[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF65890.1

[Show Plain Result]


## Summary of Sequence Search
    1::350
   14::277     2e-62  56%  278 aa  PF00793 DAHP_synth_1 "DAHP synthetase I family"
    1::350

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIHKILKGNDDRLLVVIGPCSIHDPXXXX
PF00793         ------------------------------------------VEDILIGEDDRLLVIAGPCSIEDEEAAL


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXRDELQGELEIVMRVYFEKPRTTVGWKGLINDPHMDNSFQINDGLRIARKLLLDINDSGLPA
PF00793         EYAERLKALGEKLK--LLIVMRAYFEKPRTSVGFKGLGNDPGLDILFEIKEGL-------------GLPV


                         +         .         .         .         .         *         .:210
query           AGEFLDMITPQYLADLMSWGAIGARTTESQVHRELASGLSCPVGFKNGTDGTIKVAIDAINAAGAPHCFL
PF00793         ATEVLDPIQPQYVADLVDWLQIGARTTESQDHREAASGLSKPVGFKNGTD----VAIDAMLAAAEKHHFL


                         .         .         .         +         .         .         .:280
query           SVTKWGHSAIVNTSGNGDCHIILRGGKAPNYSAQHVAEVKEGLIKAGLTPQVMIDFSHANSCKQFQKQME
PF00793         G---------VGTDGNILCERGLRGGYGPNYLVLDLAALPIMLEKTHL--PVIVDPSHANSGKDGGRQPL


                         .         *         .         .         .         .         +:350
query           VCADVCQQIAGGEKAIIGVMVESHLVEGNQSLESGQPLTYGKSITDACIGWEDTDALLxxxxxxxxxxxx
PF00793         VAPLARAAIAAG---IDGLMIESHLDPGNALSDGPQALTYGQSITDACIGWEDTELLI------------