[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF65947.1

[Show Plain Result]


## Summary of Sequence Search
    1::353
   18::107     1e-25  53%  108 aa  PF04809 HupH_C "HupH hydrogenase expression protein, C-terminal
    1::47      3e-11  57%   47 aa  PF00301 Rubredoxin "Rubredoxin"
   24::97      9e-14  51%  108 aa  PF04809 HupH_C "HupH hydrogenase expression protein, C-terminal(query 72->147)
    1::353

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF04809         ----------------------------------------------------------------------
PF00301         ----------------------------------------------------------------------
PF04809         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xPFPLSYKLNATEQQNSGLLDQLLGEGEISARVLLSDGKEQRIQETVFTGVWRVREYNADQQRVADEIII
PF04809         ----------------------------------------------------------------------
PF00301         ----------------------------------------------------------------------
PF04809         -PHVINLTLLPLSAADRALLNELLGEGEVS---VLSRGYECRIQETVFAGVWRVRYFNADGTLLLDTLEI


                         +         .         .         .         .         *         .:210
query           GPIPESIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKQPVKEPHIINLTLLPVNDADREYLDHFL
PF04809         -----------------------------------------RRPGAEPHVINLTLLPLSAADRALLNELL
PF00301         ----------------------------------------------------------------------
PF04809         GPVPEVV---------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GEGCSAIFSRGYGKCRIVSTHFPGVWRVNYFNDMNTLLQDMIEIADIPDIAVAGIDDIEDAxxxxxxxxx
PF04809         GEGEVSVLSRGYGECRIQETVFAGVWRVRYFNADGTLLLDTLEIGPVPEVVLAAPEDLEAA---------
PF00301         ----------------------------------------------------------------------
PF04809         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxRMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFxxxxxxxxx
PF04809         ----------------------------------------------------------------------
PF00301         --------------KYECRVCGYIYDPAKGDPDGGIPPGTPFEDLPDDWRCPVCGAPKSDF---------
PF04809         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxx
PF04809         ---
PF00301         ---
PF04809         ---