[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF67603.1

[Show Plain Result]


## Summary of Sequence Search
    1::146
    3::61      9e-07  47%   92 aa  PF04828 GFA "Glutathione-dependent formaldehyde-activating
    1::146

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxCHCTLCQKWSGGIAMYLEACGQPQLAPLSPEPPYFSSSSRGERY
PF04828         --------------------------CHCSICRK-AGGAPFSLNAIVPADLTLTSGETTYTFSSETAERY


                         .         .         *         .         .         .         .:140
query           FCSGCGCPLWFRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF04828         FCSTCGTPLFYR----------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxx
PF04828         ------