[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF67742.1

[Show Plain Result]


## Summary of Sequence Search
    1::643
   52::203     2e-21  48%  212 aa  PF01578 Cytochrom_C_asm "Cytochrome C assembly protein"
  125::218     2e-04  39%  495 aa  PF08616 SPB_interacting "Spindle pole body interacting protein"
    1::643

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01578         ----------------------------------------------------------------------
PF08616         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFLAFI
PF01578         ----------------------------------------------------------------------
PF08616         -----------------------------------------------------------------FFESV


                         +         .         .         .         .         *         .:210
query           LFTSGPFARTLPAFPVEGRDLNPLLQDPGLIFHPPLLYMGYVGFSVAFAFAIAALLSGRLDSAFTRFARP
PF01578         ----------LPVFPQEGAPLNPALQSPWLAIHVPLAYLGYAALAIGFLLALAYLLLTRRLKSLDRLSYR
PF08616         LFYNGPIKIPLASFPVGDYSLIKLIQDPALLTQKRIIFLGYAGEVCEFVLALCALASGGILRGFTRHAFP


                         .         .         .         +         .         .         .:280
query           WTLAAWVFLTLGIVLGSAWAYYELGWGGWWFWDPVENASFMPWLAGTALLHSLAVTEQRAGFKAWTLLLS
PF01578         WILIGFPFLTLGIILGAVWA--ELAWGGYWFWDPKETWSLITWLVYAAYLHLRITKGWRGRKAAW---LA
PF08616         YT--------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ICAFSLCLLGTFxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01578         ILGFLLLLLGYF----------------------------------------------------------
PF08616         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01578         ----------------------------------------------------------------------
PF08616         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01578         ----------------------------------------------------------------------
PF08616         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01578         ----------------------------------------------------------------------
PF08616         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01578         ----------------------------------------------------------------------
PF08616         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxx
PF01578         -------------
PF08616         -------------