[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF66691.1

[Show Plain Result]


## Summary of Sequence Search
    1::588
   55::258     6e-16  27%  274 aa  PF00664 ABC_membrane "ABC transporter transmembrane region"
  139::240     6e-04  31%  303 aa  PF07682 SOR "Sulphur oxygenase reductase"
  476::516     8e-04  39%  536 aa  PF02463 SMC_N "RecF/RecN/SMC N terminal domain"
    1::588

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00664         ----------------------------------------------------------------------
PF07682         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxAWVVWLRERVGFHAGQHIRFEIRRQVLDRLQQAGPAWIQGKPAGSWATLVLEQIDDMHDYYARY
PF00664         ------ALLLYLSFYLAARLGQRIRRDLRRRLFRKLLRLPLSFFDRNPTGELLSRLTNDVEAIDDLLGST
PF07682         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LPQMALAVCVPLLIVAAIFPSNWAAALILLGTAPLIPLFMAMVGMGAADANRRNFLALARLSGHFLDRLR
PF00664         LPLLLQALLTLVGALILLFLLSWKLALVLLAVLPLLILLAALFGKRLRKLSRKEQEARSELNSVLEESLS
PF07682         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GMETLRIFGRGEAETESIRAASQDFRQRTMEVLRLAFLSSGVLEFFTSLSIALVAVYFGFSYLGELNFGx
PF00664         GIRTVKAFGAEERELERFEEALDEYRKASLKAARLSALLSPLLQLLGALSLALVLWLGGYLVLGELTVG-
PF07682         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxELAENEPVTI
PF00664         ----------------------------------------------------------------------
PF07682         ------------------------------------------------------------KFAEGKPLGI
PF02463         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           DAVNLIITSPEGKTLAGPLNFSLAAGERAVLVGRSGSGKSSLLNVLSGFLSYQGSLRINGVELRDLSPES
PF00664         ----------------------------------------------------------------------
PF07682         P----VISQPYGQRV-------VAFGEHTVIPGKEKQFEDGAVETLEGFLGYMKEIGVSAIGSFQLGPKG
PF02463         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           WRQHLSWVGQNPQLPAATLRENVLLARPDAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00664         ----------------------------------------------------------------------
PF07682         FHQVLESLGANPPKP-----NNVMYSVPEA----------------------------------------
PF02463         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxPCQLLLLDEPAASLDAHSEQRVMQALKAASKRQTTLMVTHQxxxxxxxxxxxxxxxxx
PF00664         ----------------------------------------------------------------------
PF07682         ----------------------------------------------------------------------
PF02463         ------------PAPFYVLDEVDAALDDANVQRVADLLKELSKNSQFIVITHR-----------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00664         ----------------------------
PF07682         ----------------------------
PF02463         ----------------------------