[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF66838.1

[Show Plain Result]


## Summary of Sequence Search
    1::370
    1::362     2e-68  46%  364 aa  PF00465 Fe-ADH "Iron-containing alcohol dehydrogenase "
    1::370

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxTRLYSGQGSLAVLKRFTNKHIWIICDGFLAHSPLLDTLRNALPADNRISVFSEITPAPTIHTV
PF00465         -------TKIYFGKGALAELGKNLGKRALIVTDGSLKKLGLLDKVLDSLKAAGEVVVFDGVEPNPTVETV


                         .         .         *         .         .         .         .:140
query           VQGIAQMQALQPQVVIGFGGGSAMDAAKAIVWFSQQSGINIETCVAIPTTSGTGSEVTSACVISDPDKGI
PF00465         EEGVALAREFGADVIIAVGGGSVIDAAKAIALLAENPGDVWDPLIAIPTTAGTGSEVTPFAVITDEEGGR


                         +         .         .         .         .         *         .:210
query           KYPLFNNALYPDMAILDPELVVSVPPQITANTGMDVLTHALEAWVSPRASDFTDALAEKAAKLVFQYLPT
PF00465         KYGLADPALTPDVAILDPELTLTLPPRLTAATGMDALTHAIEAYVSTGANPITDALALKAIKLIFEYLPR


                         .         .         .         +         .         .         .:280
query           AVEKGDCVATRGKMHNASTLAGMAFSQAGLGLNHAIAHQLGGQFHLPHGLANALLLTTVIRFNAGVPXXX
PF00465         AVADGEDLEARENMLLASTLAGMAFANAGLGAVHALAHPLGALFHIPHGEANAILLPAVLRYNA--PAAP


                         .         *         .         .         .         .         +:350
query           XXXXXXXXXCGFCPAEANDIAAINALIQQIELLKQRCVLPSLAVALKEGRSDFSARIPAMVQAALADVTL
PF00465         ERYARIARALGV--DGGSDEEAAEALIEALRELFKSLGIPTTLSELGVDEED----IDELAEAALEDQCT


                         .         .         .         .         *         .         .:420
query           RTNPRPANAExxxxxxxxxx
PF00465         GNNPRELTPE----------