[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF66015.1

[Show Plain Result]


## Summary of Sequence Search
    1::160
    5::105     1e-09  37%  113 aa  PF01464 SLT "Transglycosylase SLT domain"
   30::58      2e-04  48%  123 aa  PF00062 Lys "C-type lysozyme/alpha-lactalbumin family"
    1::160

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTDLGLMQINSFH
PF01464         -----------------------KAARKYGVPPALLAAIARQESGFNPNAV----SPAGAVGLMQINPRT
PF00062         --------------------------------------LAEHESSFNTSAVNRNNNGSTDYGLFQIN---


                         .         .         *         .         .         .         .:140
query           MKRLKKMGISEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKRSDIRxxxxxxxxxxxx
PF01464         AGALGRKGASVDDLF-DPEDNIDAGARYLAELYKRFGGDWLALAAYNAGPGNVRRAYR------------
PF00062         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxx
PF01464         --------------------
PF00062         --------------------