[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF67435.1

[Show Plain Result]


## Summary of Sequence Search
    1::302
    3::205     7e-17  34%  207 aa  PF03466 LysR_substrate "LysR substrate binding domain"
    1::60      1e-09  45%   60 aa  PF00126 HTH_1 "Bacterial regulatory helix-turn-helix protein,
    1::302

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxLEAMNIYVNVVEQGSFIRAAEVLELHRPAVTRAVQNLEHDLGVKLLHRTTRQVSMTDEGExxxxx
PF03466         ----------------------------------------------------------------------
PF00126         -----LRQLRTFVAVAETGSFTAAAERLGLSQSAVSRQIRRLEEELGVPLFERSGRGVRLTEAGE-----


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxPKGRLRLDVPITLARAVIIPALGDFQNRYPDIEIVLGTSDRKIDLIAERV
PF03466         --------------------PRGTLRIGASPSFASYLLPPLLARFRARYPGVELVEGDSADLLDLLREEI
PF00126         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           DCVIRLGELNDSSFVARRLGTAAMVTCAAPSYLAKHGTPHSIDELMKSHRAVNFFSNHSLQIMEWKFTVD
PF03466         DLAIRYGPLDDPGLVARPLGEEPLVLVASPDHPLARGEPLTLEDL----------AGHPLILLPTRDLLD
PF00126         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GSIASIKIPSSILVDNSEAFLSCGLAGLGVLHGLRPSLAPFIASGELTEILTDFXXXXXXVSLLYPDRRY
PF03466         RALAEAGLPRVVLEVNSEALLAAVAAGLGIALLPRSLVEDELASGRLVALPLPDPPLPRPLYLVWRKRRA
PF00126         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LAPKVRVFIDWLCExxxxxxxx
PF03466         LSPAVRAFLDLLRE--------
PF00126         ----------------------