[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF67339.1

[Show Plain Result]


## Summary of Sequence Search
    1::135
    1::119     3e-13  42%  120 aa  PF00903 Glyoxalase "Glyoxalase/Bleomycin resistance
    1::135

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xRLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNWGVESYDMGN
PF00903         -RLHHVTLRVRDLEKALRFYTEVLGLRLVKRTDCETGGLRLAFLRAG----GGVIELTLNEGPEGALAGW


                         .         .         *         .         .         .         .:140
query           AYGHIALSVDNAAEACERIRQNGGNVTREAGPVKGGSTIIAFVEDPDGYKIExxxxxxxxxxxxx
PF00903         GGHHIAFSVDDLDAAVERLKAAGVEVLGEPDRHYFGSRYF-FFRDPDGNLIE-------------