[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF67711.1

[Show Plain Result]


## Summary of Sequence Search
    1::404
    2::245     3e-12  30%  245 aa  PF00109 ketoacyl-synt "Beta-ketoacyl synthase, N-terminal domain"
    2::118     4e-11  41%  118 aa  PF02801 Ketoacyl-synt_C "Beta-ketoacyl synthase, C-terminal domain"
    1::404

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVKLDTTGLIDRKVVRFMSD
PF00109         --RIAITGMGCRFPGGNDPEEFWENLLAGRSGISEIPRDADGLPDPDVAGKVYVRRGGFLD----VFDFD
PF02801         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADAMRSPRGLKAVGPYVVTKAMAS
PF00109         AAFFGISPREEALEDAGIDPESLRGS-RTGVFVGSGTGDYAALQALDEAGGPRRGYPATG------SLPS
PF02801         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTK
PF00109         VAAGRVSYTFGLRGPSVTVDTACSSSLVALHLACRALRSGECDVALAGGVDILSPETFAGFSALGALS--
PF02801         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           YNDTPEKASRTYDAHRDXXXXXXXXXXXXXEELEHAxxxxxxxxAEIVGYGATSDGADMVAPSGEGAVRC
PF00109         ----PDGRCKAFDAFADGFVRGEGAGVLVLERLEDA----------------------------------
PF02801         --------------------------------------------AVIRGSAVNQDGRSLTAPNGPAQARA


                         .         *         .         .         .         .         +:350
query           MQMAMHGVDTPIDYLNSHGTSTPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLML
PF00109         ----------------------------------------------------------------------
PF02801         IRAALAGLDPDIDYVEAHGTGTPLGDPIEAEAISAVFGDRPLPVGSVKSNIGHTEGAAGAAGLIKAVLAL


                         .         .         .         .         *         .         .:420
query           EHGFIAPSINIExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00109         ------------------------------------------------------
PF02801         RHGVIPPNLNFD------------------------------------------