[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF65921.1

[Show Plain Result]


## Summary of Sequence Search
    1::467
    1::430     e-108  50%  432 aa  PF01654 Bac_Ubq_Cox "Bacterial Cytochrome Ubiquinol Oxidase"
    1::467

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxLARLQFAFTVSFHIIFPAITIGLASYLVVLEGLWLKTRNPVWRSLYQFWLKIFAVNFGMGVVS
PF01654         -------LSRLQFALTASFHFLFVPLTIGLALLLAIMETLYVRTGDEVYKRMAKFWGKLFAINFALGVAT


                         .         .         *         .         .         .         .:140
query           GLVMAYQFGTNWSGFSQFAGSITGPLLTYEVLTAFFLEAGFLGVMLFGWNKVGPGLHFLSTCMVALGTLM
PF01654         GIVMEFQFGTNWSGYSRFVGDIFGAPLAIEGLFAFFLESTFLGLWLFGWDRLSKKLHLLSTWLVALGTNL


                         +         .         .         .         .         *         .:210
query           STFWILASNSWMHTPQGFEIHNGQVVPVDWFAVIFNPSFPYRLLHMSVAAFLSSAMFVGASAAWHLLKGN
PF01654         SAFWILAANSWMQTPVGAEFETGRAEMTDFWAVFFNPVAQVKFLHTVLAAYLTGAFFVAGISAWYLLRGR


                         .         .         .         +         .         .         .:280
query           DTPAIRRMFSMALWMAVVVAPVQALIGDMHGLNTLKHQPVKIAAIEGHWENTPGEPTPLTLVGWPDMEAE
PF01654         DREFAKRSFKIGLVFGLIAALLQIVLGDESGYNVAEYQPMKLAAMEGLWETEP--PAPFSLFGIPDQEEE


                         .         *         .         .         .         .         +:350
query           RTRYALEIPALGSLILTHSLDKQVPALKDYPKEDRPNSTVVFWSFRLMVGMGVLMIFLGLASLWLRYRRR
PF01654         ENDFAIEIPYLLSLLATHSFDGEVPGLKDFPGDYRPPVAPVFWSFRIMVGLGFLMLLLALVGLWLTRRGR


                         .         .         .         .         *         .         .:420
query           LYHSRPFMHFALWMGPSGLIAILAGWVTTEVGRQPWVVYGLLRTRDAVSAHSTLQMSISLLAFFVVYSLV
PF01654         LYESRWLLRLALLSIPLPFIAIEAGWIVTEVGRQPWTVYGLLPTADAVSPLSAGEVLFSLILFLLLYTAL


                         .         .         +         .         .         .         .:490
query           FGVGYIYMIRLIQKGPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01654         LVAEVYLMFRYARKGP-------------------------------