[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF66348.1

[Show Plain Result]


## Summary of Sequence Search
    1::339
    2::104     2e-29  52%  108 aa  PF08240 ADH_N "Alcohol dehydrogenase GroES-like domain"
    2::122     2e-07  32%  128 aa  PF00107 ADH_zinc_N "Zinc-binding dehydrogenase"
    1::339

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxGEVRIKVKLAGICGSDSHIYRGHNPFAKYPRVIGHEFFGVIDAVGD
PF08240         ------------------------GEVLVKVKAAGICGSDLHIRRGYPPPPKFPRILGHEGAGVVVAVGP
PF00107         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           NVNRDRIGERVSVDPVISCGHCYPCSVGKPNVCTSLVVLGVHRDGGFSEYAVAPARNxxxxxxxxxxxxx
PF08240         GVTGLKVGDRVVVEPTVPCGECEACKSGRTNLCPNQRFLGFSNDGGFAEYVVVPANN-------------
PF00107         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMGLTTVQALKGVYQVKTVIVVDRIEERLAMAKQSGADWT
PF08240         ----------------------------------------------------------------------
PF00107         -------------------------------VGLAAIQLAKALGA--RVIAVDRSPEKLELAKELGADHV


                         .         .         .         +         .         .         .:280
query           LNNGQHSLAEFLQQKALKPTLIVDAACHPAILQEAITLASPAARIVLMGFSSDPCEIVQQGITGKELAIY
PF08240         ----------------------------------------------------------------------
PF00107         INYKDEDFVEAVKEGGRGVDVVLDCVGSGATLEAALELLRPGGRVVLVGVSGGPVTLPLGPLILKEITIR


                         .         *         .         .         .         .         +:350
query           SSRLNANKFPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08240         -----------------------------------------------------------
PF00107         GSFLGSEEFP-------------------------------------------------