[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF67677.1

[Show Plain Result]


## Summary of Sequence Search
    1::220
    4::128     6e-20  46%  128 aa  PF01058 Oxidored_q6 "NADH ubiquinone oxidoreductase, 20 Kd subunit"
    1::220

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxCYVEMVT
PF01058         ---------------------------------------------------------------CTISLQA


                         .         .         *         .         .         .         .:140
query           SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
PF01058         TEPSLYDVLRFH-ETVMASPGQADVLIVEGTVPNKMAPCLEWLYELMPEAKAVVAMGSCASYGGVFAAGN


                         +         .         .         .         .         *         .:210
query           VVQGVDKFIPVDVYIPGCPPRPEAYMQALMLLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01058         KVSGVDSIKPVDVYVPGCPPNPEAILYTLTAL--------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxx
PF01058         ----------