[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF67256.1

[Show Plain Result]


## Summary of Sequence Search
    1::303
   28::230     4e-72  82%  232 aa  PF09306 Phage-scaffold "Bacteriophage, scaffolding protein"
    1::303

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF09306         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxMEAVKRGELPESLRVNPDLPPQPDINAYLSEEGLAKYDYDNSRALAAFNAANTEWLMKAQD
PF09306         ---------MEAVKRGQLPEALRVNPDLPPQPDPNAYLSKPTLAKCDYDESRALAAFEAANTEWHEKAQD


                         +         .         .         .         .         *         .:210
query           ARSNAVAEQGRKTQEFTQQSAQYVEAARKHYDAAEKLNIPDYQEKEDAFMQLVPPAVGADIMRLFPEKSA
PF09306         ARSQAVAQQGRKTQEFTQQSAQYVEAARKHYDAAEKLNVPDYQEKEDAVMSLLPPAVQADILRLFPEKSA


                         .         .         .         +         .         .         .:280
query           ALMYHLGANPEKARQLLAMDGQSALIELTRLSERLTLKPRGKQISSAPPADQPITGDVSAANKDAIRKQM
PF09306         ALMYHLGKNPEKLRQLLAMDPQRAAILLGRLSERLTLAPKPKKASSAPAPDQPITGDASAANKDAIRKKP


                         .         *         .         .         .         .         +:350
query           DAxxxxxxxxxxxxxxxxxxxxx
PF09306         EA---------------------