[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF67448.1

[Show Plain Result]


## Summary of Sequence Search
    1::566
  200::378     3e-10  33%  378 aa  PF07969 Amidohydro_3 "Amidohydrolase family"
   83::169     1e-04  34%  315 aa  PF00762 Ferrochelatase "Ferrochelatase"
   94::213     3e-04  35%  329 aa  PF01619 Pro_dh "Proline dehydrogenase"
    1::566

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07969         ----------------------------------------------------------------------
PF00762         ----------------------------------------------------------------------
PF01619         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxAIRGGQTWTFETYWYDSPSLKDALDKLRADANRRPHDQWVAVV
PF07969         ----------------------------------------------------------------------
PF00762         ---------------------------AERGVDVPVYLAMRYGHPSIEDALEELKADGVRRPQYSY-STT
PF01619         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GSWIPAQFAENRAPTVAELSHALPDHPAYIQYLYDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07969         ----------------------------------------------------------------------
PF00762         GSYLARALAKGRGQPELRVIRPYYDHPGYIEALAD-----------------------------------
PF01619         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07969         ----------------------------------------------------------------------
PF00762         ----------------------------------------------------------------------
PF01619         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPGFSSSDQDKTALRQV
PF07969         --------------------------------------------------------------DPEELEEL
PF00762         ----------------------------------------------------------------------
PF01619         ------------------------------------------------------PRYSTAGEERVMLREI


                         .         .         .         .         *         .         .:420
query           ATFAAKRGIPLEIHAYTDDSADAILTIFEQVAQQYDLRPLRWSIAHLNTGSPQTLERMRKLGLAYTVQMG
PF07969         VAAAREAGLQVAVHAIGDAAIDSVLDAYEALADGHRLE-------HAELATPEDIERMAALGVIASVQ--
PF00762         ----------------------------------------------------------------------
PF01619         CELAKERGVRLLIDAEEADRQPAILDLFEELMRKYN---KGWPQAYLKR-TPADLDRLRREGFRLGVKLG


                         .         .         +         .         .         .         .:490
query           PYFEGLAIRDANPPGATDNSPPVRLALDKGLVVAGGTDSTRIGIAGVWHAIEYHITGIASGGSVRKPASE
PF07969         PHYWGDGAPNRLGPERARGLYPVRELLDAGVPVALGSDAP-VAPYDPWSGLGAAVTRRTAGGGRVLGPEE
PF00762         ----------------------------------------------------------------------
PF01619         AYWES-EIKRAQQLGIED--PPV-----------------------------------------------


                         *         .         .         .         .         +         .:560
query           RLTRLEALALYTRHAAWLAFAEQHRGQLSVGKQADLAVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07969         RLSLEEALRAVTINPA-RALGLEDRGSLEVGKRADLVV--------------------------------
PF00762         ----------------------------------------------------------------------
PF01619         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxx
PF07969         ------
PF00762         ------
PF01619         ------