGGSIHQFNTPRDNEGQTEVICNVNFLSDAGIKNWVDRAIRE
1dzrA           AVGVNLSAENKRQLWIPEGFAHGFVTLSEYAE-FLYKATNYYSPSSESILWND-----
3cjxD           E-YPGQKQTAGCYLYEPGGSIHQFNTPRDNEGQTEFTQDGTYLGLSDAGVIKNWVDR-
1dgwA           LGRDTYKLDQGDAIKIQAGTPFYLINPDNNQN-LRILKFAITFRRPGTVEDFFLSS--
3d8vA           TGSDTMFVGAGTVVRVPPGALAVSAGPQRNIENWVQGSPAAQASKR------------
2aacA           NQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYWHEWL--------
2d5hB           VVNQDGELRRGQLLVVPQNFVVAEQGGEQGLEYVVFKTHAVSSYIKDVFRAIPSEVL-
2d40C           IGNETFSFSAKDIFVVPTWHGVSFQTTQ--DSVLFSFSDRPVQEALGLFR-EARY---
3bcwB           DPDGTVHAVKAGDAFIPEGYTGRWEVDRHVKKIYFVTH--------------------
3bcwA           DPDGTVHAVKAGDAFIPEGYTGRWEVDRHVKKIYFVTH--------------------
3ejkA           LQVTLGRPDNYRLLRIPPQVWYGFAATGDTPALVANCTDIPHRQESERAPQDAPFIPF
3cjxF           E-YPGQKQTAGCYLYEPGGSIHQFNTPRDNEGQTEFTQDGTYLGLSDAGVIKNWVDR-
1cauB           LRRYAATLSEGDIIVIPSSFPVALKAASDLNMVGIGVNAENNERNFLAGHKENVIRQI
1e5sB           NEDTVIHMRPGEIWFLDAATVHSAVNFSEISRQSLCVDFYAPGSTPDLPERRPFTAEH
3d98A           ----------------------------------------------------------
3cjxA           E-YPGQKQTAGCYLYEPGGSIHQFNTPRDNEGQTEFTQDGTYLGLSDAGVIKNWVDR-
1e5rB           NEDTVIHMRPGEIWFLDAATVHSAVNFSEISRQSLCVDFAFDGPFDEKEIFADATLY-
2d5hF           FHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQNPRVFY---
2d5hC           VVNQDGELRRGQLLVVPQNFVVAEQGGEQGLEYVKTHHNAVSSYIKDVFRAIPSEVL-
2d5hE           VVNQDGELRRGQLLVVPQNFVVAEQGGEQGLEYVKTHHNAVSSYIKDVFRAIPSEVL-
3d5nH           ----------------------------------------------------------
3dj4A           ----------------------------------------------------------
3d5nB           ----------------------------------------------------------
3d5nE           ----------------------------------------------------------
3brkX           ----------------------------------------------------------
3d82A           FRDQNITLQAGE-YVIPKGVEHKPAKEECKI--IIEPR--------------------
2d40D           IGNETFSFSAKDIFVVPTWHGVSFQTTQ--DSVLFSFSDRPVQEALGLFREAR-----
2arcA           NQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYWHEWL--------
1e5kA           ----------------------------------------------------------
3ebrA           EHDWV--AHAGSVVYETASTRHTPQSAYAEGPDIITFNILLYLDDKDNIIAVENWKT-
3d5nF           ----------------------------------------------------------
3balA           GQEGGSTAYAPSYGFESSGALHGKTFFPVESQFYMTFLGPNFIDDNGSIGWAEAQGA-
2ab4A           ----------------------------------------------------------
2ehoB           ----------------------------------------------------------
2arcB           NQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYWHEWL--------
1acfA           ----------------------------------------------------------
3d82B           FRDQNITLQAGE-YVIPKGVEHKPAKEECKI--IIEPR--------------------
2e3dD           ----------------------------------------------------------
2b8mA           EDQEPHNYKEGNIVYVPFNVKLIQ-NINSDILEFFVVKAP------------------
2araA           NQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVFRPRAYWHEWLNWPSIFAN-
2bnoA           WNPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIA---------------------
2dpwA           ----------------------------------------------------------
3d5nI           ----------------------------------------------------------
2bnnB           WNPKEALLPTGASMFVEEHVPHAFTAAKTGSAKLIAV---------------------
1dgwX           LVGL------------------------------------------------------
3d0jA           TANIELTLEKGKVYNVPAECWFYSITQKDTKY--------------------------
2bnmA           WNPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIA---------------------
2e3dC           ----------------------------------------------------------