[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF65897.1

[Show Plain Result]


## Summary of Sequence Search
    1::73
    1::50      2e-11  60%   50 aa  PF06004 DUF903 "Bacterial protein of unknown function (DUF903)"
    1::73

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxNYVMTTKNGQTIVTQGKPQLDKETGMTSYTDQEGNQREINSNDVAQLI
PF06004         ----------------------NYVMTTNDGRTIVTDGKPKVDDDTGMYSYKDADGNKVQINRDDVKQII


                         .         .         *         .         .         .         .:140
query           KAx
PF06004         EA-