[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF67119.1

[Show Plain Result]


## Summary of Sequence Search
    1::263
    1::261     4e-77  54%  261 aa  PF02548 Pantoate_transf "Ketopantoate hydroxymethyltransferase"
    1::263

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xKPTTISLLQKCKQEKKRFATITAYDYSFAKLFADEGINVMLVGDSLGMTIQGHDSTLPVTVEDIAYHTR
PF02548         -KRVTIPDLQKMKQEGEKIVMLTAYDYPSAKLVDEAGVDVILVGDSLGMVVLGYDSTLPVTLDDMIYHTR


                         .         .         *         .         .         .         .:140
query           AVRRGAPNCLLLSDLPFMAYATPEQACENAAIVMRAGANMVKIEGGAWLVDTVKMLTERAVPVCGHLGLT
PF02548         AVRRGAPRALVVADMPFGSYASPEQAVRNAARLMKAGADAVKLEGGAELAETIRALTEAGIPVMGHLGLT


                         +         .         .         .         .         *         .:210
query           PQSVNIFGGYKIQGRGDAGXXXXXXXXXXXXXXXXXXXXXCVPVELAKRVTEALSIPVIGIGAGNVTDGQ
PF02548         PQSVNVLGGYKVQGKEEAAEKLLEDAKALEEAGAFALVLECVPAELAAEITEALSIPTIGIGAGPGCDGQ


                         .         .         .         +         .         .         .:280
query           ILVMHDAFGITGGHIPKFAKNFLAEAGDMRAAVQQYMAEVESGVYPGEExxxx
PF02548         VLVMHDMLGLFGGFVPKFVKRYADLGEEIRDAVSAYVAEVKSGSFPAED----