[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF65854.1

[Show Plain Result]


## Summary of Sequence Search
    1::364
   60::192     1e-04  32%  195 aa  PF00528 BPD_transp_1 "Binding-protein-dependent transport system
    1::364

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00528         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00528         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00528         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxLWHITLPVLATVIGGFAALTMLTKNSFLDEVRKQYVVTARAKGVSEKNILWKHVFR
PF00528         --------------LGHGLLAVILALVLSTAPFVRLIRRAALESIPKDLIEAARALGASR----WQTFRR


                         .         *         .         .         .         .         +:350
query           NAMLLVIAGFPATFISMFFTGSLLIEVMFSLNGLGLLGYEATVSRDYPVMFGTLYIFTLIGLLLNILSDI
PF00528         VILPLALPGI-ITGLILAFIGALIAELLGGGPGLGSLLLLALLGYDYNVMAGAAAALALLLLLLNLLADL


                         .         .         .         .         *         .         .:420
query           SYTLVDPxxxxxxx
PF00528         LQRYLDP-------