[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF66076.1

[Show Plain Result]


## Summary of Sequence Search
    1::294
    1::38      1e-11  68%   44 aa  PF09163 Form-deh_trans "Formate dehydrogenase N, transmembrane"
    1::294

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09163         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09163         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09163         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIDTSINLWKGALKPLAAAGFIATFAGLIYHYIGIG
PF09163         -----------------------------------ISPSVTLWKGVLKPLAAAGFGATAAAGIFHYIGVG


                         .         *         .         .         .         .         +:350
query           PNKxxxxxxxxxxx
PF09163         PNR-----------